0.38 önköltséges - MultiApro.com hirdetések - Ingyen apróhirdetés, egyszerűen több apróhirdető oldalra
Nincs találat .... Nézze meg kiemelt hirdétéseinket.

önköltséges

Az MS-METAL KFT. tevékenysége közé tartozik különböző acéltermékek, fémtömegcikkek gyártása, valamint ezen termékek értékesítése. Megrendelőink igényei alapján gyártunk különböző stancolt, hajlított vagy görgőzött, hegesztett lemezalkatrészeket, különböző polcokat, polcszerkezeteket, állványszerkezeteket, fali síneket, fali tartókarokat, valamint raktártechnikai elemeket és egyedi acéltermékeket. A gyártott termékek vasfoszfátos alapozással, elektrosztatikus vagy tribosztatikus porlakk ... további részletek >>

bevonattal készülnek. Termékeink segítségével minden tárolási probléma gyorsan és egyénileg megoldható. Tevékenységünk közé tartozik az álmennyezeti elemek gyártása és értékesítése, mely mind beltéren, mind kültéren használható. A méretválasztékból a kombinációs lehetőségeket kihasználva minden igényt kielégítő polcrendszer állítható össze, legyen az irodában, lakószobában, gyerekszobában, kamrában, garázsban. Ha vásárolni szeretne, válasszon webshopjaink közül!


Feladva: 2016-12-31    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: mindenkülönbözőközévalamintvagymindfaliértékesítésetermékekgyártásatartozikelemeketpolcszerkezetméretválasztékbólhegesztettporlakktevékenységePolc

Forrás: pepitahirdeto.multiapro.com

Falpanelt keresel? A legnagyobb választék falpanelekből a KERMA Design webáruházban: gipsz, farost, fa, pvc, cukornád, műbőr, polisztirol, poliuretán, beton falpanelek. Tervezés, gyártás, és kivitelezés! KERMA www.kerma.hu #falpanel #kerma #műbőr #design #burkolat #bőrpanel


Feladva: 2017-09-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kermadesignfalpanelműbőrakkorkereselburkolatpoliuretánFalpaneltpolisztirolDebrecencukornádKftpvcfarostfalwwwgipszkivitelezéswebáruházbanbeton

Forrás: pepitahirdeto.multiapro.com

Kérjük, hogy támogassák alapítványunkat, és így együtt segíthetünk azoknak, akiknek a lakhatása veszélybe került, vagy máris hajléktalanok. Ezzel hozzájárulhatunk emberi életfeltételeik minimumának megteremtéséhez. Köszönjük az utalást, megosztást és mindenféle segítő felajánlást! Erre az OTP számlaszámra várjuk a felajánlásokat: 11707000-20490166 (IBAN): HU73 1170 7000 2049 0166 0000 0000 SWIFT kód OTPVHUHB Adószám: 18739196-1-42


Feladva: 2016-10-29    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: 0000SzívNyugodtKöszönjükkódveszélybefelajánlásokatMagyarországmegteremtéséhezSWIFTlakhatásavárjukajánlóminimumánakakiknekszámlaszámraHirdető0166

Forrás: pepitahirdeto.multiapro.com

Kedvező áron vállalom I. osztályú kerítés lécek készítését kemény fából, légszáraz anyagból. A kerítéslécek 22 mm vastagságban, bármely marásmintával, gyalulva és csiszolva készülnek, igényes minőségben. Dísz- és élberakott kerítésléceket, lapkerítéseket, kutyaházakat készítek, a vásárló igényének megfelelően. Akár saját tervezés alapján is. Szállítás megegyezés szerint az egész országban. Hívjon bátran, vagy írjon!


Feladva: 2017-08-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: lécekkerítésosztályúmegegyezéslapkerítéseketvastagságbanlenadebora@gmailvállalomSzállításkerítésléceket22mmírjonáronalapjánÉlberakottkerítéslécekvagy

Forrás: pepitahirdeto.multiapro.com

Online kávé üzlet! Nemzetközi munkalehetőség kényelmesen otthonról! Új korszak az MLM üzlet történetében: A kezdőcsomagok árának 110-150%-a levásárolható www.kavekiraly.hu/blog-2014-12-22- DXN_DSP_Dynamic_Start_Program__A_ki t__B_kit__C_kit 70%-os heti bónuszkifizetés: www.kavekiraly.hu/blog-2014-12-01- DXN_DSP_Dynamic_Start_Program__Ingy enes_Ganoderma_kave_csomagok


Feladva: 2016-09-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kitwwwProgramStartDynamicDSPkávéDXNOnline2014blogkavekiralyüzletMLMGanodermaegészségesbónuszkifizetéskorszakIngyenesAkkorhetiotthonról150

Forrás: pepitahirdeto.multiapro.com

Eladó gondola és végzáró. Gondola: 32.000.-/fm (nettó) oldalanként 4 sor polccal Végzáró: 23.000.-/fm (nettó) 4 sor polccal Könnyen szerelhető, tisztítható. További információ: www.polcozzunk.eu


Feladva: 2016-10-10    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: VégzáróGondola000polcozzunkpolccalsornettówwwoldalankéntinformációTovábbiEladótisztíthatóSzigetszentmiklósszerelhetőpolcrendszerKönnyenfém

Forrás: pepitahirdeto.multiapro.com

Zárszerviz Budapesten non-stop elérhető Zárszerviz gyors szolgálat éjjel nappal várja hívását ha Zár probléma akadt. Budapest területén egy órán belül és kiszállási díj nélkül végezzük munkáinkat. Szolgáltatásaink: Zárszerviz Zárcsere Ajtónyitás Zárnyitás Betörés utáni helyreállítás Lakatos munka Hisec ajtó zárszerviz Kínai ajtó zárszerviz Műanyag ajtó zárszerviz Biztonsági ajtó zárszerviz Ha zár probléma akadt mi vagyunk a megoldás kulcsa! Rejtett ... további részletek >>

költségek nélkül garanciával állunk rendelkezésére az év minden napján. Bővebben: www.zarszervizmester.hu


Feladva: 2017-05-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: zárszervizajtózarszervizmesterakadtproblémazárnélkülköltségekhívásátMűanyagSzolgáltatásainkRejtettvárjaKínaimunkáinkatwwwkulcsanappalHisechttp

Forrás: pepitahirdeto.multiapro.com

FŐ-TEHERTAXI, budapesti tehertaxi szolgáltatás. Teherszállítók, fuvarozók, költöztetők, bútorszállítók, rakodók. Fuvarosok Budapesten, házhoz szállítás akár azonnal. Pianínó, páncélszekrény szállítók.


Feladva: 2015-09-13    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: tehertaxiBudapest06309404757bútorszállítókbútorszállításszállítókköltöztetőkfuvarozáspáncélszekrényfuvarozókPianínóTeherszállítókazonnalszolgáltatásakár

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Alsóörsi kiadó szálláshelyek fényképes gyűjtőoldala. Panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Több mint 100 fényképpel a szálláshelyekről és a településről! - SZÉP kártyát elfogadó szálláshelyek Alsóörsön - Egész évben nyitva tartó (kiadó) szálláshelyek - Weboldal: www.zimmerinfo.hu/alsoors/hu.htm


Feladva: 2017-05-04    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfomintapartmanokévbenTöbbnyaralóházakEgésznélkülvillákAlsóörsöndíjhtmvendégházakelfogadóközvetítésialsoorsPanziókkártyát

Forrás: pepitahirdeto.multiapro.com

Nyugtató-lazító hatás: a test átmelegszik, könnyeddé válik az idegek kisimulnak az izmok ellazulnak az idegrendszer megnyugszik a vér- és nyirokkeringés megélénkül javul a sejtek oxigén- és tápanyagellátása salak- és méreganyagok kiválasztása hormonális hatás (érintésre a szervezet endorfin és oxitocin hormont állít elő, amelyek a test saját stressz- és fájdalomcsillapító szerei).


Feladva: 2015-08-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatástestméreganyagokpozitívellazulnakelőNagysalakhogyizmokállítmasszástápanyagellátásacéljakisimulnakhormontrelaxációsoxigénvégzőidegekválik

Forrás: pepitahirdeto.multiapro.com

Egyedi, megnyugtató környezetre vágyik? Színes hétköznapokra és egy kis romantikára? Vigyen az életébe egy csipetnyi csodát led csillárokkal! Kényelem a távirányító használatával és megannyi szín, mintázat, egyedi és különleges formavilág! Nézze ezt a fénytörést, mint valami varázslat… Energiatakarékos, színváltó led csillárok automata fényerő szabályozással, ajándék távirányítóval és garanciával!


Feladva: 2013-10-27    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: csillárokWebáruházledkülönlegesegyCsodafényegyedifénytöréstKényelemvágyikfényerőeztcsillárokkalkörnyezetreautomataNézzecsodátmegnyugtatócsipetnyi

Forrás: pepitahirdeto.multiapro.com

Eladó XVI. Kerületben, egy 6-lakásos társasház alatt, főútvonalon, az Örs vezér tér közelében (Nagyiccén) 20 m2-es, komfortos garázs WC-vel, mosdóval, saját vízórával és villanyórával. Két ablak nyílik a főútvo-nalra. A billenő garázsbejáraton még egy külön nyitha-tó személybejárat is van. Ára: 3.900.000.- Ft. Tel: 06302226247


Feladva: 2017-09-24    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egyvelTellakásosbillenőgarázs000Kerületbennalrakomfortos900XVIfőútvoNagyiccénÁraEladónyílikközelébenvanBudapestablaktérszemélybejárat

Forrás: pepitahirdeto.multiapro.com

Az MSZP elnökségében úgy döntöttek, egyeztetnek a volt külügyminiszterrel. Felmerült Balázs Péter volt külügyminiszter neve mint ellenzéki közös miniszterelnök-jelölt, ám erről egyelőre nincs megállapodás. A teljes cikk: www.hvg.hu/itthon/20171031_Leulne_ az_MSZP_Balazs_Peterrel


Feladva: 2017-10-31    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: MSZPvoltPeterrelBalázsLeulnemegállapodásPepitanincsPéterBalazskeresikegyelőreSokanerrőlFelmerültjelöltkülügyminiszterrel20171031miniszterelnök

Forrás: pepitahirdeto.multiapro.com

Személyi adó-vevő -8 km hatótáv környezettől és tereptől függően -304 csatorna-kombináció (8 fő és 38 alcsatorna) -További 83 DCS kód -Kivilágított kijelző -Állítható hangerő -15 választható hívásjelző hang -VOX -Elemkimerülés-jelző -Automatikus zajszűrő Roger Beep ON/OFF Microfon/fülhallgató/töltés csatlakozó Billentyűzár www.stacioshop.hu/?id=7d1819e0538f 4eddb4d675498f5da787&p=termeklap&tk od=8566


Feladva: 2017-10-15    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: vevőadókijelző7d1819e0538f4eddb4d675498f5da787környezettőlzajszűrőSMRKivilágítottstacioshophatótávAutomatikusSencorkódwwwjelzőDCSBillentyűzárVOX

Forrás: pepitahirdeto.multiapro.com

Ha szeretné, hogy az elromlott számítógépe, laptopja a lehető legrövidebb időn belül újra hibátlanul működjön, hívja szervizünket! Díjmentesen házhoz megyünk Debrecenen belül! A hét minden napján 0-24h rendelkezésre állási idővel! Szolgáltatásaink: - Helyszíni karbantartás, Hibaelhárítás, tanácsadás, elromlott alkatrész beszerzése, cseréje, javítás - Vírusirtás - Rendszerköltöztetés - Windows újratelepítés (XP,7.8.10) - Számítógép sebesség növelés, rendszer optimalizálás - ... további részletek >>

Vezetékes, vagy vezeték nélküli hálózati eszközök pl. nyomtató hálózatba kötése - Otthoni vagy munkahelyi számítógépes hálózat kiépítése, bővítés - Komplett céges és irodai rendszerek karbantartása - Adatmentés sérült, törölt vagy hibás partíción lévő adatokról - Törölt fájlok visszaállítása - Számítástechnikai - informatikai eszközök és termékek forgalmazása - Weblap és Webshop készítése rövid határidővel


Feladva: 2017-08-24    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: vagyeszközökelromlottSzámítógépbelülTöröltSzolgáltatásainkKomplettházhozWebshopnélküliVírusirtásszámítógépelévőidővelbővítésDíjmentesenWeblaphogy

Forrás: pepitahirdeto.multiapro.com

AKAI PHA-2880 mobiltelefon DUAL - sim - 7.990 Ft. ÚJ, garanciális készülék! www.techdiszkont.superwebaruhaz.hu /akai-pha-2880-mobiltelefon-dual-si m-t464754


Feladva: 2017-04-07    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: techdiszkontakciówwwTelefonkészülékgaranciális990simDUALmobiltelefon2880PHAsuperwebaruhazAKAI

Forrás: pepitahirdeto.multiapro.com

Hajcica Agency oldalán minden egy helyen! Nézzen be hozzánk, fantasztikus kínálat hostess, táncos hölgyekből, chippendale fiúkból, show műsorokból. Megszervezzük esküvőjét, szülinapi meglepetés buliját, vagy bármilyen céges rendezvényét teljes szervizeléssel! Rendeljen tőlünk! Kedvezményeink egyediek, az Ön igényeinek megfelelően. Rugalmasak vagyunk, hiszen a legfontosabb dolog: A MEGRENDELŐ-nek megfelelni, hogy visszajöjjön!


Feladva: 2014-12-24    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hajcicaagencymegfelelnihostesskedvezményeinkProdukciósmeglepetésnekkínálatfolyamatosanszervezéseszülinapiMEGRENDELŐfantasztikustőlünkrendezvényekcom

Forrás: pepitahirdeto.multiapro.com

Eladó bazalt, andezit kockakő új és bontott állapotban. 10x10, 20x20-as méretekben. 4500 Ft/m2 ártól. Érdeklődni telefonon lehet: 06705887417


Feladva: 2017-05-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kockakőBazaltEladólászlóméretekben20x2010x10állapotbanbontott06705887417lehetAndezittelefononÉrdeklődniártólBudapest4500ft

Forrás: pepitahirdeto.multiapro.com

Költöztetéssel, szállítással, megrendelőink nagy megelégedettségére! Tevékenységünk köré tartozik a Pianínó és Zongora szállítás is. Bízunk benne hogy minket választ. Kérem tekintse meg a költöztetés kalkulátorunkat, amivel ön előre ki tudja számítani a költöztetés árát! Nem csak Budapesten, hanem Vidéken is költöztetünk.A Költöztetés Budapest oldalon, További Információ: www.koltoztetesbudapest.eu vagy www.pianinoszallitas.eu Főbb tevékenységi területeink: Budapest, Budaörs, Budakalász, ... további részletek >>

Budakeszi, Dunakeszi, Dunaharaszti, Érd, Fót, Göd, Gödöllő, Gyál, Halásztelek, Kistarcsa, Mogyoród, Nagytarcsa, Őrbottyán, Pécel, Pilisvörösvár, Pomáz, Ráckeve, Szentendre, Szigethalom, Szigetmonostor, Szigetszentmiklós, Tököl, Törökbálint, Üllő, Vác, Vecsés, Veresegyház.


Feladva: 2017-02-26    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KöltöztetésBudapestwwwVácTevékenységünkPécelcsakDunaharasztiválasztÜllővagymegelégedettségéreŐrbottyánNemDunakesziminketTörökbálintnagyNagytarcsa

Forrás: pepitahirdeto.multiapro.com

Továbbá gyártunk különböző méretű, huzalvastagságú horganyzott és műanyagos drótfonat, vadvédelmi háló, vadháló, tüskéshuzal, tüskésdrót, szögesdrót, vezérdrót, kerítés háló, kerítésháló, feszítőhuzal, feszítő huzal, kerítésdrót, tüskés szöges vezér drót, vadkerítés, kerítés építés, kerítésépítés, kerítésfonat ,kiskapu, nagykapu, huzalfeszítő csavar, vibropréselt zsalukő, lábazati elem, fémoszlop, faoszlop, natodrót nato drót, fém fa beton kerítés oszlop, kerítéspanel, kerítéselem, kutyakennel, ... további részletek >>

drótháló, drótkerítés, kis nagy vas kapu, kutya kennel, szőlőoszlop, kerítésoszlop, betonoszlop, kutya kenel, szőlőkaró, kutyakenel, szőlő oszlop karó. Vállalunk az ország egész területén vadhálóval, vagy dróthálóval komplett kerítésépítést 1000 Ft/m áron. (Csak drótkerítéseket és vadvédelmi kerítéseket építünk, fakerítést nem!!!)Rengeteg terméket gyártunk és forgalmazunk a kerítésdróton és betonoszlopokon kívül, amit egy hirdetésben nehéz lenne felsorolni, ezért kérem, látogasson el honlapunkra www.kerites.hupont.hu oldalra, vagy telephelyünkre, a KÓTAJI DRÓTFONAT, VADHÁLÓ és BETONOSZLOP CENTRUMBA ahol személyesen akár további kedvezményekre is van lehetőség.


Feladva: 2017-05-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keriteswwwvadvédelmibetonBETONOSZLOPdrótVADHÁLÓDRÓTFONAToszlopgyártunkhálóvagyhupontkutyakerítéseketkerítéspaneltüskéshuzalaholegészkívülfém

Forrás: pepitahirdeto.multiapro.com

KAMIONOS állásunk van Rosenheim környékén Általános infóink a sofőr állásokról: www.nemetmunka.hu/sofor.html Konkrétumok- SOFŐR Szerződött Bajor Speditőr partnerünk (NEM Zeitfirma, nem török, román, stb- hanem német cég) részére keresünk gépkocsivezetőt CE jogosítvánnyal és 95-ös bejegyzéssel és a kamionos álláshoz szükséges némettudással. Próbamunka nincs. Személyes állásinterjú után azonnali munkakezdés van. A telephely egy Rosenheimtől nem messze lévő faluban van. A fizetés ... további részletek >>

2000-2200€ bruttó. A cég Németországi és Olaszországi fuvarozást végez. A napidíj Németországi fuvaroknál 24€/nap nettó, Olasz fuvaroknál 34€/nap nettó. A fizetés és a napidíj együtt adókategóriától és fuvaroktól függően kb. 1800-2000€ nettóra jön ki. A telephely és Budapest között kb 600km a távolság. Hétvégi hazautazás gyakorlatilag 2 hetente lehetséges, mert az egyik héten 2 fuvar van hétfőtől péntekig, a másik héten pedig 3 fuvar van hétfő kora reggeli indulással és szombat délelőtti visszaérkezéssel. Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1./ E-mailben: info@nemetmunka.hu 2./ Ingyenes regisztrációval a következő linkre kattintva: www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3./ Telefonon munkaidőben a magyar 06 1 920 3433 ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9,00-17,00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs)


Feladva: 2017-10-14    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: Németvan8364SOFŐRnemnemetmunkawwwkamionoscégtelephelyMunkafizetésnettóhtmlnincsnapfuvaroknálmailben2000péntekigvagyhétfőtőlNémetországi

Forrás: pepitahirdeto.multiapro.com

Budapest és Pest megye egész területén vállalunk üvegezési munkát, rövid határidővel, helyszíni beépítéssel, biztosító által elfogadott számlára is. Ha ön betöri mi beüvegezzük! Ha ön megfesti mi bekeretezzük! Szolgáltatásaink: - Üveg, tükör - Bútorüveg - Hőálló és hőszigetelt üveg - Edzett és hajlított üveg - Akvárium, terrárium - Üveg zuhanyajtó - Üvegfalak Telefon:061 426 74 56 Mobil.06 30 262 85 91 06 70 933 78 21


Feladva: 2017-02-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: ÜvegüvegezésimegyePestBudapestÜvegfalakazuvegesekSzolgáltatásainkhatáridővelzuhanyajtómegoldásokbekeretezzükrövidÜvegezésmegfestimunkátterrárium933

Forrás: pepitahirdeto.multiapro.com

Kéményajtó légbevezető, forgalmazása, beépítése és egyéb légtechnikai rendszerek kiépítésével foglalkozunk. Termékeink megvásárolhatók webáruházunkban, a www.kemenyajto.com oldalon


Feladva: 2013-10-25    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kemenyajtoforgalmazásalégbevezetőhttpWebáruházunkbanbeépítésmegvásárolhatókTermékeinkfoglalkozunkkiépítésévelrendszereklégtechnikaioldalonegyébcom

Forrás: pepitahirdeto.multiapro.com

Pihenjen, üdüljön, kapcsolódjon ki nálunk és szülessen újjá a helyi Zsóry Gyógy-és Strandfürdőben, ami a szó szoros értelmében egy kőhajintásnyira van a Csilike apartmantól. Akcióinkról tájékozódjon a weboldalunkról: www.csilikeapartman.hu


Feladva: 2017-02-28    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: CsilikeáronkőhajintásnyiraszülessenjótegynálunkcsilikeapartmannyáronértelmébenkapcsolódjonwwwTélenszorosüdüljönhttpszóPihenjenweboldalunkrólami

Forrás: pepitahirdeto.multiapro.com

Napelem Akció! Válasszon Canadian Solar napelemeinkből most igen kedvező áron. 270W CS6K-270P 37.700Ft + Áfa (Bruttó: 47.879Ft) + termékdíj 2075Ft/napelem + Áfa. Akció a készlet erejéig tart! Érdeklődés esetén hívja: +36304700199 számot!


Feladva: 2017-06-27    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: AkciónapelemÁfaszámot2075Ftmost36304700199termékdíjnapelemeinkbőlhívja879FtSolareseténBruttóCanadianÉrdeklődés700FtVálasszontart270PDebrecen

Forrás: pepitahirdeto.multiapro.com

Szeretné, ha a 2017-es év sokkal jobb lenne, mint eddig bármelyik? Különleges Vásárlási Tanácsadói területre keresünk értelmes, segítő szándékú embereket kimagasló jövedelmi lehetőséggel!!! Többet kereshet vele, mint egy bankigazgató!!! A munka otthonról is végezhető szabad időbeosztásban! Ingyenes képzés, sőt mi adunk 12.000,- forintot ajándékba!! A feladat, az embereket megtanítani a tudatos és felelős vásárlásra, és információkkal segíteni őket pénzügyi problémáik megoldásában! Nem adunk el ... további részletek >>

semmit MLM rendszerben, nem kell befizetnie semmit sem, és nincsenek kötelezettségei! Magyarországon hiányszakma a Vásárlási Tanácsadó, miközben a legmagasabb jövedelmeket ezen a területen lehet elérni, ráadásul, nem is nehéz munka, és még a képzés is ingyenes!Magyarországon Törzsvásárlói Rt.-hez keresünk Tudatos Vásárlási Tanácsadó szakmai referens munkatársat. Magyarországon hiányszakma a Vásárlási Tanácsadó, miközben a legmagasabb jövedelmeket ezen a területen lehet elérni, ráadásul, nem is nehéz munka, és még a képzés is ingyenes! Az is köztudott, hogy óriási problémát jelent az első lakáshoz jutás, a nyugdíjkérdés, és a magas színvonalú taníttatás! A Vásárlási Tanácsadók ezekre a problémákra is megadják a megoldást! Köztudott, hogy Magyarországon több mint 100 milliárd forint értékű élelmiszert dobunk ki a kukába évente, mert az emberek nem tudnak tudatosan és felelősen vásárolni. Az is köztudott, hogy óriási problémát jelent az első lakáshoz jutás, a nyugdíj kérdés, és a magas színvonalú taníttatás! A Vásárlási Tanácsadók ezekre a problémákra is megadják a megoldást!Mindannyian ismerünk olyan embereket, akik jómódúak, de nincs IDEJÜK. Mindannyian ismerünk olyan embereket, akiknek sok idejük van, de nincs PÉNZÜK. IDŐT és PÉNZT Szerezhet egy nagyszerű üzleti koncepcióval! ”Minden perc egy új esély arra, hogy mindent megváltoztass!” Ha nem is leszünk szuper gazdagok, azért jó tudni, hogy nagyon jó úton haladunk! Ön is jöhet velünk ezen az úton! Keressen bizalommal kérdéseivel! Karrierlehetőség: • kiemelkedő, teljesítményarányos jövedelem • életpálya program • szakmai oktatások • biztos háttér • gépkocsi támogatás • bónuszok A Vásárlási Tanácsadók feladata, hogy olyan plusz pénzeket tegyenek az emberek zsebébe, amely eddig is meg volt, de senki nem jutott hozzá, mert nem tudta, hogyan kell! Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet!


Feladva: 2017-01-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemVásárlásihogy8226embereketmegmintMagyarországonköztudottolyanezenTanácsadókeddiglegmagasabbingyenesegyTanácsadóképzésmunkaszínvonalúúton

Forrás: pepitahirdeto.multiapro.com

Évjárat: 2013/07 Állapot: Megkímélt Kivitel: Ferdehátú Futott kilométer: 97253 km Műszaki vizsga érvényessége: 2019.07.02 Üzemanyag típusa: Benzin Hengerűrtartalom: 1596 cm3 Teljesítmény: 117 kW / 160 LE Sebességváltó: Manuális 6 fokozat Belső felszereltség: CD-s rádió, elektromos ablak, elektromos tükör állítás, állítható kormány, multikormány, ülésmagasság állítás, elektromos ülés állítás, bluetooth-os kihangosító, vezetőoldali légzsák, utasoldali légzsák, oldal légzsák, ... további részletek >>

függönylégzsák Műszaki felszereltség: ABS, ASR, ESP (menetstabilizátor), szervokormány, immobiliser,központi zár Külső felszereltség: metálfény, színezett üveg, ködlámpa Még jobb választás, mert... Magyarországi, rendszeresen karbantartott, keveset futott, nem dohányzó, garázsban tartott, szerviz könyv, első tulajdonostól MAGYARORSZÁGI LEINFORMÁLT GÉPKOCSI KILOMÉTER GARANCIÁVAL! www.autodual.hu/index.fcgi?rx=&menuparam5=20&item=340_1#item


Feladva: 2017-09-28    [Autó - Motor - Jármű]

Címkék, kulcsszavak: légzsákállításelektromosfelszereltségKILOMÉTERfutottMűszakiitemMAGYARORSZÁGI97253tulajdonostólkormánySCTirendszeresenTeljesítménymenuparam5zároldal

Forrás: pepitahirdeto.multiapro.com

Klasszikus és modern olasz konyhabútorok nagy elemválasztékával várja Önt a Lineaflex Olasz Bútoráruház és Ágybetét Stúdió.


Feladva: 2016-09-02    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: OlaszBútoráruházLineaflexÖntvárjaelemválasztékávalnagykonyhabútorokmodernStúdióKlasszikusÁgybetétkerBudapestkonyhabútor

Forrás: pepitahirdeto.multiapro.com

Kárpitozás. Teljes vagy részleges kárpitozás autó utasterében. Bőr, műbőrbevonatokkal történő javítási munkák, ill. teljes belsőtér kárpitozás. Kormánybőrözés, műszerfalbőrözés, ajtókárpitbőrözés, tetőkárpitozás,ülés javítás, utastér kárpitbőrözés és műbőrkárpitozás. Lakóbusz kárpitozás. Lakóautó - lakókocsi kárpitozás, műbőrkárpitozás, bőrkárpitozás, kárpitjavítás. Helyszíni ki és visszaszereléssel is. Kéz és lábáploló szalonok pedikűrszékeinek újra kárpitozása. Kozmetikai, tetoválószék ... további részletek >>

kárpitozás. Fogászati székek újra kárpitozása. Konditermek kondigépeinek újrakárpitozása, továbbá pubok, éttermek boxainak újra kárpitozása, szivacsolása. Masszázságy, ill. sportklubok gyúrópadjainak újrakárpitozása. E mail: carleathering@gmail.com Tel.: +36209313164


Feladva: 2017-02-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: kárpitozáskárpitozásaújraújrakárpitozásaillbőrkárpitozásműbőrkárpitozásteljespedikűrszékeinekKárpitoscarleathering@gmailLakóbuszéttermekmunkákszalonok

Forrás: pepitahirdeto.multiapro.com

A hyaluronsavas ráncfeltöltés a Bionic Lifter segítségével egyedülállóan hatékony. A Washingtoni Egyetem vizsgálata szerint hatására a bőr elasztin tartalma 45%-kal nő, ami hihetetlen eredmény a bőrfeszesítés szempontjából. A hyaluronsavas ráncfeltöltés nagyon gyengéd és kíméletes módszer. A természetes hatóanyagok bőrbe juttatása nem injekcióval, hanem egy speciális technológiával, az iontoforézissel történik. Ez a forradalmi újítás teszi lehetővé, hogy a bőr mélyebb rétegeibe is eljusson a ... további részletek >>

nedvességmegkötésben verhetetlen hyaluronsav. Hyaluronsavas ráncfeltöltés árak itt!


Feladva: 2017-07-17    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: ráncfeltöltésHyaluronsavasbőrhatásárarétegeibespeciálisKellérgyengédszerintmélyebbegynagyonvizsgálatahanemszempontjábólitthogyEgyeteminjekcióval

Forrás: pepitahirdeto.multiapro.com

Kútfúrás. Engedélyes kutak fúrása. Víznyelők fúrása kedvező áron! Bízza szakemberre! Tökölön, Dunaharasztiban, Soroksáron. Kézi és gépi kútfúrás. Csepel-szigeten és környékén. Budapesten és környékén. Szentendrei szigeten, Pest megyében. Minőségi anyagokkal és szűrőkkel. SZAKMUNKA, precíz kivitelezés, megfizethető árak. Cső átmérő: 40 mm-től 125 mm-ig. Hívjon bizalommal!


Feladva: 2014-09-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kútfúrásfúrásamegyébenPestszigetenMegfizethetőkörnyékénáronkedvező9642PrecízCsepelbizalommalSZAKMUNKAVíznyelőkHívjonszűrőkkelgépikutak125mm

Forrás: pepitahirdeto.multiapro.com

Olcsó új gyerekruhák és játékok! Gyerekruhák bébi, gyerek és kamasz méretekben, bébi kiegészítők nagy választékban. Több mint 10.000 gyerekjáték a bébitől egészen 12 éves korig. Személyes átvétel Budapesten, házhoz szállítás az ország egész területén.


Feladva: 2016-03-27    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: GyerekruhákbébijátékokOlcsóJátékBudapestenválasztékbanátvételnagySzemélyeskiegészítőkkorigkpjatekévesméretekbenwwwegészenkamaszterületénbébitől

Forrás: pepitahirdeto.multiapro.com

Asztali sörcsapolók, hogy mindig legyen hideg sör a vendég előtt! Kell-e bármit még mondani ahhoz, hogy ellátogasson a honlapunkra?


Feladva: 2017-07-15    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hogysörcsapolókAsztalimégDebrecenbármitajánlóKellHirdetőelőttPepitavendégsörhonlapunkrahidegellátogassonlegyenmindigahhozmondani

Forrás: pepitahirdeto.multiapro.com

Készülj fel a nyelvvizsgára otthon kényelmesen, a saját időbeosztásoddal. Heti egy alkalommal kérhetsz tanári segítséget is személyesen vagy skype-on. www.eszperanto-tanfolyamok.hu


Feladva: 2017-03-22    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: segítségetfeltanáriKészüljkérhetszFerencalkalommalHarnyosegytanfolyamHetieszperantótanfolyamokidőbeosztásoddalInterneteseszperantosajátskypevagy

Forrás: pepitahirdeto.multiapro.com

A Makulátlan Tiszta Terület Kft., Panoráma ablak, a PVC, a Parketta, a Felújítás utáni, A szőnyeg mély tisztítása, az Irodai eszközök tisztítását, a Zsíros kézmosó, a Boltíves üvegtető, a Lépcsőházi takarítás, a Kazánház takarítása, a Sportlétesítmény, a Kirakattisztítás, a Nagy felületű ablak tisztítása, a Mohás terasz takarítása, az Éttermi asztal tisztítása, a Maszatos, csíkos padló tisztítását a Gumicsík eltávolítását, a seprést, a Domború burkolatok, az Irodaház ablakainak tisztítását, az ... további részletek >>

Olajozott parketta tisztítását, a Garázs tisztítását, mind kihívásnak tekinti, és örömmel végezzük el.


Feladva: 2016-11-16    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tisztításáttisztításaMakulátlanparkettatakarításaKftTerületablakTisztafelületűeszközökpadlóNagyGarázsIrodaicsíkoskerületKirakattisztításmélyPVC

Forrás: pepitahirdeto.multiapro.com

Az igazi kárpitozott autós ágy, fülkével, kormánnyal, matraccal. Egyedi kivitelezés személyre szabott forma. Uniós formatervi védelem alatt. Könnyen átalakítható. Minden felületen puha szivacs, melyen választható a kárpit bevonat. - Traktor autós ágy - Vonat autós ágy - Pick-up autós ágy - Dömper autós ágy - Tolólapos autós ágy www.atalakulok.hu/autosagyak


Feladva: 2017-10-23    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: ágyautóskivitelezésDömperMindenEgyediPickátalakíthatómatraccalVonatKönnyenkormánnyalTraktoralattfülkévelbevonatvédelemkárpitozottkárpitigazi

Forrás: pepitahirdeto.multiapro.com

Zeneszeretõ - Bakelit rajongók figyelmébe! Az Audió Design Studió hosszú évek óta foglalkozik hangrestaurálásal. A stúdió vállalja minden tipusú hanganyag rendbe hozatalát, archív hangzók feljavítását ujra masterelését. Bakelit lemezek, kazetták, professzionális szinten történõ átirása, zajmentesítése az az, a hangzó anyagok restaurálása, digitális technológiával úgy , hogy a kész anyag megegyezzen az eredeti hangzással. Ne hagyja, hogy kincsei kárba vesszenek!


Feladva: 2017-10-09    [Zene - Hangszer]

Címkék, kulcsszavak: stúdióDesignBakelithogy245anyagévektörténátjátszáshozatalátkészhosszúszintenhangjavításrendbeúgyprofesszionálisDigitalizálásvesszenekhanganyag

Forrás: pepitahirdeto.multiapro.com

AZ LC-32HG3142E EGY HD Ready LED TV KIVÉTELES KÉPMINŐSÉGGEL Active Motion 100 A HAGYOMÁNYOS LCD HOMÁLYOS JELENETEKET EREDMÉNYEZHET. ACTIVE MOTION HATÁSOSAN ÉLESÍTIT A MOZGÓKÉPEKET TOVÁBBI KERETEK ADVA A KÉPHEZ AZ ERŐTELJES GRAFIKAI PROCESSZORNAK ÉS GYORS LCD PANELNEK KÖSZÖNHETŐEN. Dolby Digital/ Dolby Digital+ audio DTS Tru Surround A DTS TECHNOLÓGIA VIRTUÁLIS SURROUND MOZI JELLEGŰ HANGHATÁST EREDMÉNYEZ. PVR KÖNNYEDÉN FELVEHETI KEDVENC PROGRAMJAIT ÉS FILMJEIT KÜLSŐ USB ... további részletek >>

VAGY MEREVLEMEZRE 3x HDMI CSATLAKOZTASSA ÖSSZES DIGITÁLIS AUDIO/VIDEO ESZKÖZÉT, MINT BELTÉRI EGYSÉG, JÁTÉKKONZOL VAGY BLU-RAY LEJÁTSZÓ KÖNNYEDÉN TÉVÉJÉHEZ 2x USB CSATLAKOZTASSA USB STICKJÉT VAGY MEREVLEMEZÉT A KÉSZÜLÉKHEZ, ÖSSZES ZENÉJE VAGY FILMJE ÉLVEZÉSÉHEZ További információ: www.adivstore.com/szorakoztato-elektronika/tv/796/sharp-lc-32hg3142e-80cm-es-hd-ready-led-tv


Feladva: 2017-07-11    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: VAGYUSBledready32che4042eDTSCSATLAKOZTASSADigitalTovábbiDolbyAUDIOKÖNNYEDÉN80cmLCDMOTIONsharpSURROUNDÖSSZESACTIVEEGYSÉGGRAFIKAIPROGRAMJAIT

Forrás: pepitahirdeto.multiapro.com

Havi egy főzéssel a hónap minden napján meleg ételt varázsolni az asztalra, anélkül, hogy hosszú órákat töltenél minden nap a konyhában? Igen, lehetséges! Válaszokat, segítséget az oldalon találsz!


Feladva: 2017-01-20    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: HaviegyfőzésmindenoldalonhogysegítségetanélkülVálaszokatasztalralehetségesvarázsolniIgenételtkonyhábanmelegnapnapjánhónaptöltenélfőzéssel

Forrás: pepitahirdeto.multiapro.com

14 év iskolai angol tanítás után rádöbbentem, hogy csak egy helyben toporgok, nem jutottam közelebb a céljaimhoz. Elegem lett a hónapról-hónapra élésből, ezért elkezdtem keresgélni, mit is lehetne tenni annak érdekében, hogy több pénzt keressek, és több szabadidőm legyen. Ekkor találkoztam a Ganoderma kávéval a DXN online üzlet keretében. Bárki tudja csinálni és komoly befektetés nélkül elkezdhető, mindenféle diploma és előképzettség nélkül. Engem nagyon megfogott a személyre szabható honlap ... további részletek >>

is, amit a csatlakozáskor kaptam: http://kavekiraly.hu/uzleti_lehetoseg Rólam bővebben itt olvashatsz a honlapomon: http://kavekiraly.hu/az_en_tortenetem Csatlakozni itt tudsz: http://kavekiraly.hu/member_registration_private Keress bátran, ha kérdésed van: http://kavekiraly.hu/kapcsolat


Feladva: 2016-10-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kavekiralyhttptöbbnélkülhogyittszabhatólehetnevankomolyközelebbhonlapomonEkkoriskolaiszemélyremitkérdésedcsinálnijutottamolvashatszlegyen

Forrás: pepitahirdeto.multiapro.com

Kiadó próbatermek Csepelen! Érdeklődni: telefonon!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: próbatermekKiadóÉrdeklődniCsepelenBudapestTulajpróbateremtelefonon

Forrás: pepitahirdeto.multiapro.com

2 szoba, 4+3 fő (ágyneműt biztosítunk), nappali+étkező, felszerelt konyha, hűtőszekrény, gáztűzhely, mikrohullámú sütő, kávéfőző, tusolós fürdőszoba, WC, klíma (hűtés-, fűtés), TV, jakuzzi, kandalló (fa díj ellenében biztosítva), füvesített kert, parkoló, 12 nm-es móló+csónak, horgászatra, fürdésre, fedett terasz, hintaágy, kerti bútorok, bográcsozás, grillezés (tűzifát igény esetén biztosítok!), gyerekeknek homokozó, lengőteke, fürdőmedence bérlési lehetőség, 3db kerékpár is biztosított!


Feladva: 2016-07-20    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kandallóbiztosítokhűtőszekrényfürdésreKöröspartihorgászlakjakuzzieseténkonyhahorgászatrabiztosítottfűtésigényfelszereltcsónakkerékpárhűtéstűzifát

Forrás: pepitahirdeto.multiapro.com

Egyedi, minőségi, széleskörűen testre szabható kutyaházak többféle méretben és kivitelben. Egyéni elképzelések megvalósítása. Szigetelt, akár fűtött kutyaházak gyártása... Számos választható extra felszereléssel!


Feladva: 2017-07-06    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: kutyaházakgyártásaminőségiEgyediszabhatótestrefűtöttszéleskörűenakárSzigeteltmegvalósításaajánlóelképzelésekHirdetőfelszerelésselEgyéniPepitaextra

Forrás: pepitahirdeto.multiapro.com

Szeretnél egy könnyen megjegyezhető domain nevet és egy weboldalt? Esetleg tetszenek a rövidebb, pár betűből álló domain kombinációk? Vagy egy régi, koros domainnel szeretnéd segíteni a weboldaladat, hogy már az elején előnnyel indulj a többi lappal szemben? Bővebb információ és az eladó weboldalak teljes listája itt tekinthető meg: www.eladhatatlan.hu/elado-domain-w eboldal


Feladva: 2016-04-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: domainegyeladóweboldalakweboldalbetűbőlakciósanweboldaladatpárinformációneveksegítenieladorövidebbBővebbszeretnédeladhatatlantetszenekszemben

Forrás: pepitahirdeto.multiapro.com

Adj esélyt az óriási nyereményeknek! Akár 3,5 milliárd Ft nyeremény! * Naponta új nyerési lehetőségek * Alacsony részvételi díj - akár ingyen is! * Könnyen, otthonról játszhatsz


Feladva: 2017-09-21    [Pénzkeresés - MLM]

Címkék, kulcsszavak: akáresélytAdjlehetőségekPepitanyerésiszerencsédnekNapontajátszhatsznyereményotthonrólmilliárdKönnyennyereményeknekingyenóriásidíjrészvételiajánló

Forrás: pepitahirdeto.multiapro.com

Béreljen, vagy vegyen! Miért éri meg a Fiscal Online pénztárgépet választani? - Kisméretű - Akkumulátoros - Érintőkijelzős - Könnyű, gyors papírcsere - Kis és közepes forgalmú üzletekben megállja a helyét - Felhasználó barát kezelés - Végösszeg korlát az elütések elkerülése végett - Nyugta sztornó, hogy felejtse el a sztornó füzetet - Átszemélyesíthető A bérlésről itt olvashat többet: ... további részletek >>


Feladva: 2017-07-11    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: sztornópapírcsereéribérlésrőlVégösszegATCgyorsMiértÁtszemélyesíthetőkezelésakcióKönnyűvegyenfüzetetbarátPénztárgépÉrintőkijelzősvagyFelhasználó

Forrás: pepitahirdeto.multiapro.com

Nyaralás, üdülés Abádszalókon a Tisza-tónál a családias hangulatú Zöld Wellnessházban. Beltéri fűtött medence, jakuzzi, finn-infra szauna, masszázs, kábel TV, minibár, napozókert, napozóágyak, zárt parkoló. Árak: 3.500-7.000 Ft-ig. Csónak-kenu, kerékpár túrák, Böllér fesztivál, majd Kompér fesztivál, koncertek, előadások, stb ... Társaságoknak, meetingek, továbbképzések részére is kiadó! Programok és akciók a honlapon!


Feladva: 2016-01-25    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: ZöldfesztiválAbádszalókképzésektúrákszállás36202946410kábeltovábbhangulatúkerékpár36208028955masszázsmítingekcsaládiaskenuzoldwellnesshazszauna

Forrás: pepitahirdeto.multiapro.com

Grundig Vch 9131 2-in-1 14.4V típusú akkumulátoros porszívó. - Nagy teljesítményű és hosszú élettartamú 14,4 V-os NiMH újratölthető akkumulátor - Nagy teljesítményű elektromos kefe - Működési idő: Kb 25perc - Portartály: 500ml - Hatékony szűrőrendszer ciklontechnológiával és mosható HEPA szűrővel - Kivehető morzsaporszívó - Számlával, fél év jótállással és 14 napos pénz visszafizetési garanciával. Ingyenes házhoz szállítással megrendelhető az alábbi linken: ... további részletek >>


Feladva: 2017-09-18    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: akkumulátorosporszívó9131teljesítményűVchNagyGrundigporszivokIngyenesKivehetőakkusMűködésiházhozszűrővelkefetípusúszállítássalHEPAelektromoswww

Forrás: pepitahirdeto.multiapro.com

Budapest chiptuning az élen.


Feladva: 2017-01-30    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BudapestchiptuningJánosFontosautochipélen

Forrás: pepitahirdeto.multiapro.com

Ingatlanok A-tól Z-ig: mint az oldal neve is mutatja, várjuk az ország minden részéből az ingatlant eladni, venni, kiadni vagy bérelni kívánó ügyfelek hirdetéseit. Regisztráció után egy házhoz akár tíz kép is feltölthető, és több hirdetés is feladható. Magánszemélyeknek és ingatlanirodáknak egyaránt ajánljuk az új hirdetőoldalat.


Feladva: 2016-01-21    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: tólIngatlanokmindenfeladhatóTormahirdetéseitországhirdetésügyfelekvárjuktöbbkívánómutatjafeltölthetőbérelnineveképvagyoldaltízkiadnimint

Forrás: pepitahirdeto.multiapro.com

Ha gyűjtöd a hanglemezt, ajánlom figyelmedbe a Rock LP oldalt. Rock, Pop, Disco, Soul, Funky, Jazz, Blues... Kedvező árfekvésben.


Feladva: 2016-07-18    [Zene - Hangszer]

Címkék, kulcsszavak: RockBluesgyűjtödJazzBudakesziFunkyTiborSoulBotkaDiscoVinylPopBakelitHanglemezoldaltfigyelmedbeárfekvésbenajánlomKedvezőhanglemezt

Forrás: pepitahirdeto.multiapro.com

Hatékony folteltávolítás kedvező áron. Csepke folteltávolító spray www.mososzerbolt.hu/id/00207_Csepk e_folteltavolito_spray_500_ml__ - Hazai mosószer és tisztítószer webáruház.


Feladva: 2016-01-27    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: sprayfolteltávolítóCsepkeHazaiáronKftkedvezőFuturefolteltávolításCudyHatékonywebáruháztisztítószermosószer

Forrás: pepitahirdeto.multiapro.com

Rongyszőnyegek: A másra már nem használható, nagyobb darab farmeranyagokból készítjük. A rongyszőnyegek általában a kék különböző árnyalataiban készülnek, de gyártunk fekete, szürke, ritkábban barna színekben is. Az összes rongyszőnyegünk kézi szövésű. 70 cm szélesek és 70 cm-től 6 méteresig mindenféle méretben gyártjuk. Kérésre egyedi méretekben is! Kreatív szőnyegek: Ezeket a szőnyegeinket a farmernadrágok zsebeiből, ülepéből, övrészéből, stb készítjük. Kézzel varrottak, ezért az összes ... további részletek >>

darab teljesen egyedi. A gyakoribb méreteken kívül, megrendelésre egyéb méretekben is elkészítjük őket. Nézze meg a szőnyegeinket! www.oldblue.hu/index.php/szonyegek


Feladva: 2017-04-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: rongyszőnyegekszonyegekszőnyegeinketegyedidarabösszesKreatívméretekbenkészítjükstbnemoldblueméteresigméretekengyártunkövrészébőlmárwwwtőlmásra

Forrás: pepitahirdeto.multiapro.com

Itt az idő, az ablakcsere ideje. Vásárolja Ön is nyílászáróját nagykerből 48% kedvezménnyel! Rendelje meg most ablakait és ajándékba adjuk az egyik ablakra a redőnyt vagy szúnyoghálót! (250000 Ft feletti rendelés esetén) IGLO5, IGLO5 CLASSIC •5 kamrás, •70 mm beépítési mélységű, •2x külső EPDM gumitömítéssel, •alap üvegezése 4/16 Ar/4 Low-e thermofloat üveggel, argon gázzal töltve, •Uw=0.92 W/m2K, •EN-674 szabványnak megfelelően, •MACO MULTI ... további részletek >>

MATIC KS vasalattal, •Lehetőség változó vastagságú üveg beépítésére Redőny, szúnyogháló, reluxa kedvező áron, rövid határidővel! További 5% kedvezmény nyugdíjasoknak és egyedülálló 2 vagy több gyerekes családoknak Látogasson el weboldalunkra, ahol részletes leírást talál termékeinkről. 2017. május 1-31. között regisztráló felhasználóink között ajándékokat sorsolunk ki, amelyet megrendelésével együtt szállítunk! Ajándékok: Hoppe Secustic kilincs 3 megrendelőnk minden ablakára, amelyet tőlünk rendel, Aereco légbevezető 5 lakásba, amelybe tőlünk rendelik a nyílászárókat.


Feladva: 2017-05-02    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 8226vagyRedőnyAblakamelyetközötttőlünkIGLO5MULTIablakaitmájusLowEljöttamelybetöbbeseténHoppeszúnyoghálóMACOmost2017üvegezéseBudapestmeg

Forrás: pepitahirdeto.multiapro.com

Szívből - Jövő című könyvem szívből ajánlom a szépirodalmat, verseket kedvelő kedves olvasóknak. Megrendelni a webáruházban lehet: www.verses.boltaneten.hu/kinalat/1 __aranyosi_ervin_versei


Feladva: 2015-09-19    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: ervinaranyosiszívbőlverseikedvesmegjelentkedvelőversesköteteverseketlegújabbkinalatszépirodalmatboltanetenajánlomverseshttpkönyvemlehetcíműJövő

Forrás: pepitahirdeto.multiapro.com

Betonacél, acélháló, betonvas hajlítás kedvezményes nagykereskedelmi áron! Nagyobb megrendelés esetén még nagyobb árkedvezményt adunk. Cégünknél az árut leszállításkor is kifizetheti. Önnek csak annyi a dolga, hogy az e-mail címünkre elküldi a Statikai tervet! Mi kiszámoljuk és legyártjuk a szükséges mennyiséget. Üzenhet itt is, vagy a honlapunkon található elérhetőségen!


Feladva: 2015-12-22    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: hajlításBetonvasAcélhálóBetonacéllegyártjukBudapestcsaknagyobbkiszámoljukKftÖnnekmelybőltervetCentrumkifizethetibetonvascentrumáronStatikaiÉpít

Forrás: pepitahirdeto.multiapro.com

Nyugodt természeti környezetben, 2 szintes családi házban 4x4 ágyas szobák kiadók. Minimum 3 éjszakára vagy többre kiadó. A vendégházat egy időben csak egy családnak, illetve társaságnak kiadó. A szállás, legalább három éjszakára és minimum 10 fő részére foglalható. Maximum 16 fő, családoknak és baráti köröknek ideális. Minden szobában TV, WIFI. Konyha és fürdőszoba közös használatú. Nagy, parkosított udvar, ahol bográcsozni- nyársalni lehet. Parkolás zárt udvaron. Felnőtt: 2700 Ft/fő/éj + ... további részletek >>

IFA 280 Ft/fő/éj Gyerek: 0-17 éves korig 2700 Ft/fő/éj Fűtési szezonban minimum 3 éjszakára és minimum 10 főnek kiadó a vendégház. Fűtési szezonban Felnőtt: 4700 Ft/fő/éj +IFA 280 Ft/fő/éj Fűtési Szezonban Gyerek: 4700 Ft/fő/éj Eger 18 km-re, Mezőkövesd 12 km-re van Bogácshoz. Lehetőségek: Gyógyvizes strandolás, horgászás, túrázás, este a pincesori borozók, amikben hajnalig lehet szórakozni. OTP, MKB, K&H Szép kártya elfogadó hely. Érkezés: 14 órától Távozás: 10 óráig. A vendégházban lakik a tulajdonos is. www.fpvendeghaz.fw.hu piroska60@freemail.hu 06303756031 Egész évben szeretettel várom vendégeimet!


Feladva: 2017-06-07    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: minimuméjszakáraSzezonbanFűtésikiadóFarkas4700FtGyerek2700Ftegy280FtIFAFelnőttlehetBogácsvendégházPiroskaMezőkövesdMindenEgészÉrkezésfőnek

Forrás: pepitahirdeto.multiapro.com

Automata mosógépek, mosogatógépek, hűtőgépek, varrógépek, mikrosütők, porszívók és egyéb háztartási gépek helyszíni és szervizes javítása 1 év garanciával.


Feladva: 2015-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: FerencCsókajavításagépekháztartásiszervizeshpmosógépekhospitalszervizesAutomataelektrohelyszíniltpwwwMarcalváros840Győr350egyébTelporszívók

Forrás: pepitahirdeto.multiapro.com

A méh pempő nemcsak étrendkiegészítőnek kiváló, de a bőr- és hajápoláshoz is az egyik legjobb termék. A méhek állítják elő, hogy ezzel a sűrű, ragacsos anyaggal táplálják királynőjüket. A méh pempő áldásos hatásait az ember már korán felfedezte és alkalmazza ma is szinte valamennyi betegség ellen sikeresen. Hatásait annak köszönhetjük, hogy benne rendkívül sok hasznos anyag található. A létfontosságú tápanyagok mellett számos más értékes összetevőt tartalmaz, többek közt acetilkolint és 10-HDA ... további részletek >>

savat is. Ezek adják intenzív gyulladásgátló antivirális és az agyműködést elősegítő hatásait.


Feladva: 2017-07-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásaithogypempőméhkiválóértékessűrűbenneétrendkiegészítőnekintenzívkoránmásezzelnemcsakadjákmárszámoselőköszönhetjükKittiEzekemberannak

Forrás: pepitahirdeto.multiapro.com

Eladó, megfelelő ajánlat esetén kiadó az egész évben nyitva tartó, 650 m²-es Pelcz Apartmanház! Befektetésre is ajánlott! A Balatontól 150, a városközponttól pedig mindössze 200 m-re fekszik. A házban 8 db apartman található, mindegyik külön bejárattal és fedett terasszal rendelkezik. Apartmanjainkban egy időben legfeljebb 38 vendég elszállásolására van lehetőség. Főszezonban csak egész hetekre, szombat délutáni érkezéssel és szombat reggeli távozással fogadunk vendéget.


Feladva: 2016-02-13    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kiadószombatApartmanházEladóPelczegészvankülöntávozássalBalatontólelszállásolásáraeseténmindegyikreggeliajánlottvendégajánlattalálhatólegfeljebb

Forrás: pepitahirdeto.multiapro.com

Havi fix és még autód is lehet! Hogyan vásárolhatsz olcsóbban? Hogyan lehet háromévente új autód? Hogyan lehet havi 140000 Ft jövedelmed? Itt a lehetőség! https://youtu.be/6ovqDxaNyyY www.senholding.com/kaldornoe0111


Feladva: 2017-05-12    [
Pénzkeresés - MLM]

Címkék, kulcsszavak: lehetHogyanautódhavihttpsmégfixsenholdingwwwháromévente6ovqDxaNyyYolcsóbbanyoutuvásárolhatszlehetőségIttjövedelmedNoémi140000Káldorcom

Forrás: pepitahirdeto.multiapro.com

24 órás otthoni szakápolás, betegápolás! Otthonában ápolom kifejezetten szakápolást igénylő lábadozó, beteg, vagy idős hozzátartozóját, krónikus belgyógyászati, haematológiai és onkológiai tapasztalattal és több, mint 25 éves gyakorlattal. Szükség esetén 24 órában. Kórház, műtét utáni ápolás. Tumoros betegek otthoni ápolása. Megfelelő végzettséggel és referenciával rendelkezem. Bérezés megállapodástól függően. Tel: 06-30-8834252 kovacsbiren@gmail.com


Feladva: 2017-05-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: otthonibetegápolásMegfelelőszakápolásSzükségidőscomápolásaórásgyakorlattalvagykovacsbiren@gmailBudapestéves8834252betegekIrénmintlábadozóTel

Forrás: pepitahirdeto.multiapro.com

Minden gépjárműre személyautóra,kisteherautóra,kamionra traktorra,buszra,készítünk méret pontos üléshuzatot. Legalább 100 fajta anyag minta közül választhat. Uv álló anyagok, gyári kárpit anyagok, utángyártott anyagok, elasztikus anyagok, szövetek, között válogathat.A különböző színű, mintájú,vagy minőségű anyagok össze variálásának,csak az ön fantáziája szabhat határt. Vásárolhat nálunk trikó üléshuzatokat, valamint univerzális üléshuzatokat is.Várjuk szeretettel. Tekintse meg web ... további részletek >>

oldalunkat:huzatkiraly.hu Bán&Vincze BT Kecskemét Jókai utca 41 Telefon:0630/911-1277 0630/4853749


Feladva: 2016-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: anyagokVinczeBán0630üléshuzatokatKecskemétkárpitvalamintpontosminőségűüléshuzatgyáritrikóméretvagyMéretpontoshuzatkiralyállónálunkkészítünk

Forrás: pepitahirdeto.multiapro.com

Álmait megvalósítjuk, otthonát hangulatosabbá tesszük, komplett szolgáltatást nyújtunk. Egyéni megrendelők és közületek számára egyaránt a klasszikus megoldásoktól a modern stílusig. Minőségi munkát, minőségi szolgáltatást végzünk, korrekt áron. Szolgáltatásaink: függönyvarrás, drapériák, ágytakarók készítése, római roló és lapfüggöny készítése, függönytisztítás. Varrodánkban textilválasztás is lehetséges!


Feladva: 2016-07-24    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: függönyvarráskészítéseszolgáltatástminőségistílusigtesszükágytakarókmodernhangulatosabbádrapériákmegoldásoktólotthonátklasszikuslehetségesmegvalósítjuk

Forrás: pepitahirdeto.multiapro.com

Golosi Kitten speciális táp a kiscicák számára, 1 hónapos kortól 1 éves korig. Ebben az életszakaszban könnyű, mégis gazdag beltartalmú táplálékra van szükség, mely elősegíti a fiatal kismacska kiegyensúlyozott, egészséges fejlődését. A könnyen emészthető csirkehús olyan fehérjeforrás, mely nagy mennyiségben tartalmazza a növekedéshez elengedhetetlenül fontos aminosavakat. A frukto-oligoszacharid (FOS) tartalmú prebiotikumok elősegítik a tápanyagok megfelelő felszívódását, mivel egészséges ... további részletek >>

táptalajt biztosítanak a bélflórának. Ugyanakkor a krokett forma a kiscica igényeinek megfelelően lett kialakítva, elősegítve ezzel a rágást. Teljes értékű állateledel csirkével és rizzsel kiscicáknak 1 hónapos kortól 12 hónapos korig. www.golosipetfood.hu/katalogus/macska/golosi-kitten


Feladva: 2017-07-01    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: golosikittenhónaposkortólmelykorigegészségesajánlóaminosavakatemészthetőlettgazdagmivelHirdetőkiscicáknakfontoskönnyenmegfelelőenmégisPepita

Forrás: pepitahirdeto.multiapro.com

A Piccolo Café Itália kávézóinak hangulatát hozza el Budapestre. Espresso alapú kávéinkhoz Caffé Danesit, egy méltán híres római kávé különlegességet használunk. Konyhánkat az egyszerűség, az egészséges táplálkozás és az olaszos ízek jellemzik. Paninit, szendvicseket szolgálunk fel kedves vendégeinknek, illetve igen népszerű nálunk az igazi olasz street food, az Emilia-Romagna tartományból származó Piadina (olasz lepénykenyér) is. Kávézónkban a hagyományos és paleo sütemények is kaphatók.


Feladva: 2016-01-02    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: olaszCaféPiccoloBudapestPaninithagyományosrómaiigazihangulatátjellemzikKávézónkbanhíresnálunkkávézóinakízeklepénykenyérméltánnépszerűItáliaegy

Forrás: pepitahirdeto.multiapro.com

Könyvelés - Cégalapítás - Székhelyszolgálat Hosszított esti és hétvégi elérhetőséggel állunk Ügyfeleink rendelkezésére. Jelenlegi és leendő partnereinkkel a kölcsönös és feltétlen bizalmon alapuló baráti és üzleti kapcsolatra törekszünk, hiszen ebben a szakmában ez elengedhetetlen. Kft, Bt könyvelése 7.000 Ft-tól Egyéni vállalkozó könyvelése 6.500 Ft-tól Székhelyszolgálat 4500 Ft-tól Cégalapítás 19.990 Ft-tól Célunk, hogy az Ön számára is hasznos segítség lehessünk ... további részletek >>

mindennapjaihoz. Reméljük, hamarosan Önt is ügyfeleink körében üdvözölhetjük, s egyúttal várjuk mielőbbi jelentkezését. Részletes információ weboldalunkon!


Feladva: 2016-10-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: tólmindenMostügyfeleinkCégalapításSzékhelyszolgálatingyenKönyveléskönyveléseÜgyfelünknekegyúttalbarátiszámáraelérhetőséggelEgyéniüdvözölhetjükalapuló

Forrás: pepitahirdeto.multiapro.com

JUNKERS gázkészülék szakszerviz Budapest. Junkers, Bosch szerviz. Junkers cirkók és vízmelegítők éves karbantartása javítása, cseréje. Garanciális kazánok ellenőrzése Budapesten és környékén. Gyors, megbízható, precíz munka, korrekt ár! Budapest területén nincs kiszállási díj! Ha önnek fontos családjának biztonsága, évente ellenőriztesse gázkészülékét! Hívjon bizalommal! Junkers szerelés, gázkészülék szerviz, gáz szerviz, Junkers márkaszervíz, Bosch márkaszervíz. Kazán szerviz.


Feladva: 2016-03-28    [Lakossági szolgáltatás]

Címkék, kulcsszavak: JunkersszervizBudapestmárkaszervízBoschkarbantartásabiztonságaprecízévescsaládjánakmegbízhatóvízmelegítőkfontosGyorsgázcirkókönnekkörnyékéndíj

Forrás: pepitahirdeto.multiapro.com

Minden erőfeszítése ellenére sem tudja leadni a fölösleges kilóit? Nincs ideje,energiája edzőterembe járni? Megoldást ajánlunk. Biorezonanciával beállítjuk - az anyagcsere korrekcióját - a sejtszintű zsírbontást - étvágy csökkentést Már az első alkalommal beindul a fogyás. Heti 1 kezeléssel a folyamat fenntartható. A biorezonanciát ajánljuk,kisiskolás kortól,idős korig. A túlsúlyos gyermeket csúfolják a társaik és nem fogadják be. Ettől magányos,magábaforduló,sérült lesz,aki ... további részletek >>

evéssel és magányos játékokkal vigasztalja magát. Ebből a kiút az ésszerű fogyás. A túlsúlyos idősebbek - izületei nehezen cipelik a fölösleges súlyt, - a szívműködésük és - a vérnyomásuk fogyásért kiált. Alkalmanként egy 20 perces alakformáló masszázst ajánlunk,hogy a kilók onnan szívódjanak fel,ahol Önnek a legfontosabb. A normál súly - egészséget, - önbizalmat, - munkabírást, - boldog életet biztosít. Bővebb információért,időpont egyeztetésért hívjon a 06 30 907 47 86 telefonon. eletmod-debrecen.hupont.hu


Feladva: 2017-08-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogyásajánlunkfölöslegesmagányostúlsúlyosdebrecennemkilóithívjonfolyamatsúlyvigasztaljakorrekciójátmasszázsttársaikleadniegyeztetésértcipelikHeti

Forrás: pepitahirdeto.multiapro.com

Angol online tanfolyam kezdőknek és újrakezdőknek, ha nincs időd nyelviskolába járni itt a helyed! Most 20 ingyenes ONLINE leckével próbáld ki magad és fejleszd tudásodat. Képek, videók és különböző feladatok segítenek az angol nyelv elsajátításában. Tesztek és gyakorlási lehetőség INGYEN. Tanulj otthon, a saját időbeosztásod szerint! Webcímünk: www.tanoda.shp.hu


Feladva: 2016-10-29    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: angolONLINEkezdőknekotthonpróbáldWebcímünkújrakezdőkneknyelvleckévelszerintidőbeosztásodtanfolyamsegítenekingyenessajátOrszágosfeladatokMostTünde

Forrás: pepitahirdeto.multiapro.com

Vendégházunk 4 személyes apartmanjában és vendégszobáinkban kényelmes szállást biztosítunk kedves vendégeinknek. Levelezős diákokat,munkavállalókat,átutazókat is szívesen fogadunk. Vállalatoknak, munkavállalóknak hosszabb távra jelentős kedvezménnyel. 3500,-Ft/fő/éj-től. SZÉP KÁRTYA elfogadás. 3 éjszakán túli foglalás esetén akár 3290,-Ft-tól Az ár függ az eltöltött éjszakák és a személyek számától. www.aratovendeghaz.atw.hu tel:+36704593419


Feladva: 2017-09-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: eltöltöttapartmanjábanSZÉPátutazókatfüggszemélyestőlmunkavállalókattólVendégházunk350036704593419diákokat3290PécskedvezménnyeltelLevelezősakár

Forrás: pepitahirdeto.multiapro.com

Balaton, Balatonfenyves, közvetlen vízparti szállás, üdülés, horgászat. Az udvarból a Balatonba léphet... csak 1 lépés a Balaton! Strandolás, horgászat helyben. Biztonságos, családias, gyermekbarát környezet. Ingyenes stég, csónak, vízibicikli, kerékpár használat. Bográcsozási lehetőség. SZÉP-KÁRTYA elfogadás! Nézze meg a honlapot és kérjen ajánlatot! NE FELEDJE: ... csak a halak vannak közelebb a Balatonhoz...


Feladva: 2016-09-25    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: csakhorgászatBalatonBalatonfenyvesilépésüdüléslehetőségBiztonságosvízpartiBográcsozásihelybenFELEDJEközvetlenhasználatajánlatotBalatonfenyveskerékpár

Forrás: pepitahirdeto.multiapro.com

Eddig mennyit kerestél abból az üzletből, amely mellett minden körülmények között kiállsz? Értem én, hogy hirdetéseket adsz fel, mert valami csodát ajánlasz! Értem Én, hogy pénzt szeretnél keresni abból, amit ajánlasz! Azt nem értem, hogy miért kell külföldiek zsebét tömnöd! Minden külföldi tömhetné a Te zsebedet is! Gondolkozz!!!!!!!! Biztos vagy abban, hogy az a csoda termék, amit ajánlasz, Neked milliókat hozhat? Sok pénzt kifizettél, befektettél már világmegváltó lehetőségekbe? Sok ... további részletek >>

pénzt elveszítettél? Meg is érdemled! Ez fájdalmas tanuló pénz volt! Mindent értek! Csak azt nem, hogy miért nem vagy nyitott olyan lehetőségre, ahol minden másképp működik, mint amit eddig megismertél! Nem kell befektetned, nincsenek MLM eladások, nincsenek vásárlási és egyéb kötelezettségek, nincs semmi, amit nem szeretnél! Vannak lehetőségek, amelyeket kihasználhatsz, ha szeretnéd! Van arra lehetőséged, hogy akár 5-10 év alatt milliomos legyél továbbajánlások nélkül is!!!!!!!!!!! Ingyen van az információ, nem kell befizetned, és mégsem érdekel???? Mondd meg Te, hogy mit szeretnél, és megnézzük, hogy lehetséges e, de valószínű, hogy igen! Keress bizalommal kérdéseiddel az email címemen. Ha megadod a telefonszámod, szívesen fel is hívlak! Email: rozsabusiness@gmail.com


Feladva: 2017-03-07    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmindenamitértemabbólkellszeretnélajánlaszpénzteddigaztSokmellettamelyEmailüzletbőlkerestélfelmennyitnincsenekvankiállszmegvagy

Forrás: pepitahirdeto.multiapro.com

20 éve bárki számára ingyenes! Töltse ki anonim önismereti tesztünket és meglátja miben fordulhat hozzánk. Elégedettség · Nevetés · Boldogság · Optimizmus Közvetlenül a teszthez: www.optimistaklub.hu/spiritualítás


Feladva: 2017-09-27    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: 183spiritualításingyenesNevetésszámáraElégedettségbárkihozzánkévefordulhatajánlóoptimistaklubmibenHirdetőwwwmeglátjaPepitatesztheztesztünket

Forrás: pepitahirdeto.multiapro.com

Profi weboldal készítés olcsón, garanciával.


Feladva: 2016-12-18    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: ProfikészítésweboldalBudapestKftBridgeDiamondgaranciávalolcsón

Forrás: pepitahirdeto.multiapro.com

Megmentjük és olcsó csereautót is biztosítunk! Autómentés, furgon szállítás, daruzás (patakból - árokból), autószállítás non-stop. Budapest és Pest megye azonnal, vidéki autómentés esetén a lehető legrövidebb időn belüli elindulás. Autóparkunk és kollégáim segítségével megoldjuk az Ön problémáját! Darus technikánk alkalmas az összes helyzetre: feltört, bezárt, erősen sérült, megszorult futóművű autók, munkagép mentés, daruzás, szállítás különleges, speciális, extrém szállítások.


Feladva: 2017-09-08    [Autó - Motor - Jármű]

Címkék, kulcsszavak: daruzásautómentésBudapestszállításautószállításkollégáimextrémmegyeerősenMegmentjükAutóparkunkspeciálisPestbezártchriscarelinduláskülönlegesfeltört

Forrás: pepitahirdeto.multiapro.com

Újdonság Magyarországon a porcelán urna, mely gránit, márvány mintával, többféle színben választható és amire az Elhunyt porcelánképe kerül. Az urna elhelyezhető kültéren, bírja az időjárás viszontagságait, de egy otthoni házi oltár dísze is lehet. Az urna üreges, talpán van a hamvak elhelyezésére szolgáló nyílás, amit a hamvak elhelyezése után ragasztással kell rögzíteni. A teljes választék megtekinthető a www.sirkokep.hu oldalon.


Feladva: 2016-07-14    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: urnahamvakbírjakellmárványüregeskültérenragasztássalgránitelhelyezhetőutánmelylehetkerülelhelyezéseporcelándíszeoldalonporcelánképeoltáramit

Forrás: pepitahirdeto.multiapro.com

A bodzalé felnőtteknek hatékony szív- és érvédő. Napjainkban nagyon sokat érintenek és fenyegetnek a keringési problémák, melyek sokszor rejtve maradnak és halálhoz vezetnek. A Sambucol bodzalé azonban segít megelőzni a bajt! Természetes koleszterincsökkentőként hat, megakadályozza az erekben a lerakódások képződését, csökkenti az érelmeszesedés, érszűkület esélyét. A bodzalé immunerősítésre is kitűnő. www.bodzaitalok.bodza.co.hu/hatasai Fogyasztásával ősszel és télen, a felső légúti ... további részletek >>

betegségek szezonjában is egészségesek maradhatunk! Influenza esetén enyhíti a tüneteket és napokkal gyorsítja a gyógyulást! Sambucol bodzalé vásárlás itt: www.bodzaitalok.bodza.co.hu


Feladva: 2017-06-26    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: bodzaléSambucolképződésétbodzagyorsítjavezetnekfelsőnagyonlerakódásokfeketenapokkalhalálhoztélenNapjainkbanerekbentüneteketmaradnakősszelérvédő

Forrás: pepitahirdeto.multiapro.com

Társkereső weboldal baráti áron eladó. 3 in 1 megoldás. (Titkos, alkalmi, komoly). 1000-nél is több regisztrált felhasználó! .com-os, .hu-s domain nevekkel. Remek befektetés, ha komolyan gondolod. Alapozzad meg a jövődet! A részletekért hívj bátran!


Feladva: 2017-03-30    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: eladóweboldalTárskeresőnélBudapestgondolod1000AndraskomolyankomolyBundzselbefektetésalkalmiRemekTitkosnevekkelmegoldásbátrandomainhívjcom

Forrás: pepitahirdeto.multiapro.com

A zsírégető ételek és élelmiszerek nem oldanak meg mindent, de ahhoz kiválóak, hogy serkentsük az anyagcserét. A mozgáshiány, a helytelen táplálkozási szokások szinte bénítólag hatnak az egészséghez és a fogyáshoz is nélkülözhetetlen anyagcserére. Ha zsírégető ételek és élelmiszerek fogyasztásával sikerül felgyorsítani, beindul a kalóriák elégetése, ezzel együtt a fogyás is. A zöld tea, a teljes kiőrlésű gabonák, az alma a legjobbak erre a célra. A zsírégetés ételekkel és természetesen tornával ... további részletek >>

is nagyon hatékony lehet, az egyik leghatásosabb mozgásforma a súlyzózás, ami edzés után órákkal is pörgeti az anyagcserét.


Feladva: 2017-08-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: élelmiszerekételekzsírégetőzsírégetésanyagcserétórákkalfogyasztásávaltornávalszokásokteanemutántermészetesentáplálkozásizöldKittiedzésételekkel

Forrás: pepitahirdeto.multiapro.com

Mégsem vagy még partnerünk? a SkyWay capital programjában való részvétel - egy kiváló lehetőség egy hatalmas innovációs projekt részévé válni, amihez hasonló még nem létezik a világban! a SkyWay projekt értéke ugyan 400 milliárd dollárra van felbecsülve, de mára már minimum 20szor ennyit ér. Ma ebbe befektetni - ez a lehető legelőnyösebb befektetés, amit csak megtehetünk. Tudjuk, hogy a legnagyobb léptékű Transnet projektet hozzuk létre és minden kockázatot számba vettünk.


Feladva: 2017-10-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: projektSkyWayegymármégcapitalbefektetni400válniléptékűpartnerünkebbeugyanrészévélegnagyobbvagyennyitértékeinnovációshogyMégsem20szorÁgi

Forrás: pepitahirdeto.multiapro.com

Gerincsérv, derékfájás, lumbágó, isiász, hátfájás, porckorongsérv, térdfájdalom, ízületi fájdalom? Meglepő fájdalomcsillapító tapasztalatok egy 7 perces VIDEÓban! 4 ember mondja el tapasztalatait és azt, hogy pontosan mit csinált!


Feladva: 2015-12-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Gerincsérvizületitapasztalataitporckorongsérvmondjahátfájás33580emberisiász4124VIDEÓbanlumbágóclikapercderékfájáshttptapasztalatokcsináltMarcsi

Forrás: pepitahirdeto.multiapro.com

Az Ezermester Magyarország legrégibb és legnépszerűbb általános technológiai magazinja. Gépek, szerszámok, technológiák, építés, kert, újdonságok, ötletek. Facebook oldal: www.facebook.com/ezermester.hu


Feladva: 2017-09-11    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: ezermesterfacebookáltalánosoldallegnépszerűbbötleteklegrégibbújdonságokMagyarországkertajánlóépítésHirdetőtechnológiákPepitaszerszámokHobbimagazin

Forrás: pepitahirdeto.multiapro.com

Ha Ön és cége, vállalkozása > termékeinek, valamint szolgáltatásainak új piacot keres > szabad kapacitását szeretné lekötni > szellemi termékeit szeretné értékesíteni > Telephelyét, ingatlanát óhajtja eladni > együttműködésre törekszik külföldi cégekkel > képviseletet óhajt külföldön > reklámra, vagy telemarketingre van szüksége, akkor cégünkben megbízható partnerre talál!


Feladva: 2016-02-13    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: szeretnéképviseletettermékeitmegbízhatócégecégekkelszellemicégünkbenPartnerkülföldilekötniakkorBusinesstörekszikkapacitásátszükségeEuroszabadvan

Forrás: pepitahirdeto.multiapro.com

Azok számára állítottuk össze kezdő csomagjainkat, akik most vágnak bele a kisállat tartásba. A csomag tartalmaz minden, a felelős állattartáshoz szükséges kelléket. A Cavie 60 a Ferplast több éves fejlesztése. Strapabíró, praktikus és rendkívül esztétikus tengerimalac ketrec. Magas peremmel rendelkezik, így a kiszemetelés esélye minimális. Tálcája erős minőségi műanyagból készül, tisztán tartása könnyű. A csomag tartalmazza: -Felszerelt Cavie 60 ketrec /1db 300ml-es csepegésmentes ... további részletek >>

önitató, 1db szénarács/ -Fogkoptató kő /Panzi,55gr/ -Tengerimalac eledel /Panzi, 1000ml/ -Réti széna /350g/-Fenyőforgács /5L/ Színekről érdeklődjön elérhetőségeinken.


Feladva: 2017-09-18    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: tengerimalacketrecCaviePanzicsomag1dbtengerimalacnakkezdocsomagmindenerősállítottukkisallatokpraktikus1000mltartalmazTálcájaszámárawebshopAzok

Forrás: pepitahirdeto.multiapro.com

Nyíregyházán két utcával határolt 4650 m2 telephely, építési teleknek is, az ukrán, román, szlovák határokhoz vezető 41-es főút 6-os km-nél eladó. A városközpont 4 km, az M3-as autópálya 1 km, a határok 50-100 km távolságra vannak. Sok célra alkalmasan, lekövezve, bekerítve, közművesítve, tetszés szerint oszthatóan. 63 m széles. A telek előtt 23 ezer gépjármű megy el naponta.


Feladva: 2017-05-03    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 245251bekerítvenélgépjármutcávallekövezvevezetezerkétalkalmasanhatárokhozNyíregyházáncélraszlováktelekNyíregyházaSokrománszélesJános100

Forrás: pepitahirdeto.multiapro.com

Befektetőt, társat keresünk, 50-100 Mft-tal, azonnal kezdhető társasházak építéséhez, közre működéssel vagy a nélkül. Biztos megtérülést, garanciát, biztonságot ajánlunk. Biztosan Ön is tudja, hogy most lakásokba megéri befektetni. Jelentkezni a haza i@upcmail.hu e-mail címen.


Feladva: 2017-10-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: építéséhezkeresünkBefektetőthogyközrepesttudjaKftBiztosantársasházakcímenFinancialajánlunkkezdhetőmailEurópabiztonságotazonnalhazai@upcmailtal

Forrás: pepitahirdeto.multiapro.com

Simson Electronic motort vennék 0 km-es, műszakilag hibátlan, gyári állapotban Budapesten, vagy közvetlen környékén. (Kisebb szépséghiba nem számít.) Esetleg 4 sebességes, tirisztoros gyújtású, halogén reflektoros Simson Enduro, vagy S51B is érdekel.


Feladva: 2016-09-13    [Autó - Motor - Jármű]

Címkék, kulcsszavak: SimsonvagyvennéknemmotortszépséghibaElectronicEnduroKisebbBarátkörnyékénElectronicotreflektorosközvetlenhalogénBudapestengyújtásúállapotbangyári

Forrás: pepitahirdeto.multiapro.com

Az isiász gyógyítása általában teljes sikerrel jár, hiszen nem rosszindulatú betegségről van szó. Ez sokkal inkább egy tünetegyüttes, melyet az ülőideg összenyomódása okoz. Rendszeres testmozgással, a gerinc és a hátizmok ülés közben történő megtámasztásával, a helyes ülésmód elsajátításával megelőzhető a kialakulása és a kiújulása is. Az isiász lelki okai a túlterhelés érzésében gyökereznek. Ha valakin túl nagy a nyomás, a felelősség, túl sokat vállal magára pl anyagi gondok miatt, nagy ... további részletek >>

eséllyel alakul ki nála ez a probléma. Az idegbecsípődés és isiász kezelése történhet gyógyszerekkel és megfelelő tornával is.


Feladva: 2017-01-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: isiászidegbecsípődéstúlnagykezelésevállalsokkalkiújulásagyógyításagerincsokatszókialakulásaKittiproblématestmozgássalvanmegelőzhetőKellérnála

Forrás: pepitahirdeto.multiapro.com

Komáromi János (Málca, 1890. december 22. – Budapest, 1937. október 7.) író, újságíró. Több tucat elbeszélés és regény szerzője. Sorozatcím: Komáromi János munkái gyűjteményes kiadás IV. Kiadó: Genius Könyvkiadó Rt. Kiadás éve: 1930 Kiadás helye: Budapest Kötés típusa: egészvászon Terjedelem: 233 Nyelv: magyar Méret: Szélesség: 13.00cm, Magasság: 19.00cm Kategória: Irodalom szépirodalom regény, novella, elbeszélés Dedikált, aláírt könyvek Antik könyvek ... további részletek >>


Feladva: 2017-04-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: KiadásBudapestgenius1930DedikáltelbeszélésnapokszepregénykirJánosKomáromi00cmkönyvekSzélességHirdetőaláírtTöbbMéretPepitaéveújságíróíró

Forrás: pepitahirdeto.multiapro.com

Meditációs párna tönkölypelyva töltettel - 33 cm-es átmérőjű és 13 cm magas tönköly meditációs párna eladó a készítőtől. 100 %-os pamut vászon külső huzattal. Jóga csoportoknak, több darab rendelése esetén árkedvezményt biztosítunk. 4700 Ft leszállítva


Feladva: 2017-05-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: párnameditációstönkölyeladódarabtöbbcsoportoknakJógamagashuzattalátmérőjűleszállítvakülsőtöltettel4700vászontönkölypelyvabiztosítunkpamutKft

Forrás: pepitahirdeto.multiapro.com

Eladó 2 emeleti (!!!) napfényes, déli fekvésű gázkonvektoros lakás. A lakás körbe lakott, ezért minden oldalról fűtött falak veszik körbe, a rezsi minimális. A szoba hagyományos parkettás, a többi helység járólapos. parkra néző, nincs utcazaj, por. A lépcsőház kulturált a bejárati ajtó, lépcsőház ablakok kivannak cserélve hőszigeteltre. Külön WC, fürdőszoba! A konyha az előtérből nyílik nem a szobán át kell megközelíteni, mint a legtöbb garzonban. Ingatlan ügynökök, hirdető cégek kíméljenek! ... további részletek >>

Érdeklődni: +36 30 575 3168, +36 70 588 8033


Feladva: 2017-10-07    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: Eladólépcsőházlakáskörbehőszigeteltredéli588nézőmintveszikcserélvenapfényes3168parkramegközelítenifalakkivannakemeleti575járólaposkelltöbbi

Forrás: pepitahirdeto.multiapro.com

Elhunyt szerettei fotóját megörökítő porcelánképek rendelhetők. Fénykép alapján porcelánfestékkel készülnek, 800 °C felett beégetve, kopásálló felülettel és fotó minőségben. Plakettek nagy forma és méretválasztékban! Mindenszentekre felújíthatja a síremléket egy egyedi porcelánképpel. www.dekormania.hu vagy www.sirkokep.hu


Feladva: 2016-08-29    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: wwwfotójátsíremléketbeégetveszeretteifelújíthatjafelettElhunytMindenszentekre800kerméretválasztékbankészülneksirkokepXIVformaporcelánfestékkelnagy

Forrás: pepitahirdeto.multiapro.com

Országosan olyan üzletkötőket keresünk csapatunkba, akik nem kezdők már az értékesítésben, de kimagasló teljesítményükért elvárják a megbecsülést is cserébe. Talán pont Téged keresünk? Magas kereseti lehetőség, NEM MLM! Ha ilyen üzletkötőnek tartod magad, küldj önéletrajzot az alábbi email címre andras.bogar@athletastic.co m! Vagy ismersz valakit, aki ilyen üzletkötői munkát keres, kérlek, vedd fel vele a kapcsolatot.


Feladva: 2017-10-02    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünküzletkötőketNEMilyenvalakitcsapatunkbamagadkapcsolatotTalánismersztartodvelecserébeVagyolyanüzletkötőnekfelmegbecsüléstcomOrszágosan

Forrás: pepitahirdeto.multiapro.com

Exkluzív olasz italtartó földgömbök, sakkasztalok széles választékban. Rövid szállítási határidővel.Megrendelheti honlapunkon, vagy személyesen üzletünkben. 1093 Budapest közraktár utca 20./a www.matracfutar.hu www.lineaflex-butor.hu


Feladva: 2017-02-15    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: BudapestsakkasztalokolaszlineaflexwwwItaltartókmatracfutarszállításiutcaRövidközraktárválasztékbanszéles1093üzletünkbenföldgömbökszemélyesenvagy

Forrás: pepitahirdeto.multiapro.com

----Pick téliszalámi reklám áron! ---- Pick eredeti téliszalámi ára : 4390 Ft/kg Herz eredeti téliszalámi ára : 4390 Ft/kg Csongrádi füstölt kolbász ára : 1190 Ft/kg Pick paprikás szalámi ára : 990 Ft/db ---- Budapest XI. Bocskai út 42 sz. ----- ---- Telefon: 061/3611-609 ---- Web: http://www.lazarhus.hu Email:lazarhusmintabolt@gmail.com< /a>


Feladva: 2016-08-16    [
Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: áraPicktéliszalámiLázár4390Budapesteredetiszalámi1190Hús3611kolbász061füstöltárakTelefonCsongrádicomHúsboltBocskailazarhusmintabolt@gmail

Forrás: pepitahirdeto.multiapro.com

Fenomenális tisztítási alkalmazás lehetősége: www.smalteam.com/autlanding.php?re ff=Robi78&lang=hu


Feladva: 2017-07-22    [Vegyes hirdetések]

Címkék, kulcsszavak: Robi78FenomenálisreffRóbertphpLantosautlandingautóracomtisztítássmalteamnélküliwwwVízhttplehetőségealkalmazáslangtisztítási

Forrás: pepitahirdeto.multiapro.com

Az ország legelismertebb és legjobban foglalkoztatott Elvis imitátora, külföldi turnéja után újra Magyarországon vállal fellépéseket. Ő az egyetlen Magyarországon, aki Las Vegasban sajátította el a szakmát. Ha színvonalas műsort szeretne, hívjon bizalommal telefonon!


Feladva: 2016-04-24    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: ElvisMagyarországonLasakifoglalkoztatotttelefononlegjobbanbizalommalegyetlenlegelismertebbhívjonfellépéseketországszeretnevállalélőbenműsortújra

Forrás: pepitahirdeto.multiapro.com

Minden típusú hőlégfúvó, bármilyen gyártmányú hőlégfúvó és mindenfajta fűtőanyagú hőlégfúvó javítása. Olcsó hőlégfúvót keres? www.olcso.holegfuvok.com


Feladva: 2015-05-06    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: hőlégfúvómindenfajtacomgyártmányúholegfuvokbármilyenolcsotípusúwwwMindenkeresHalásztelekhőlégfúvótszervizOlcsójavításafűtőanyagú

Forrás: pepitahirdeto.multiapro.com

Mire jó az aloe ital? Az ókorban is ismerték gyulladásokkal és fertőzésekkel szemben kifejtett jótékony hatásait. Napjainkban is használják a vírusok, baktériumok, gombák ellen, segítségével kezelhetünk bőrbetegségeket, influenzát, bélgyulladásokat. Az aloe vera ital más szempontból is nagyon egészséges. A kutatások megerősítették, hogy képes szabályozni a vércukorszintet és fokozni az inzulinérzékenységet. Aki rendszeresen fogyasztja, csökkentheti a cukorbetegség kialakulásának esélyét. ... további részletek >>

Közvetett módon a fogyást is támogatja. Aloe vera ital melletti érvek és rendelés weboldalunkon!


Feladva: 2017-08-22    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: italAloeveraMireKittiinzulinérzékenységetmásfogyástNapjainkbanKellérfokoznibélgyulladásokatmódonhatásaitvércukorszintetinfluenzátjótékonyKözvetett

Forrás: pepitahirdeto.multiapro.com

Vállalom családi házak kivitelezését, átalakítását, felújítását, burkolást, hőszigetelést, gipszkarton szerelést, térkövezést, illetve mindennemű kőműves munkát. Hívjon bizalommal!


Feladva: 2016-10-24    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kőműveshőszigeteléstmunkákatburkolástbizalommalfelújítástHívjonátalakítástmunkátkivitelezésétházakmindenneműcsaládiilletveVállalomtérkövezéstIstván

Forrás: pepitahirdeto.multiapro.com

Környezetbarát tisztítószer, amely lehetővé teszi a zsíros szennyeződések eltávolítását minden felületről. Különösen alkalmas a tűzhely, a sütő és a főzőlap zsíros lerakódásainak eltávolításához. Bőrgyógyászatilag tesztelt. Ecolabel minősítéssel rendelkezik, amely tanúsítja a környezetkímélő, biológiailag könnyen lebomló összetevőket. - 750 ml-es szórófejes flakon www.vegatar.hu/id/01352_Neutral-Gr een-oko-zsiroldo-750-mL


Feladva: 2017-04-04    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: 750amelyNeutralGreenökozsírostanúsítjatisztítószerzsiroldotűzhelykörnyezetkímélősütőbiológiailaglehetővéfőzőlapkönnyenteszilerakódásainaklebomló

Forrás: pepitahirdeto.multiapro.com

A Tilta Gravity G1 egy rendkívül könnyű, egyszerűen kezelhető, csúcsminőségű egykezes gimbal, professzionális használatra. Köszönhetően a 0-tól 3 kg-ig terjedő terhelhetőségének, kompatibilitása egyedülálló: a nehezebb DSLR konfigurációtól, a MILC és GoPro kamerákon át az okostelefonig szinte bármivel használható. Ezt nem csak a kifinomult vezérlésnek és a páratlanul erős motoroknak, hanem az egyedülálló váz-kialakításnak köszönheti, amely hosszabb és erősebb, mint bármely más egykezes ... további részletek >>

gimbalnál. Kiterjeszti az alkalmazhatóságát a gimbal markolat felett elhelyezkedő jobb és baloldali rozetta, amelyre monitor, mobil telefon (élőképhez), follow focus vagy más kiegészítő csatlakoztatható. A Gravity G1 markolata egy mozdulattal eltávolítható és a rozetták segítségével egyszerűen kétkezes gimballá alakítható. A működés finomhangolása bluetooth kapcsolaton keresztül a TILTA Assistant App (Androidra és iPhone-ra) segítségével történik. Bővebben: www.gaia.hu/tilta-gravity-g1-gimbal-stabilizator-grt02g1.html


Feladva: 2017-09-04    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: gimbalgravitytiltamássegítségévelegyszerűenegyedülállóegyegykezesbármelyKöszönhetőenfinomhangolásaerőskameracsatlakoztathatókamerákonBővebbenmint

Forrás: pepitahirdeto.multiapro.com

Ha Ön is szereti az izgalmas mozgalmas filmeket, megdöbbentő videókat, retró, vagy mai zenét halgat szívesen, akkor ezzel a YouTube válogatással további keresés nélkül ingyen megteheti.


Feladva: 2014-12-01    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: hathazizenétzenékmegtehetimaivideókingyenvagyFilmeknélkülretrókeresésvideókattovábbimegdöbbentőyoutubeválogatássalfilmeketezzelmozgalmasakkor

Forrás: pepitahirdeto.multiapro.com

Pihenjen, gyógyuljon és töltődjön fel Hajdúszoboszlón, a Pávai Apartmanházban, 2 személyes, kényelmes apartmanjainkban, melyek a gyógyfürdő bejáratától csak egy rövid sétára találhatóak. Az ajánlat tartalmazza a szállásdíjat 6 éjszakára, a parkolás, internet használatát is. A külön bejáratú, 2 személyes apartmanok mindegyikéhez saját, jól felszerelt konyha, fürdőszoba tartozik. Ágynemű huzat, törölköző, kábel és műholdas tv, Wi-Fi internet, a teraszon, erkélyen kerti bútorok.


Feladva: 2016-11-11    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: PávaiApartmanházinternetszemélyesbejáratátólbútorokfürdőszobaPihenjenparkolásgyógyfürdőkertikonyhaHajdúszoboszlóéjszakáramelyekerkélyenfelszerelt

Forrás: pepitahirdeto.multiapro.com

Szeretettel várok minden új és régi vendégemet újonnan nyílt szalonban :) Bejelentkezni ezen a telefonszámon tudtok : +36 70 626 1434


Feladva: 2017-09-28    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: régi1434minden626vároktudtokSzeretetteltelefonszámonBudapestezenÉvaBejelentkezniGázerszalonbanVicuskutyakozmetikanyíltújonnanvendégemet

Forrás: pepitahirdeto.multiapro.com

Tökéletesen tisztítja a többféle felületet. Univerzális alkalmazású: fürdőszoba, konyha, terasz és erkély. Használja fazekakhoz, odaégett maradékokhoz, mosogatókhoz, üvegekhez, porcelánhoz. Erős és biztonságos - a biológiailag lebomló. Nagyon szennyezett, pl. kenőanyagokkal szennyezett kezet is lehet vele mosni 500 g-os kiszerelésben. ERŐS ÉS BIZTONSÁGOS - KÉZKÍMÉLŐ - KÖRNYEZETBARÁT Azért is foglalkozom vele, mert én is használom a saját háztartásomban. Emellett keresek pénzt is vele, ... további részletek >>

mert megismertetem mindazokkal, akiket szintén érdekel...


Feladva: 2017-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: veleBIZTONSÁGOSERŐSUniverzálisszennyezettmertkonyhapasztabiológiailagfürdőszobapénztlebonthatóporcelánhozalkalmazásúkeresekkiszerelésbenzöld500

Forrás: pepitahirdeto.multiapro.com

Valósítsd meg a saját projectedet szerezz támogatási összeget magán, üzleti, vagy szociális terved megvalósításához. https://youtu.be/F4cwkaunLJk http://bit.ly/2mZHw3Q


Feladva: 2017-05-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: httpssajátmegvalósításáhozmegtervedValósítsdszociálisNoémivagyKáldorüzletipénzrendszer2mZHw3QmagánkizártbitösszegetLehetőséghttptámogatási

Forrás: pepitahirdeto.multiapro.com

Számlaképes cégünk vállalja lakások, házak, irodák, komplett költöztetését, lomtalanítását, épületen belüli átrendezését. Igény szerint csomagolunk vagy csomagolóanyagot kiszállítunk, rakodási, szerelési feladatokat is végzünk. Minőségi, gyors munka több éves tapasztalattal, referenciával, hétvégén is hétköznapi árakon! Akár lakáscsere lebonyolítását is vállaljuk. T: +36 (70)23 53 403, +36 (1) 787 0230


Feladva: 2017-05-22    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: csomagolunkvállaljuklakásokmunkaszerintlebonyolításátvállaljagyorsIgénylakáscserecégünkMinőségiátrendezésétAkárSzámlaképesvégzünkbelüliárakon0230

Forrás: pepitahirdeto.multiapro.com

Varázslatos gyermek ruhák – Vásárolj olcsón otthonról! Új tavaszi,nyári kollekció amivel kislány álmok válhatnak valóra! Gyors szállítás! Új és használt kislány alkalmi és ünneplő ruhák elérhető áron.


Feladva: 2017-04-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: ruhákkislányáronelérhetőhasználtolcsónszállításVásároljGyors8211valóragyermekválhatnakVarázslatosálmokBudapestamivelButikkollekcióManóruha

Forrás: pepitahirdeto.multiapro.com

Sárosd centrumában eladó egy 72 m2-es családi ház garázzsal, melléképületekkel, hozzá tartozó rendezett, két utcára nyíló 1200 m2-es jó fekvésű, körbe kerített telekkel (telek megosztható). Közművek: víz, villany, telefonvonal bevezetve,, gáz, csatorna telekhatáron ráköthető.


Feladva: 2017-11-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: SárosdvillanyutcáracentrumábanvízkétKözművekrendezettZsuzsannamegoszthatótartozóPálkovácstelekhozzáutcaráköthetőtelekkelmelléképületekkelJókai

Forrás: pepitahirdeto.multiapro.com

Hatékony német tanulás otthon, a Te beosztásodhoz igazítva, ingyen!


Feladva: 2016-12-18    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: németHatékonyZsuzsaKulcsárTanfolyamOnlineingyenigazítvabeosztásodhozotthontanulás

Forrás: pepitahirdeto.multiapro.com

Meg Vagy Te Őrülve??? Kidobod a tintapatronodat ahelyett, hogy feltöltenéd??? Más emberek ezrei nyomtatnak ÖTÖD-, vagy akár TIZEDÁRON, egy teljesen biztonságos, egyszerű módszerrel, súlyos ezreket, tízezreket takarítva meg a tintapatronjaikon! Nyomtass Te is ÖTÖD-, vagy akár TIZEDÁRON! Kattints és tudd meg, hogy ez mennyire olcsó és egyszerű!


Feladva: 2015-09-06    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: megvagyhogyTIZEDÁRONŐrülveakárRefillParadiseÖTÖDegyszerűmennyiretakarítvaMártízezreketfeltöltenédezreketahelyetttuddsúlyostintapatronodategy

Forrás: pepitahirdeto.multiapro.com

A Penda 1997. februárjában a Betéti Társaság-ból Kft.-vé alakult, mely a mai napig is 100%-ban magyar tulajdonban van. A vállalat immár 20 éve a termelőeszköz forgalmazók és felhasználók igényeinek kielégítésére törekszik. Húzó termékeink: rendsodrók, szárzúzók, ekék, traktorok, rendkezelők, kaszák, bálázók, pótkocsik, permetező gépek, vetőgépek. Négy telephelyen, Békéscsabán, Kecskeméten, Kiskunmajsán és Nagykőrösön szerződéses partnereink raktározzák és adják ki áruinkat.


Feladva: 2017-08-31    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: PendaKftekékszárzúzókrendsodrókáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetétitörekszik

Forrás: pepitahirdeto.multiapro.com

Miért fogyasztom a DXN cég ganodermás termékeit? Azért, mert az immunrendszeremet szeretném erősíteni és mert szeretnék meggyógyulni az általános fizikai gyengeségből. Hogyan lehet megvásárolni a DXN ganodermás termékeit? Látogasson el a honlapomra az interneten: www.rita.ganodermakave.hu/termekek a honlapomon megtalálja a megrendelés menetét, kattintson a ”kosárba tesz” ikonra. Mit szükséges tenni azért, hogy a honlapomon lévő minőségi DXN termékeket megvásárolja? ... további részletek >>

Kapcsolódjon az internetre és kattintson az egérrel ide: www.rita.ganodermakave.hu/termekek Válassza ki kattintással a terméket, töltse ki a megrendelő lapot és vásároljon!


Feladva: 2017-02-24    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: ganodermástermekekDXNrita8221ganodermakavewwwhonlapomonazértkattintsonmerttermékeitmegvásároljaerősíteniikonraGyógygombásVálasszatermékekettesz

Forrás: pepitahirdeto.multiapro.com

A német tulajdonban lévő U&D Select Group Dél-Németországba keres: betanított és segédmunkásokat marhavágóhídra és tésztagyárba! Szállás igény esetén biztosított. Munkábajárásban tudunk segíteni. Német nyelvtudás nem feltétetel! Hosszútávú biztos munkalehetőség! Heti 5 munkanap, szombatonként túlórázási lehetőség Magyar nyelvű ügyintézés. Közvetítői díj nincs! Jelentkezni és, érdeklődni a delnemetmunka@gmail.com e-mail címen lehet. Telefon: +49151/26389661 és +3630/6485271


Feladva: 2017-10-19    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: NémetbetanítottDélnyelvűNémetmunkanemcímenmarhavágóhídraMagyarSegédmunkanyelvtudásmailsegédmunkásokatlehetőségcomtúlórázásisegítenikerestudunk

Forrás: pepitahirdeto.multiapro.com

Megújult műsorral, új felállásban vállalunk fellépéseket: - falunapokon - céges rendezvényeken, bálokon. Hívjanak bizalommal. Élőzenés előadás, nem playback! Elérhetőségek és ízelítő a műsorokból a honlapon hallgatható formában. CD rendelést felveszünk Ének: Lehoczky Judit - retró - örökzöldek (angol, német, olasz nyelven) - magyar nóta - csárdások - cigány dalok - mulatós - operett német nyelven - német slágerek (német nyelven)


Feladva: 2017-04-04    [Zene - Hangszer]

Címkék, kulcsszavak: németnyelvenhonlaponJuditLehoczkyÉneklehoczkyjuditBennünketolaszkezdjükhttpBizalommalangolfelállásbanhallgathatóhívjanakörökzöldekműsorralbálokon

Forrás: pepitahirdeto.multiapro.com

Fürjtápot keres? Nálunk az is van: 159,- Ft/kg A holland De Heus takarmányokat már Magyarországon is megvásárolhatja. Kiváló minőség és széles áruválaszték jellemzi. A fürjtáptól a lótápokig minden állatfajnak tudunk tápot biztosítani. Kiszállítás megoldott, viszonteladókat is kiszolgálunk.


Feladva: 2017-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: keresKiszállításKiválóFürjtápottápotmegoldottmegvásárolhatjaPadragkúttudunkviszonteladókatMagyarországonAjkaállatfajnakkiszolgálunkmárajánlóminden

Forrás: pepitahirdeto.multiapro.com

Sport HD kamera nem csak mindenféle sport események rögzítésére alkalmas, de lehet csatlakoztatni egy autóba, egy motorra, stb tartalmaz a sokféle tartót a csomag, hogy csatolja a kamerát könnyen mindenféle helyre. Tartalmaz egy vízálló tokot is a csomag. Kamera kijelzője 2” és a tömege a kamerának akkumulátor nélkül csak 46 gramm. www.elektronikai-webshop.hu/hu/spo rt-akcio-kamerak/30-sport-kamera-er intokepernyos-hd-720p.html


Feladva: 2017-10-14    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: sportkameraegycsakTartalmaz720perintokepernyosmindenfélecsomaghtmlmotorraautóbanélkülhelyrecsatlakoztatniakkumulátorlehetkameránakkönnyentömege

Forrás: pepitahirdeto.multiapro.com

- Minden gumiabroncs új! - Számlát és 2 éves garanciát biztosítunk. - Az ár tartalmazza a szállítási költséget (*Utánvételes fizetés esetén +1500 Ft a csomagra). - Bármilyen címre szállíthat Magyarországon belül, beleértve szervizpartnereink bármelyikét. - Figyelem: Csak gumiabroncsot szállítunk. Amennyiben a képen felni is látható, csak a jobb szemlélhetőséget szolgálja.


Feladva: 2017-01-25    [Autó - Motor - Jármű]

Címkék, kulcsszavak: gumikcsakjobbbeleértveköltségetáronbelülszállításiláthatókedvezőMagyarországontartalmazzafelnitéliszállíthatbiztosítunkképencímregaranciátéves

Forrás: pepitahirdeto.multiapro.com

A legnèpszerűbb eladható tudàs a jobb agyfèltekès rajzolàs. Legyen ön is az Imre Dezső módszer akreditàlt kèpviselője. Akciós àr ötszàzezer Ft. Elvègezhető intenzív egy èv, vagy kèt èv alatt. Online konzultàciós lehetősèg tàvoktatàssal is.


Feladva: 2017-05-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 232224eladhatóegyImressaloktatóintenzívLegyentudásgezhetőrajzolvoktatlegnépszerűbbElvltekzezeragyflehetősötszjobbciósAkcióstudkonzult

Forrás: pepitahirdeto.multiapro.com

Betonozható nyers kavics, osztályozott kavics értékesítés féláron! Nyers kavics 700 Ft/tonna. Osztályozott kavics: megrendeléstől függően 1650 Ft/tonna nettó áron. Szemcseméretek: 4-8 mm 8-16 mm és 16-24 mm. Nyers kavics esetében, kitermeléstől függően akár évi 1-2 millió tonna eladása is lehetséges jól szervezett logisztika esetén. Azon cégek jelentkezését várjuk akik nagyobb mennyiséget rendelnek.


Feladva: 2017-06-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: NyerskavicstonnafüggőenféláronkavicsOsztályozott700eseténÚtépítőkkitermeléstőllogisztikaesetébenértékesítésszervezettrendelnekBetonozhatójólIlona

Forrás: pepitahirdeto.multiapro.com

Én étkezés előtt fél órával fogyasztom ezt a bio Spirulina, oroszlánsörény gomba, bolhafű, zöldtea és még sok más kiváló fűszer és gyógynövény tartalmú terméket. Én karácsonykor sem híztam meg, pedig nassoltam rendesen. A DXN Myco Veggie por megtisztítja a táplálék útját a belekben és javítja az emésztést. Kiváló választás fogyókúrához is, de a napi mozgást nem váltja ki. Én így fogyasztom: www.kavekiraly.hu/blog-2017-01-21-Gomboc_Artur_es_a_DXN_MycoVeggie_gyogynoveny_keverek webáruház: ... további részletek >>


Feladva: 2017-01-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: DXNKiválómegkavekiralyfogyasztomhttpgyógynövényMycoVeggieveggiemycoGomboczöldteaGergelyproducts2017bolhafűemésztéstTakácshíztambloggombawww

Forrás: pepitahirdeto.multiapro.com

Ausztriai kapcsolatokkal keresünk olyan agilis embereket Nemzetközi piacvezető Törzsvásárlói Rt.-hez akik Ausztriában partneri vezető Referensként tevékenykednének. Kiemelten várjuk 25-45 év közötti felsőfokú végzettséggel rendelkező céltudatos, sikerorientált munkatársak jelentkezését, akik nyitottak a tudatos vásárlási tanácsadó területre. Díjmentes, teljes körű magas színvonalú duális átképzést biztosítunk. Karrierlehetőség: • Kiemelkedő, teljesítményarányos nemzetközi jövedelem ... további részletek >>

• Életpálya program • Szakmai oktatások • Biztos háttér • Gépkocsi támogatás • Bónuszok Feladat: Az embereket és a cégeket informálni arról, hogyan tudnak tudatosan és felelősen vásárolni, ott, ahol eddig, azt, amit eddig, hogyan tudnak jelentős visszatérítéseket kapni készpénzben. A Vásárlási Tanácsadók feladata, hogy olyan plusz pénzeket tegyenek az emberek zsebébe, amely eddig is meg volt, de senki nem jutott hozzá, mert nem tudta, hogyan kell! A munkához tartozó elvárások:  Felső vezetéssel kapcsolattartás  Képzéseken való megjelenés Jövedelmi lehetőségek: Vásárlónként havonta 500-3000 forint lehetséges, teljesítményarányos jövedelem, amely kimagaslóan magasabb, mint amit Magyarországon bármilyen területen és pozícióban megkereshető! / Pl. 1000 vásárlónál 500.000-3.000.000,- millió forint havonta, EGYSZERI MUNKÁVAL!!!! / Gondolja át, hogy Ausztriában 8 588 584–en élnek és hányan vásárolnak nap, mint nap, és ennek megfelelően kiszámolhatja a havi jövedelmét is!!!! Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet! Email: rozsabusiness@gmail.com


Feladva: 2017-04-04    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8226eddigVásárlásihogyanjövedelem000AusztriaiteljesítményarányosakikAusztriábanmeghogynapmintemberekethavontatudnakforintnemzetköziamitnem

Forrás: pepitahirdeto.multiapro.com

Lakást keresek Budapesten 13 millió forintig. Elsősorban X., XIX.,XX., XXI., XVIII., XIV., XVI., XVII. XV. kerületekben, lehet felújítandó vagy átlagos állapotú. Minimum 15 nm-től.


Feladva: 2017-08-21    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: BudapestenkeresekLakástállapotúXIXátlagosElsősorbanvagyforintigfelújítandómilliólehetkerületekbenXVIIXVIBalázsXIVtőlXVIIIMinimumXXI

Forrás: pepitahirdeto.multiapro.com

Segítünk berendezni, kérje Önnek szóló ajánlatunkat: www.hu-mago.hu/boltok-tervezese-sz erelese Vállaljuk boltok: felmérését, tervezését, látványterv készítését, összeszerelését, bontását. Szolgáltatásaink: » Boltok tervezése, szerelése » Bevásárlókocsi felújítás » Galvanizálás » Raktári állvány építés » Sorompó telepítés Új és használt forgalmazott termékeink megtekintéséhez látogasson el weboldalunkra!


Feladva: 2017-04-17    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 187BoltokszerelésetervezéseösszeszerelésétkérjeállványkészítésétweboldalunkraberendezniRaktárilátványtervlátogassonSegítünkGalvanizálástervezésétmago

Forrás: pepitahirdeto.multiapro.com

PD Generál Kft Bontásban az első! Gépi földmunkát vállalunk, főképpen Baranyában, de nagyobb volumenű munka miatt az országba bárhova képesek vagyunk elmenni. Az ár mennyiségtől - időtartamtól és helytől függ. Hívjon minket bizalommal, biztosan meg egyezünk!


Feladva: 2016-10-12    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GépiegyezünkföldmunkavagyunkföldmunkátmegbontásképesekbiztosanbárhovaelsőbizalommalországbaBontásbanminketmiattKftHívjonmunkaGenerálfügg

Forrás: pepitahirdeto.multiapro.com

Massive Tools Magyarország legnépszerűbb ipari felsőmarókés családja. Több mint 20 éve a hazai piacon. Ár/Minőség, legjobb. www.felsomarokes.hu és www.botex.ro Telefon: 70/3788393 További import termékeink: Csiszolószivacsok, szorítók, körfűrészlapok...


Feladva: 2017-05-22    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: botexfelsőmarókéswwwToolsMassiveiparifelsomarokeslegnépszerűbblegjobbMagyarországMinőségcsiszolószivacsokpiacontermékünkhazaiBudakesziimportéve

Forrás: pepitahirdeto.multiapro.com

Dormán László mosógépszerelõ vállalja Whirpool, Ignis, Polar, Energomat, Minimat, Midimat, Energolux, LG, Zanussi, NDK-s WA tipusú, stb. automata mosógépek javítását. MOSÓGÉPSZERVIZ KISPESTEN a kerületben lakóknak, mosógépszerelés munkanapokon, akár 4 órán belül is lehetséges. Mosógépszerelés: Erzsébet, Kõbánya, Pestlõrinc, Pestimre, Csepel, Soroksár, Ferencváros, Józsefváros, Kispest és a XVII. ker.-ben. www.mosogepszereles-javitas.hu


Feladva: 2016-03-14    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 245MosógépszerelésDormánkerLászlówwwZanussirinclakóknakhttpEnergoluxXIXkerületbenbenMidimatPestlBudapestKISPESTENMinimatbányaMOSÓGÉPJAVÍTÁS

Forrás: pepitahirdeto.multiapro.com

Táplálékunk az egészségünk! Túlszennyezett világunkban rengeteg káros anyag halmozódik fel bennünk, ezért fontos a szervezetünk megtisztítása, és az ételeink megtisztítása is! Ehhez nyújt segítséget e készülék, mely ózonnal (O3) kitisztítja a zöldségekbe, gyümölcsökbe felhalmozódott vegyszer, rovarölő-szer maradványokat. A húsokból és halakból a hormon és egyéb maradványokat. De fertőtleníthetjük lakásunkat, autónkat a különböző gombáktól, baktériumoktól is. Igazi természetes fertőtlenítő!


Feladva: 2014-10-23    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: megtisztításamaradványokatfertőtlenítőkészülékvegyszerautónkatvilágunkbanfelhalmozódottételeinklakásunkatTúlszennyezettgyümölcsökbeszervezetünkegészségünk

Forrás: pepitahirdeto.multiapro.com

Gondja van egészségével? Érszűkületes? Csontritkulása van, vagy lúgosítani szeretné szervezetét? Esetleg cukorszintjén szeretne javítani? Látogassa meg oldalamat www.vitalioninfo.lapunk.hu Ajánlataim segítik Önt egészsége megőrzésében és jobbá tételében: allergia, bőrproblémák/ ekcéma,pikkelysömör,herpesz,lábszár fekély/erősödik immunrendszere, pótolja vashiányát, változókori problémákra, vízhajtó,alvássegítő, nyugtató, emésztéssegítő,cisztára,és daganatos betegségek megelőzésére.


Feladva: 2015-12-27    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vanszeretneÖntcukorszintjéncisztáralábszárfekélyVitalionsegítikEsetlegemésztéssegítőherpeszHRIAjánlataimszervezetétnyugtatópikkelysömörlapunkekcéma

Forrás: pepitahirdeto.multiapro.com

Minden típusú automata váltó javítása, felújítása korrekt árakon, garanciával, kifogástalan minőségben! Vállaljuk automata sebességváltók tuningját, verseny célú átépítését, megerősítését is. Csak minőségi, megbízható anyagok felhasználásával dolgozunk! Több éve jelen vagyunk a versenysportban, jelentős tapasztalatokat gyűjtöttünk. Várjuk céges megrendelők megkeresését is! Rendszeres megrendelés esetén jelentős kedvezményeket biztosítunk a munkadíjból. További információ: Facebook: Mopar Garage


Feladva: 2016-10-21    [Autó - Motor - Jármű]

Címkék, kulcsszavak: automatajelentősváltóTovábbiVállaljukVárjukEgermegbízhatómunkadíjbólminőségbengyűjtöttünkCsabaminőségibiztosítunkkifogástalantapasztalatokatHorváth

Forrás: pepitahirdeto.multiapro.com

A vakbél gyulladása gyakori probléma, főként férfiaknál és fiatalabb korban jelentkezik. Tünete lehet a puffadás, étvágytalanság, rossz közérzet, a köldök és gyomortáji fájdalom, előrehaladott állapotban láz is jellemzi. A vakbél gyulladás kezelése kizárólag műtéttel történhet. Miután a betegséget diagnosztizálták, az orvos a lehető leghamarabb sort kerít a gyulladt szövetek eltávolítására a szövődmények - vakbél perforálódása - elkerülése érdekében. A vakbélgyulladás elleni terápiák a műtét ... további részletek >>

után magukban foglalják antibiotikum szedését a fertőzés megelőzéséhez, valamint az első néhány napban pépes ételek fogyasztását.


Feladva: 2016-10-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vakbélgyulladáskezelésenéhánykizárólagterápiákrosszkerítgyakorielsőelleniétvágytalanságsortKittivalamintvakbélgyulladáspuffadásleghamarabbKellér

Forrás: pepitahirdeto.multiapro.com

Albérletből könnyedén saját otthonba! Kérd segítségünket! Üzenetben megadott telefonszámon is visszahívunk. Albérletben te is saját lakásról álmodozol? Esetleg meglévő lakásodat bővítenéd, vagy cserélnéd nagyobbra? Amiben segíteni tudunk: Havi 20.000 forinttal, 30 %-os vissza nem térítendő állami támogatással, OBA garanciával, kamatadó- és járulékmentesség. Álmaid otthona neked is elérhető! Kérd üzenetben ingyenes visszahívásunkat telefonszámod és egy számodra megfelelő időpont ... további részletek >>

megjelölésével. Segítünk megteremteni, eligazítunk a lehetőségek között. Tájékoztatást nyújtunk személyesen. www.otthonteremtes-biztonsaggal.webnode.hu/ bindererika56@gmail.com


Feladva: 2016-12-26    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: sajátüzenetbenKérdvagycomtámogatássalOTTHONeligazítunknagyobbravisszahívunkbindererika56@gmailállamiALBÉRLETmegteremtenicserélnédtelefonszámonwebnode

Forrás: pepitahirdeto.multiapro.com

Alumínium profilok porfestése. Például: Ablakok és ajtók, kapuk, zsaluk, medencefedő szerkezetek, kerítések elektrosztatikus felületi kezelése porszórással. Kérje árajánlatunkat! Szeretettel várjuk!


Feladva: 2016-07-21    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: AlumíniumvállalunkSzeretettelkapukporfestéstárajánlatunkatajtókKérjeAblakokporszórássalPéldáulkezeléseporfestésefelületiprofilokelektrosztatikusKft

Forrás: pepitahirdeto.multiapro.com

IFETCH - az igazi szórakozás Önnek és kutyájának! Újdonság a kutyajátékok piacán!! www.petsafe.hu/hu/ifetch-labdakilo vo/444-ifetch-labdakilovo-kutyaknak .html


Feladva: 2016-01-05    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: ifetchkutyajátékokÚjdonságkutyájánakhtmlÖnnekkutyaknakszórakozáslabdakilovigaziPápa418KftpetsafeTradinghttpWilsonpiacánkutyajáték

Forrás: pepitahirdeto.multiapro.com

Rendelj online, mi pedig szélsebesen szállítjuk neked! Ragyogj Te is Rossettiben! · Ingyenes átvétel Bp-en · Online fizetés · Házhoz szállítás · Pick Pack Pont átvétel Fülbevalók - Gyűrűk - Akciós termékek - Nyakláncok - Szettek


Feladva: 2017-10-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: 183OnlineátvételPontnekedSzépPackszállítjuktermékekPickszélsebesenNyakláncokpedigSzettekszállításRendeljHázhozajánlásfizetésHirdetőAkciós

Forrás: pepitahirdeto.multiapro.com

A budapesti Széll Kálmán téren kerestek munkát azok, akik nevére, mint kiderült, egy bűnbanda cseh cégeit íratták. A bűnszövetség irányítói előzetes letartóztatásban vannak. A teljes cikk: www.promenad.hu/cikk/munkat-kereso k-adataival-eltek-vissza-183564


Feladva: 2017-11-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: munkátkeresokcikkvisszaeltekadataivalbűnszövetségírattákkerestekmunkatcégeittérencsehKálmánpromenadbűnbandaSzéllwwwegybudapestiteljesvannak

Forrás: pepitahirdeto.multiapro.com

Elhunyt szerettei fotóját megörökítő porcelán plakettek. Fénykép alapján porcelánfestékkel készülnek, 80 °C felett beégetve, kopásálló felülettel és fotó minőségben. Plakettek nagy forma és méretválasztékban! Sürgősséggel akár 2 nap alatt is elkészül a sírkőkép és már a ravatalozáson is ott lehet.


Feladva: 2016-01-04    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: PlakettekporcelánkészülnekBudapestméretválasztékbanporcelánfestékkellehetDekormániaformaalapjánottfényképesnagyFényképravatalozásonragaszthatómár

Forrás: pepitahirdeto.multiapro.com

Az általunk ajánlott technológiával 2 fős személyzettel, egyetlen gépjárművel elvégezhető az aszfaltburkolat javítás, bontási munkálatok nélkül. Ami még fontosabb: a javítás költsége akár 40%-al is kevesebb lehet ezzel a módszerrel, valamint a létrejövő hő-kötés miatt lényegesen tartósabb megoldást nyújt. Végül, de nem utolsó sorban a helyszínen újrahasznosítjuk az összes jelenlévő anyagot, ezáltal hulladékelszállításra sincs szükség. Mi minőséget nyújtunk! Keressen bizalommal!


Feladva: 2014-02-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: télenjavításújrahasznosítjukegyetlenkötésnyújtunkméghelyszínenszemélyzettellétrejövőminőségetamisorbanfősvalamintIlletveutolsótechnológiávalnem

Forrás: pepitahirdeto.multiapro.com

Támogassa a koraszülött babák ellátását adója 1 százalékával! Miért minket támogasson? Köszönjük, ha elolvassa: www.anokert.hu/ado-1


Feladva: 2017-09-27    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: adobabákanokertkoraszülöttwwwTámogassaelolvassaajánlóKöszönjükHirdetőtámogassonPepitaminket8206MiértBabákértszázalékávalSzázalékadójaAdó

Forrás: pepitahirdeto.multiapro.com

A SkyWatcher 70/500-as lencsés távcsövét kis méretének, könnyű súlyának köszönhetően egyszerűen magunkkal vihetjük családi kirándulásaink alkalmával. Városoktól távol, sötét égen igen kitűnő mély-eges távcső: hatalmas látómezejébe sziporkázó nyílt halmazok sokasága vagy a kiterjedt, sejtelmes csillagközi ködök is beleférnek. De a távcső nappal sem hagyja unatkozni: jól használható spektívként a környező táj megfigyelésére. Az alaptartozék zenittükör egyenes állású, de jobb-bal irányban ... további részletek >>

megcserélt képet ad. A csomagban 25 mm-es, valamint 10 mm-es Super Bárium okulárokat találunk, melyek 20x és 50x-es nagyítást adnak. Spektívként alkalmazva 8-24 mm zoom okulárt javaslunk, mely a 21x-62x nagyítástartományt fedi le. Még nagyobb nagyítások elérésére egyszerű 2x-es Barlow lencse is a csomagban található. Az AZ-2 mechanika egyszerűen használható, ideális természetfigyelésre. Az okulártálcára számos kiegészítőt helyezhetünk, akár az észlelőteánkat is. A kihúzható alumíniumláb pedig testmagasságunkhoz igazítható. www.tavcso-mikroszkop.hu/termek/skywatcher-70-500-az2-refraktor


Feladva: 2017-07-01    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: skywatchertávcsőSpektívkénthasználhatóegyszerűen500csomagbanmelyködökPepitaigazíthatózoomSuperegestermészetfigyelésremegfigyeléséremagunkkalkitűnő

Forrás: pepitahirdeto.multiapro.com

Egyedi póló nyomtatás: legyen akár születésnap, legény- vagy leánybúcsú, vagy bármilyen más alkalom, egy egyedi póló mintázása, feliratozása nagyszerű ajándék. A Pólósaroknál céges pólót is rendelhet, emblémával láthat el, a pólótervezőben meg is tervezheti. Gyors, országos kiszállítás, pamut termékek. Pólósarok.hu


Feladva: 2017-08-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: egyedipólóvagymegmintázásaakárpólótervezőbenlegyenláthatnyomtatásemblémávalegyBudapestrendelhetalkalomPétertermékekpólótmásKisspamutcéges

Forrás: pepitahirdeto.multiapro.com

”B” kategóriás jogosítvánnyal vezethető kisteherautók bérbeadása Budapesten és környékén rövid távra, vagy hosszú távra is tartós bérlettel, akár külföldre is. www.teherautorent.hu +3630/298-4353


Feladva: 2017-04-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: távra8221rövidbérlés3630környékénTeherautóteherautorentBudapestenwwwbérbeadásakülföldrekisteherautókakárvezethetőbérletteljogosítvánnyaltartós298

Forrás: pepitahirdeto.multiapro.com

Már szembesült vele, hogy a hazai szociális háló nem fogja megvédeni? Ha időben nem gondoskodik nyugdíjas éveiről, akkor komoly bajba kerülhet! Búcsút inthet azoknak az idilli pillanatoknak, amelyekről álmodozott, hogy majd átéli öreg napjaiban, mint ahogy a tőlünk nyugatabbra élő nyugdíjasok meg is teszik. Rájött már arra is, hogy egy hagyományos munkahelyen nincs biztonságban a jövője? Elég egy új törvény, egy átszervezés, egy akvizíció, vagy csak egy új vezető és láthatóan egy-egy ... további részletek >>

piaci szegmens azonnal tönkremegy, és ez magával vonzza a tömeges elbocsátásokat is! Tapasztalja a várólisták hosszúságát, a súlyos orvos- és nővérhiányt, illetve az egészségügyi intézményekben tapasztalható katasztrofális állapotokat? A saját bőrén érzi, hogy miképpen fizeti meg a banki-, a telekommunikációs- és egyéb különadókat, mennyi a hitele havi törlesztő részlete, mennyit veszít reálértékéből megtakarítása és hány ember veszítette el még ezt is a becstelen pénzügyi szektor szereplői miatt? Elérkezett arra a pontra, amikor már teljesen tudatában van, hogy megoldást kell találnia mert a megtakarításai elolvadnak, a pénzügyi szektorba fektetett bizalom a múlté, a kor előrehaladtával az egészségünk sajnos nem javul és a döntéshozók elképzelései szerint alakuló szabályzók lehetetlenné teszik a hosszú távú tervezést és a stabil jövőkép kialakítását? Ha változtatni akar ezen akkor jelentkezzen: rozsabusiness@gmail.com


Feladva: 2017-03-28    [Pénzkeresés - MLM]

Címkék, kulcsszavak: egyhogynemmégmárarrateszikakkorpénzügyijavulveszítetteTapasztaljaátélielolvadnakmennyivezetőkomolytervezéstamikorkatasztrofálishagyományos

Forrás: pepitahirdeto.multiapro.com

Próbálja ki a mobil számítógép szerviz előnyeit. A javítást intézze kényelmesen, otthonából! Házhoz megyünk és megoldjuk számítógépes problémáit, legyen szó asztali számítógépről, vagy laptopról. 1 órán belüli munkavégzés esetén, csak kiszállási díjat kell fizetni! Készséggel segítünk mindenben, kérje tanácsunkat! Tel: 0620-4-117-117 www.pcjavitas.net


Feladva: 2016-04-18    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: szerviznetpcjavitas117számítógépszámítógépestanácsunkatmobilmunkavégzésmegoldjukkérjePróbáljabelülimegyünkmindenbenBudapestenóránHázhozsegítünk

Forrás: pepitahirdeto.multiapro.com

Területi Igazgatókat Keresünk! Közép-Európa (Magyarország, Ausztria, Románia, Szlovákia, Ukrajna, Szerbia, Szlovénia, Horvátország, Csehország) területéről keresünk vállalkozókat, vállalkozásokat az Intercontact Marketing Network Kft. információs rendszerének további kiszélesítésére és szervezői munkáira. Amit kínálunk: Eredményes próbaidő után kizárólagos területi képviseleti jogot adunk. Bérezés, juttatások: Kiemelkedően magas jutalékot biztosítunk. Akiket keresünk: Elsősorban ... további részletek >>

azok jelentkezését várjuk, akik kapcsolatban állnak az ipar, a mezőgazdaság, a kereskedelem és a szolgáltatás ágazataiban tevékenykedő vállalatokkal, cégekkel, vállalkozásokkal. Főbb területek: Árualap és szabad gyártói kapacitás felkutatása, nemzetközi anyagos és bérmunka kihelyezése. Főleg a fémipar - faipar - építőipar - élelmiszeripar gyártói kapacitás lekötés, valamint a beruházás, export-import, projekt finanszírozás, vegyesvállalat alapítás profiljában vagyunk érdekeltek. Elvárások: Maximális megbízhatóság és szorgalom. Előnyt jelent már meglévő közép - nagyvállalati ügyfélkör, de nem alap elvárás. Fő célunk: Minél több gazdasági, üzleti információt biztosítani, üzleteket létrehozni a magyar gazdaság szereplői számára. Az üzleti lehetőségek, megrendelés, befektetés, ingatlan és cég adás-vétel üzleti ajánlatok ismertetése. Tevékenységünk: Külföldi üzleti partnerközvetítés, nemzetközi gazdasági stabil üzleti kapcsolatok, folyamatos megrendelések létrehozása. Kiemelten fontos tevékenységünk a magyar áruk és termékek külpiaci bevezetése, külföldi piackutatás. Feladat: Piacképes magyar gyártók és árualapok felkutatása. Nagyon sok esetben konkrét minták és műszaki dokumentációk is rendelkezésünkre állnak. Elsősorban profi és minőségi szinten lévő, komoly munkákra képes üzletembereket, cégeket keresünk. Jelentkezés: Még ma jelentkezzen ! Csatlakozzon hozzánk ! Várjuk megbízható, profi üzletemberek, cégek, vállalkozások jelentkezését ! Legyen Ön is egy 27 éve sikeresen működő cég munkatársa! Részletesebben: www.intercontact.hu/kepvis/kepvis1.html További információ: Tel: +36 30 449 7559 imn@t-online.hu


Feladva: 2017-04-17    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: üzletiintercontactkeresünkmagyarkapacitásközépprofigyártóicégwwwVárjukkülföldihttpterületigazdaságifelkutatásaElsősorbannemzetközijelentkezését

Forrás: pepitahirdeto.multiapro.com

Bellelli B-One Clamp gyerekülés, hátsó, csomagtartóra szerelhető Hátsó gyermekülés. Szerszám nélkül a csomagtartóra rögzíthető. Használata 7 éves korig javasolt. Maximum teherbírás 22 kg. Egy kézzel ki/be csatolható biztonsági öv. Szürke vagy kék színben. www.bicyclewebshop.com/?1260,belle lli-b-one-clamp-gyerekules-hatso-cs omagtartora-szerelhetö=2591


Feladva: 2017-09-18    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: gyerekülésclampcsomagtartóraonebellelliHátsószerelhetőwwwjavasoltszínbenkorigajánlókékévesHirdetővagyHasználataPepitaSzürkerögzíthetőKerékpár

Forrás: pepitahirdeto.multiapro.com

A fekete bodza sok olyan hatóanyagot tartalmaz, melyekkel hosszútávon is növelhetjük védettségünket a különböző betegségekkel szemben. Az immunerősítéshez az egyik legjobb gyógynövény, hiszen hatékony a vírusokkal, baktériumokkal szemben vívott harcban, természetes antibiotikumként viselkedik, miközben a már fennálló betegség tüneteinek csökkentésére is képes. A Sambucol bodza szirup gyerekeknek is egész évben adható étrendkiegészítő, melyet a láz és a köhögés csillapításához is használhatunk. ... további részletek >>

Biztonságos és rendszeresen alkalmazható székrekedés és bélgyulladások esetén. Sambucol fekete bodza szirup rendelés itt!


Feladva: 2017-05-23    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: bodzaszirupSambucolszembenfeketeimmunerősítéshezrendszeresengyerekeknekKittiharcbanittbetegségekkelBiztonságosképesKellérvívottrendeléskülönböző

Forrás: pepitahirdeto.multiapro.com

Alig használt sodastream gép eladó


Feladva: 2017-11-10    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: gépeladósodastreamhasználtAligZamárdiPéterBuzásEndrédi

Forrás: pepitahirdeto.multiapro.com

Német egyéni és kiscsoportos nyelvoktatás, korrepetálás, vizsgafelkészítés veszprémi, központhoz közel fekvő családias nyelvstúdióban. Részletek és jelentkezés: www.nyelvstudio.hu/#/start


Feladva: 2017-02-06    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: NémetVeszprémcsaládiasfekvőNyelvstúdióközelVölgyhídközponthozmagánoktatásveszpréminyelvstudiovizsgafelkészítéswwwkorrepetáláshttpnyelvoktatásegyéni

Forrás: pepitahirdeto.multiapro.com

A Sport Full HD kamera alkalmas mindenféle sportesemény rögzítésére. A csomagban talál sok konzolt és szalagot, amelyekkel a kamera könnyen felrögzíthető sisakra, testre, kormányra, vagy az autóban tetszőleges helyre. A kamera maximális felbontása 1080p (1920x1080) és vízálló 30 méter mélységig. 4 színváltozatban elérhető. Rendelje meg megbízható helyről 2 év garanciával itt: www.elektronikai-webshop.hu/hu/spo rt-akcio-kamerak/31--gocam-sj4000-a kcio-kamera.html


Feladva: 2017-09-20    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: kameraakciosj4000gocamsport1080pkönnyenhelyrőlFullfelbontásaamelyekkelmegbízhatóajánlómaximálisszalagotmegHirdetőhelyrekonzoltRendeljePepita

Forrás: pepitahirdeto.multiapro.com

Első mini gurtni csere ára 6000 Ft, a többi 3000 Ft/db. Első maxi gurtni csere ára 7000 Ft, a többi 4000 Ft/db áron tudjuk vállalni. Pest megye egész területén ingyenes kiszállással. Munkáinkra garanciát vállalunk! A szolgáltatás megrendeléséhez hívja a 061 445 11 81 telefonszámot. Adja meg ügyfélszolgálatunknak nevét, címét, elérhetőségét és egyeztessen egy időpontot, amikor szakembereink kicserélhetik a gurtnit. Telefonszám: 061 445 11 81 Email: ajanlatkeres@redony-szereles.org ... további részletek >>


Feladva: 2017-01-05    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megcsereszerelesgurtniElső445061többiáraorgredonyidőpontotmegrendeléséhezWebvállalniegy3000Ftszolgáltatásajanlatkeres@redonytudjukegyeztesen

Forrás: pepitahirdeto.multiapro.com

Miért érdemes még hozzánk jönni? ⋅ mert ha valamit nincs nálunk, azt 24-48 órán belül megszerezzük ⋅ mert termékigényét eljuttathatja hozzánk a webáruházon keresztül, vagy e-mail-en, amit aztán célba juttat egy futár, esetleg átveheti egy PickPackPont-on, de akár személyesen is ⋅ mert üzletünkben van: spirálozás, fénymásolás, laminálás, nyomtatás, bélyegzőkészítés és szkennelés, (e-mail-ben juttassa el hozzánk dokumentumait majd a kész kötészeti anyagot vegye át a ... további részletek >>

futártól, vagy a PPPonton. ⋅ mert szakmai tanácsot is adunk (térítés nélkül!). Aki inkább a hagyományos vásárlást részesíti előnyben, azt szeretettel várjuk kiskereskedelmi üzletünkben: 1133 Budapest, Dráva u. 5/d. H - CS: 9.00 - 17.00; P: 9:00 - 16:00 óra között.


Feladva: 2017-10-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: mert8901hozzánkaztvagymailBudapestegyüzletünkbennélkülesetleganyagotbelülnyomtatásajánláskiskereskedelmitérítésfutárkötészetióránlaminálás

Forrás: pepitahirdeto.multiapro.com

Zsolt vagyok konyhán szeretnék dolgozni Konyhai kisegítő, Előkészítő, Pizza szakács, Mosogató Köszönöm 06309205255


Feladva: 2017-08-26    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: konyhánZsoltdolgozniszeretnék06309205255vagyokKöszönömMosogatóBudapestszakácsTörökPizzadolgoznékElőkészítőkisegítőKonyhai

Forrás: pepitahirdeto.multiapro.com

A goji bogyó és a chia mag szuperélelmiszerek, melyeknek nevét ma már az egész világon ismerik. Immunerősítő és antioxidáns hatásuknak köszönhetően nagyon jól felhasználhatók a betegségek megelőzéséhez. A goji bogyó szuperélelmiszer legfőbb hatóanyaga a zeaxantin és a béta-karotin, melyek egyenként is óvják a szem egészségét, együtt pedig még fokozottabban segítenek a látásromlás elkerülésében még idősebb korban is. Agyműködést serkentő, energiát adó, fáradtságot megszüntető hatása miatt a ma ... további részletek >>

embere számára különösen értékes növény. A szuperélelmiszerek jótékony hatásai kapcsán tudjon meg még többet: www.gyumolcsok.veganostra.hu/goji-novenyi-feherje


Feladva: 2016-12-06    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: mégszuperélelmiszerekbogyógojiVeganostraegyenkéntszámárabetegségekidősebbmártöbbetmelyekemberefelhasználhatókelkerülésébennevétkarotinmiattjól

Forrás: pepitahirdeto.multiapro.com

Ajándékozz névnapra, születésnapra gravírozható, rozsdamentes fém flaskát. Minden féle méretben, különböző ón matricákkal is kapható. Érdeklődj telefonon: 30 640 5940, postázni is tudjuk. www.hunbolt.hu/spd/2041/Flaska-kul onbozo-meretben-gravirozhato-laposu veg


Feladva: 2017-02-13    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: kaphatóméretbenMindenpostázniflaskát5940fém640rozsdamentestelefonongravírozhatóÉrdeklődjszületésnapranévnapramatricákkalAjándékozzkülönbözőBudapest

Forrás: pepitahirdeto.multiapro.com

Németországba keresünk fizikai betanított munkára férfi, női dolgozókat. Német nyelvtudás szükséges, jó kereseti lehetőség. Fényképes önéletrajzát várjuk i jckft.hr@gmail.com címre.


Feladva: 2016-02-24    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: betanítottfizikaivárjukmunkáramunkaönéletrajzátNémetországiFényképeslehetőségkeresünkkeresetiNémetországbaszükségesZalaegerszegnyelvtudásKftcímre

Forrás: pepitahirdeto.multiapro.com

Cégünk, a SkandiVisual egy építészeti és látványtervezési kreatív stúdió. 3D Illusztrációinkkal mindig az egyediségre, és különlegességre törekszünk, mert hiszünk abban, hogy egy jó ötlet megérdemli a megfelelő előadásmódot. Különböző módokon segíthetjük a projektek marketingjét: fotórealisztikus építészeti látványtervek, belsőépítészeti látványtervek, körpanoráma készítés, fotómontázs, 3D illusztráció alaprajzokhoz, 3D modellezés 2D rajzok alapján, családi ház léptékű építészeti tervezés és ... további részletek >>

tanácsadás. Keressen fel minket, és mi megelevenítjük az elképzeléseit! www.skandivisual.hu


Feladva: 2016-11-30    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: építészetiskandivisualtanácsadástervezéslátványtervekegyKülönbözőkülönlegességrefotómontázselőadásmódotegyediségrekészítésmegfelelőmindigkörpanorámaház

Forrás: pepitahirdeto.multiapro.com

Aranyszarvas Apartmanház! Szarvason a Történelmi Magyarország szívében található Aranyszarvas Apartmanház Étterem és Grill Terasz újra megnyitotta kapuit. Vendégeink számára biztosítjuk a felejthetetlen, élményekben gazdag kikapcsolódást és pihenést. Minőségi apartmanok, 100 méter széles vízpart, óriási medencék, jacuzzik, szaunák várják a pihenni vágyókat.


Feladva: 2017-09-09    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: AranyszarvasÉtteremApartmanházvárjákSzarvaspihenéstTeraszszaunákajánlókikapcsolódástGrilljacuzzikHirdetőgazdagmedencékPepitaélményekbenóriási100

Forrás: pepitahirdeto.multiapro.com

Típus: Kompakt Érzékelő: 20 Mp CMOS LCD: 3.2”, 1.620.000 pont, Fix, érintőképernyő Videó: 1920×1080 (60p kép/mp) Áramforrás: Li akku + töltő (Alaptartozék) Memória: SD-XC, SD-HC, SD Optikai zoom: 25× (24 - 600 mm) optikai stab. Magyar menü, CMOS érzékelő, LCD touch, Wifi Megtekinthető: www.digifenykep.hu/canon/kompakt-p owershot-sorozat


Feladva: 2017-05-22    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: LCDérzékelőezustCMOSg9xpowershotcanonoptikaiPepitaMegtekinthetőzoomérintőképernyőWifiMemóriaFixtouchAlaptartozékponttöltő000akku6208221

Forrás: pepitahirdeto.multiapro.com

Selyemvirágokat, műnövényeket rendeljen a Zöldvilág Webáruházban! Most az ősz színeiből is tud válogatni.


Feladva: 2017-09-26    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: SelyemvirágZöldvilágGyőrválogatniWebáruháztudNagykereskedésszíneibőlőszműnövényMostWebáruházbanrendeljenműnövényeketSelyemvirágokat

Forrás: pepitahirdeto.multiapro.com

Saeco, Jura, Solis használt automata kávégépek forgalmazása, javítása. Minden kávéfőzőre 6 hónap garancia. Országos házhoz szállítás. Ár: 35.000 HUF.-tól. Házhoz szállítás 2.000 HUF. www.caffeshop.hu/index.php/caffesh op


Feladva: 2015-04-27    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: HUFautomataJuraSaecocaffeshopMindenNagywwwjavításakávéfőzőkforgalmazása2000kávégépekszállításHázhozhasználttólSolis35000garanciahónapSásd

Forrás: pepitahirdeto.multiapro.com

Ásványból készült ékszerek, nyakláncok, karkötők hihetetlen árakon, most nagyszerű kedvezményekkel a Lili Bizsu Webáruházban. Karkötők már 290 Ft-os akciós ártól! www.lilibizsu.hu/fokat/5627b9518x2 82-ASVANY-EKSZEREK


Feladva: 2017-04-10    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: LiliKarkötőkBizsuakciókedvezményekkelásványékszernagyszerűmostártólárakonakcióshihetetlen290FtnyakláncokmárékszerekkészültWebáruházbanÁsványból

Forrás: pepitahirdeto.multiapro.com

Rajtad is múlik, hogy NE legyenek katasztrófák, NE pusztuljon ki a világ! www.onfejlesztes6.webnode.hu/


Feladva: 2017-06-19    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: webnodeRamsbergonfejlesztes6ÉvahttpHalmaivilágNyárinépusztuljonDorfstrkatasztrófákOberelegyenekhogymúlikRajtadBayern

Forrás: pepitahirdeto.multiapro.com

0-24 darázsirtó gyorsszolgálat vállalja Budapesten és országos kiszállással darazsak, lódarazsak azonnali eltávolítását porozásos, permetezéses eljárással. Oldalunkon hasznos darázsirtási tanácsokat olvashat a házilagos darázsirtással kapcsolatban.


Feladva: 2015-07-30    [Lakossági szolgáltatás]

Címkék, kulcsszavak: porozásosBudapestpermetezésesdarázsirtókapcsolatbaneltávolításátZoltándarázsirtássalazonnaliGoldnerházilagoslódarazsakdarázsirtásolvashatdarazsak

Forrás: pepitahirdeto.multiapro.com

Vízszerelést, javítási munkákat, épületgépészeti munkákat, vízvezeték szerelési munkákat vállalunk Budapest és környékén, Pest megyében. Csaptelep csere, mosdó, mosogató csere javítás, vízóra csere, beépítés. Kerti csap készítés, kerti akna, vízóraakna készítése, telepítése. Minden ami vízzel kapcsolatos, szerelés, javítás, kivitelezés. Szivattyúk telepítés fúrt kutakra, kútfej telepítés, szerelés, javítás. Csaptelep csere, javítás (zuhany, kád, mosdó, mosogató), teljes felújítás ... további részletek >>

lebonyolítása. Keressen minket bizalommal!


Feladva: 2017-04-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: javításcserekertiCsapteleptelepítésmunkákatmosdóvízóraPestvízszerelőszerelésfelújításaknamosogatóVízszerelésfúrtszerelésiSzivattyúkkészítéskád

Forrás: pepitahirdeto.multiapro.com

Lepje meg gyermekét, szeretteit, barátait, ismerőseit egy igazán különleges ajándékkal, egy HAPPY BIRTHDAY dallamot játszó serleg-focilabda vagy egy rózsaszín virág alakú tortatűzijátékkal, tortagyertyával! Kiszállítás postai, vagy futár csomagban!


Feladva: 2014-11-22    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: egyserlegvirágrózsaszínfocilabdagyermekétlatvanypont@gmailjátszómegmaildallamotLepjetortagyertyávalBIRTHDAY0775SzegedtortatűzijátékkalHAPPY863

Forrás: pepitahirdeto.multiapro.com

Most vegye meg, vagy kösse le álmai otthonát, nyaralóját! Nálunk most akár önerő nélkül is lakáshoz juthat! Amennyiben tőlünk (vagy megbízott ingatlanközvetítőinken keresztül) vásárolja meg lakását, a CSOK és a kedvezményes kamatozású hitelügyintézésben is segítünk önnek! Ezen felül partner ügyintézőnk állami támogatás intézésében is segít önnek + 8 millió Forint államilag garantált kedvezményes hitel intézésében is! A kivitelezést már megkezdtük! BADACSONY LEGKORSZERŰBB ... további részletek >>

PANORÁMÁS, ENERGIATAKARÉKOS KLIMATIZÁLT TÁRSASHÁZA ÉPÜL! CSOK IGÉNYBE VEHETŐ!!! www.facebook.com/groups/1573877696240446/permalink/1690129964615218


Feladva: 2017-07-21    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kedvezményesvagyönnekmegCSOKintézésébenmosthitelNálunk16901299partnerÁlomotthonTÁRSASHÁZAmegbízottnyaralójátpermalinkfelülKLIMATIZÁLTgarantált

Forrás: pepitahirdeto.multiapro.com

Elakadt, balesetet szenvedett, lerobbant? Hívjon és segítünk! Professzionális járműveinkkel akár 1 órán belül a műszaki a mentést megkezdjük. Személyautó, teherautó, kamion, mezőgazdasági járművek mentése daruzással, emelővillával, csörlőzéssel, vontatással. Járművek elszállítása, őrzése, javítása egy helyen ha szükséges, biztosítókkal együttműködő partnerként. Alapdíj: 15000 Ft + óradíj Árainkról bővebb tájékoztatást telefonon adunk.


Feladva: 2017-01-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: KomlókamionJárművekvontatássalműszakiElakadtpartnerkéntcsörlőzésselbelülegyüttműködőemelővillávalóránJánosbiztosítókkaldaruzássalakáradunkTóthegy

Forrás: pepitahirdeto.multiapro.com

A GaBChat egy kifejezetten mobiltelefonra készített chat. Nem számítógépes chatből lett lekonvertálva, ezért nem tartalmaz semmilyen felesleges multimédiás elemet. Úgy lett megtervezve, hogy minimális adatforgalmat generáljon, sőt még adattakarékos felülettel is rendelkezik, így nálunk még 100 Mb-os internettel is túlzás nélkül napi több órát chatelhetsz. Sajnos egy oldal csak komprumisszumok árán lehet számítógép és mobiloptimalizált egyben. Szinte mindenhol ilyen komprumisszumok árán lehet ... további részletek >>

csak mobilról chatelni, ezért a GaBChat nélkülözi a számítógépes felületet. Nálunk nincs komprumisszum a telefonoddal! Ez nem azt jelenti, hogy számítógépről nem fog működni a chat, természetesen PC-ről is az összes szolgáltatás használható, viszont semmilyen fölösleges dizájn nincs benne, így a kinézete a végletekig egyszerű. Bár a felülete spórol az interneteden és a telefon memóriáján, de rengeteg beállítási lehetőség és szolgáltatás van a chaten, így mobilon nagyon kényelmes és egyszerű, természetesen gyors a használata. Lehetőség van a háttérszín a betűméret, a frissítési idő és a szoba hozzászólás szám beállítására, így úgy állíthatod be a chatet, hogy biztosan kényelmesen olvasható legyen a számodra. Várunk mindenkit szeretettel: www.gabchat.hu


Feladva: 2017-06-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: gabchatnemígyhogychatkomprumisszumokNálunkszámítógépesszolgáltatásvanezértúgynincsLehetőséglettmégcsaksemmilyenegytermészetesenlehetárán

Forrás: pepitahirdeto.multiapro.com

Hó végére Neked is mindig elfogy a pénzed? Én is így voltam ezzel, de egy különleges, sokaknak bevált módszer nekem is segített. Azelőtt nem bíztam az ilyenekben, de ennek utána jártam és mindent rendben találtam. Ha érdekel, hogy hogyan tudnál otthonról plusz pénzt keresni, anélkül, hogy bármit is el kellene adnod: akkor írj nekem üzenetet. Miután megkaptam az üzenetet tőled küldöm a tájékoztatót a munkáról. Erre az e-mail címre hiresemberek@gmail.com


Feladva: 2017-09-22    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyüzenetetnekemErreAzelőttadnodelfogyérdekelmunkárólsegítettkellenemindigtaláltamtájékoztatótmódszerbármitNekedrendbenküldömbeváltvégére

Forrás: pepitahirdeto.multiapro.com

Kameradepo a Biztonsági kamerák és video megfigyelő rendszerek webáruháza. Megbízható, kipróbált infrás beltéri és kültéri kamerák, digitális rögzítők közvetlenül a forgalmazótól. Szerelésre előkészített komplett kamerarendszerek, melyeket csak fel kell szerelnie. Keressen minket: www.kameradepo.hu Tel: 06 20 569 8848 Kameradepo webáruház


Feladva: 2016-03-16    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: kamerákKameradepoBiztonságirendszerekKeressenközvetlenülmegfigyelőszerelnierögzítőkvideokelldigitálisfelwebáruházBudapestcsakkültériKftmelyeket

Forrás: pepitahirdeto.multiapro.com

Póló szitanyomás, póló nyomtatás cégeknek, iskoláknak. Egyedi póló kiváló minőségben! Tervezze meg kedvenc pólóját, küldje el nekünk mit szeretne és mi megszitázzuk az ön által kiválasztott színű méretű pólójára. Megrendelését akár személyes, akár postai utánvéttel veheti át. A megrendelt termékeket 5-10 munkanap alatt juttatjuk el önhöz. Nagyobb mennyiségű megrendelések esetében ez az idő akár 10-15 nap is lehet megegyezés szerint. További kérdésére szívesen válaszolunk ... további részletek >>

keressen minket élérhetőségeink egyikén. A Facebook-on is megtalál: www.facebook.com/poloranyomas.hu


Feladva: 2017-02-16    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: pólószitanyomásakárnyomtatáspoloranyomasNagyobbiskoláknakakkorutánvéttelTovábbimitönhözcégeknekpostaiszerintnekünkjuttatjukszemélyesmegegyezés

Forrás: pepitahirdeto.multiapro.com

Megrendelésre gyártunk automata drótfonógépet! Profi kivitelben, nem barkács gép! PLC vezérlés, könnyű kezelhetőség! Garantált a gazdaságos termelés! Gépünk cégét versenyképesé teszi! Érdeklődni: 0670 770 3460 Ár: 4.350.000,- Ft + ÁFA


Feladva: 2016-12-13    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: automataGépünkkivitelbenáfatermelésProfi000gazdaságosdrótfonógépet350Garantált3460kezelhetőséggyártunk770könnyűMegrendelésre0670vezérlésPLC

Forrás: pepitahirdeto.multiapro.com

Professzionális segítségre és gyógyításra számíthat az UNIQA legújabb betegségbiztosításával, ha egy súlyos, „rettegett” betegség ütné fel Önnél a fejét. A Best Doctors közreműködésével felkutatjuk Önnek az adott betegség legjobb specialistáit a világon, teljes körűen megszervezzük és térítjük a külföldi gyógykezelését 2 millió euró összeghatárig. Tájékozódjon honlapomon a Med TopDoc betegségbiztosításról, vagy kérjen tájékoztatót!


Feladva: 2015-01-18    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: MedbetegségTopDocBestlegújabbteljesbetegségbiztosítássalfejéthonlapomonUNIQAvilágonÖnnélTájékozódjonszámíthatspecialistáitfelösszeghatáriglegjobb

Forrás: pepitahirdeto.multiapro.com

A fitt emberek webáruháza. Eredeti Body&Fit termékek Magyarországon. Étrend kiegészítő, sporttáplálkozási, diétás termékek. Fehérjék, aminosavak, protein szeletek, diétás édességek. Nézze meg weboldalunkat és adja le megrendelését.


Feladva: 2017-07-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: termékekFitBodydiétáshungaryproteinwebáruházabodyfitaminosavakemberekwwwFehérjékfittmegrendelésétBudapestadjasporttáplálkozásiweboldalunkatmeg

Forrás: pepitahirdeto.multiapro.com

Szalvéta felülnyomást vállalunk céges rendezvényekre, esküvőkre! Készítünk még: étlapot, itallapot, egyedi pincérblokkot, reklám gyufát, papír tányéralátétet, ültetőkártyát, menükártyát. www.ritternyomda.hu/keszites/szalv eta.php


Feladva: 2017-04-16    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szalvetaegyediajánlóritternyomdaétlapotHirdetőwwwmégPepitamenükártyátKészítünknyomásültetőkártyátesküvőkretányéralátétetrendezvényekrepapírcéges

Forrás: pepitahirdeto.multiapro.com

Imádom a 3 kutyámat, 4 éve élek velük panelban. A napi 3 kötelező séta miatt olyan, mintha főállás mellett még plusz 3 műszakban dolgoznék. Rohanni kell hozzájuk haza bárhonnan, bármit abbahagyva. Szakadó esőben és késő este is minden nap ugyanabban az időben kell levinnem őket. Elegem lett ebből az életvitelből. Ők is és én is jobbat érdemlek. Ez csak egy kertes házzal oldható meg, amire viszont jelenlegi állásomban esélytelen, hogy megkeressem a pénzt. Pont jókor hozott össze a sors a DXN ... további részletek >>

Ganoderma kávés online Network Marketing üzlettel: www.kavekiraly.hu/uzleti_lehetoseg Rólam bővebben itt olvashatsz: www.kavekiraly.hu/az_en_tortenetem Itt bizony kell dolgozni, szóval aki munka nélküli gyors meggazdagodást keres, ne nézze meg az oldalam!


Feladva: 2016-11-02    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kellmegIttkavekiralykávéshttplehetosegElegemkutyámathozottabbahagyvadolgoznioldhatóminthauzletiőketImádomoldalamjókorbármitházzalolyanegy

Forrás: pepitahirdeto.multiapro.com

Mindennemű régiség felvásárlása azonnali készpénz fizetéssel: antik bútor, festmény, szőnyeg, szobor (fa, bronz), óra,(kar, asztali és fali álló), ezüst tárgy, (gyertyatartó, cukordoboz, tálca, evőeszköz, hiányos is) porcelán (Herendi, Zsolnay, Meissen) arany ékszer (fél drága, drágaköves, törtarany is), csillár (asztali, álló, fali lámpa) zongora, régi tv, rádió, bélyeg, kitüntetés, képeslap, írógép, varrógép! Lakásokat, házakat hagyatékkal együtt is megvásárolunk! Cim: BP. 1137. SZENT ... további részletek >>

ISTVÁN KRT. 12 ARANY-EZÜST VÉTEL: NE ADJA EL ÉKSZEREIT TÖRT ARANY ÁRBAN, MERT MI FAZONARANYKÉNT MAGASABB ÁRON MEGVÁSÁROLJUK ÖNTŐL, TOVÁBBÁ ÜZLETÜNK VILÁGPIACI ÁR FÖLÖTT VÁSÁROL TÖRT ARANYAT, BEFEKTETÉSI ÉRMÉT, FOGARANYAT, ILLETVE BÁRMILYEN ARANYAT, KARÁTSZÁMTÓL ÉS MENNYISÉGTŐL FÜGGETLENÜL!!! BUDAPESTEN ÉS VIDÉKEN IS. A KISZÁLLÁS DÍJTALAN. Tel.: 06702862076,


Feladva: 2017-09-22    [Régiség - Művészet]

Címkék, kulcsszavak: ARANYTÖRTARANYATfaliállóEZÜSTasztaliantikVIDÉKEN1137cukordobozbélyegfizetésselMERTdrágaBUDAPESTENCimgyertyatartóVÁSÁROLrádiókészpénzÁRBAN

Forrás: pepitahirdeto.multiapro.com

Minőségi kínai telefonok és kiegészítők elérhető áron! Ingyenes szállítás 1 év garanciával, megbízható országos szervizekkel. Vásárlás csak előreutalással lehetséges. Vállalkozások részére külön kedvezmények. 0-24 elérhetőség online, telefonos ügyfélszolgálat 16.30-20.00-ig, hétvégén is.


Feladva: 2017-07-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: garanciávalkínaiMinőségionlineországosajánlóelérhetőségmegbízhatóHirdetőkedvezményekPepitakülönszállításnyelvenrészéreIngyenesmagyarVállalkozások

Forrás: pepitahirdeto.multiapro.com

Teleszkópos, Légkeveréses Normál szélesség: 60 cm Főzőzónák 4 Anyag kerámiaműködési elem Touch Control Maradékhő kijelzés Tervezési keret nélküli, süllyesztett Fogyasztás 7000 watt... www.muszakiguru.hu/shop/index.php?center=uj_termek&term_id=6307 Üzletünkben outlet áron kaphatók szépséghibás új és felújított használt műszaki cikkek, háztartási kis- és nagygépek. Cím: 1134 Budapest Lehel utca 14 (Lehel - Dózsa György saroktól 50 m a Lehel piac felé) Nyitva tartás: ... további részletek >>

Hétfőtől - péntekig 10 órától 19 óráig Szombaton is nyitva, 10 órától 16 óráig Tekintse meg teljes árukészletünket honlapunkon! www.muszakiguru.hu Termékeinkre 1 év garanciát adunk. További információk: Telefonszám: +36 30 591-7000 E-mail: muszakiguru@muszakiguru.hu


Feladva: 2017-04-13    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: LehelóráigórátólnyitvaBudapestmuszakiguruwww70006307teljeskeretpiacháztartásiNormálTelefonszámtermmegTervezésicikkekLégkeverésesinformációk

Forrás: pepitahirdeto.multiapro.com

Döbbenetes sportkocsit és elektromos kamiont mutatott be a Tesla! Elon Musk péntek hajnalban áll a nagyközönség elé, és nem egy, hanem rögtön két vadonatúj Tesla járművet mutatott be az egybegyűlteknek, és persze az egész világnak. A sajtótájékoztató egyik legfontosabb része, hogy a személygépkocsik után a Tesla belép a fuvarozás területére is... Keresőnkben ez a cikk is megtalálható: www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60546


Feladva: 2017-11-17    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: TeslamutatottHirdetőegybegyűlteknekcomállutánPepitamultiaprohajnalbanszemélygépkocsikkeresikjárművetpepitahirdetopéntekhogySokanvadonatújwwwkét

Forrás: pepitahirdeto.multiapro.com

Falszigetelés - Acéllemezes falszigetelés - Falszigetelés injektálással, - Dryzone-os injektálással - Magasnyomású injektálással - Háttérinjektálással - Tömbinjektálással A falszigetelés összes technológiájával állunk 20 éve a lakosság, illetve az önök szolgálatában.


Feladva: 2017-05-07    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: falszigetelésinjektálássaltechnológiájávalellenösszesfalakvizesTömbinjektálássalutólagosanHáttérinjektálássalinjektálásszolgálatábanönökMagasnyomásúéve

Forrás: pepitahirdeto.multiapro.com

Tudtad hogy már Magyarországon is elérhető az ŐSSEJTTERÁPIA ??? LAMININE elérhető áron... Legyél munkatársunk,,, Információ telefonon vagy Email-ben


Feladva: 2017-04-18    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: elérhetőáronTITKAFIATALSÁGLAMININEÖRÖKŐSSEJTTERÁPIAbenMagyarországonEmaylmárvagyhogytelefononTudtadInformációMagyarorszagmunkatársunkkinga

Forrás: pepitahirdeto.multiapro.com

Búvóhely pároknak Siófokon néhány órára vagy éjszakára is! Csak hívj és foglalj. A feltüntetett ár 3 órára vonatkozik.Új szolgáltatásunk, dézsafürdőnk is igénybe vehető.(egyeztetést igényel) Rejtett telefonhívásokat nem fogadunk! Csak párok hívjanak! Nálunk a diszkréció az elsődleges szempont!


Feladva: 2017-06-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: pároknakBúvóhelyCsakóráraRejtetthívjszempontigényeléjszakáraelsődlegesegyeztetéstvagydiszkrécióvehetőnéhányNálunkigénybeSiófokonhívjanakpárok

Forrás: pepitahirdeto.multiapro.com

Válogasson a Galaxy Játékáruház távirányítós játékai közül! A gyerekek életkorának megfelelő játékok különböző árkategóriákban. www.galaxyjatekaruhaz.hu/59-tavira nyitos-jarmuvek


Feladva: 2017-07-01    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: carrerahelikopterhelicoptermicrotávirányítóstaviranyitosgalaxyjatekaruhazméregzsákcsöppségetcsomagbólwwwindítsdjátszaniajánlottigazitávirányítóbahtml

Forrás: pepitahirdeto.multiapro.com

Az 8in1 márka teljes mértékben az állatok érdekeit tartja szem előtt. Az 8in1 termékek olyan gazdiknak ajánljuk, akik imádják a kisállataikat! Kutya- és macskaeledel, jutalomfalatok, rágócsontok, kutyapelenka, vitaminok Táplálékkiegészítők · Teljes értékű táplálékok · Gyors kiszállítás · Széles termékválaszték


Feladva: 2017-07-14    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8in1183TeljestermékválasztékPepitarágócsontokSzéles8206jutalomfalatokelőtttólmacskaeledelszemkiszállítás7000KutyatartjaGyorsszállításérdekeit

Forrás: pepitahirdeto.multiapro.com

A 21. század legújabb Rubik kockája egy teljesen új technikai tervezés alapján készült, amelynek a belső felépítése és szerkezete számos, eddig nem alkalmazott megoldást tartalmaz. Az új design legfontosabb tulajdonsága, aminek legfőképpen a versenyzők fognak örülni, hogy az új szerkezet következményeképpen a kocka nagyon könnyen és gyorsan tekerhető, versenyzésre alkalmas. www.egyszerbolt.hu/rubik-kocka-3x3 x3-uj-2158


Feladva: 2017-04-06    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: rubikkocka3x3x3megoldásttervezéshogyalkalmazotttechnikaiegyszerboltörülninemteljesenwwwfognakeddigegyalkalmasversenyzőkszámoskockájalegújabb

Forrás: pepitahirdeto.multiapro.com

Új, garantáltan eredeti, számlás Kingston Pendrive-ok 1 év garanciával, gyors kiszállítással: Kingston 8GB USB 2.0 Pendrive: 1420 Ft Kingston 16GB USB 3.0 Pendrive: 1700 Ft Kingston 32GB USB 3.0 Pendrive: 3000 Ft Kingston 64GB USB 3.0 Pendrive: 5800 Ft Középkategóriás (gyorsabb, strapabíróbb), csak a héten: Kingston USB 3.0 pendrive 16GB *DTR 3.0 G2* (120/25MBps) - 2990Ft Rendelni a weboldalról lehet: www.itmedia.sk/shop Megrendelését még aznap továbbítjuk szállító partnereink ... további részletek >>

felé, amit a Sprinter futárszolgálat már másnap, a Pick Pack Pont 2 munkanap alatt kézbesít. A pesti csomagpontra a délután 2 óráig beérkezett megrendeléseket már másnap délben beszállítjuk, így gyakorlatilag 24 órán belül átveheti a megrendelését, legyen az bármilyen kis értékű!


Feladva: 2016-07-30    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: pendriveKingstonUSBmegrendelésétmásnapmár16GBmegrendeléseketPick32GBitmediaMediabeérkezettfutárszolgálat1700átvehetiwwwóráigSprinter1420belül

Forrás: pepitahirdeto.multiapro.com

Vattacukor készítő gépek - Új/Gyáriak (USA Design) - átlátszó plexi szélvédő burával, (Professional candy floss machine) + kétkerekű kocsival szerelten (kordé), vagy asztali változatban ELADÓK - MEGRENDELHETŐK! A Vattacukor gépek ELEKTROMOS (Electric) és GÁZOS (PB Gas) fűtéssel választhatóak! Kiemelkedően profi gasztronómiai használat, és gyári design! E-mail címre tájékoztatót, és képeket küldök! Az értékesítés Pro-Forma számlával történik! ... további részletek >>


Feladva: 2017-04-30    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: ELADÓKdesigngépekVattacukorMEGRENDELHETŐKProcandyprofiWAYértékesítésProfessionalKiemelkedőenGOLDENváltozatbanküldökburávalválaszthatóakasztaliGas

Forrás: pepitahirdeto.multiapro.com

24 h ápoló/háztartásvezető állásunk van LANDSHUT-ban, a család a munkáltató. Idős otthonos ÁPOLÓ-i állásaink BAJORORSZÁGBAN vannak, feltétel eü. végzettség. Az AMBULANTE mobil ápolói állásunk FRANKFURTBAN van eü. végzettséggel és jogosítvánnyal rendelkezők részére. A szállás mindhárom helyen megoldott. Némettudás szükséges szintje állástól függően A2-től B1-B2-ig. További infók a www.nemetmunka.hu/apolo.html weboldalunkon, ahol regisztrációs lehetőség is van. Érdeklődni munkaidőben a ... további részletek >>

+36 1 920 3433 budapesti, vagy a +49 8641 6949 000 német vezetékes számokon lehet. Várjuk jelentkezését! Német Munka Team


Feladva: 2017-02-10    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: vanMunkaNémetÁPOLÓállásunkTeamszámokonjogosítvánnyalállásainkállástólvezetékesvégzettséggellehetőségszintje000FRANKFURTBANregisztrációsIdősotthonos

Forrás: pepitahirdeto.multiapro.com

Alaplap javítás garanciával! Laptop, notebook alkatrészek eladása, burkolat, és zsanér javítás, csavarpótlás...


Feladva: 2017-07-15    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: javításalkatrészeknotebookLaptopgaranciávalAlaplapNagykőröscsavarpótlásajánlóHirdetőzsanérPepitaburkolatszervizeladásaLaptopalkatrészek

Forrás: pepitahirdeto.multiapro.com

A forró kávé varázsát gondolom, nem kell bemutatnom. De mi a megoldás nyári kánikulában, mikor inkább egy jéghideg italra vágyunk? A DXN Ganoderma gyógygombás kávékülönlegességei hidegen is nagyon finomak, és amit még jobb, nem vagyok forró vízhez, konyhai eszközökhöz kötve: bárhol el tudom magamnak készíteni egy perc alatt: www.kavekiraly.hu/blog-2017-06-19- DXN_Ganoderma_kave_keszitese_hideg_ vizzel


Feladva: 2017-07-01    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: alattforróperckávéegynemGanodermaDXNbárholhidegenkavekiralybemutatnomkonyhaikávékülönlegességeihttpkellvízhezgyógygombásgondolomvizzelvágyunk

Forrás: pepitahirdeto.multiapro.com

Antikvitás, lakberendezés, belsőépítészet Régi- és stíl bútorok, egyéb régiségek Porcelánok - Festmények - Házimunkák Nyitva: minden nap 9-17 óráig


Feladva: 2016-09-16    [Régiség - Művészet]

Címkék, kulcsszavak: GalériaStílusbútorokbelsőépítészetmindenlakberendezésNyitvaAntikvitásHázimunkákGyulakesziFestményekPorcelánokrégiségekmodernegyébAntikstílóráig

Forrás: pepitahirdeto.multiapro.com

Munkatársakat keresek ingatlan ajánlói, és értékesítési területre. Ha még nem dolgoztál ilyen munkakörbe mi betanítunk, ha már dolgoztál az előnyt jelent.Ha foglalkoztál esetleg hitelezéssel vagy LTP-vel akkor is írj a számodra is van munka. Jelentkezni lehet a munka.ingatlan.srl@gmail.co m email címen. Kérlek, írj telefonszámot is hogy fel tudjam venni veled a kapcsolatot.


Feladva: 2017-08-29    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: ingatlanmunkakeresekdolgoztálírjMunkatársakatvelmunkakörbeemailLTPkapcsolatotilyencomvagyvelednemsrl@gmailhitelezésselvennimégesetlegtudjam

Forrás: pepitahirdeto.multiapro.com

Ha igen, akkor a lehető legjobb helyen jársz! Az UtazzFillerekért.hu segít benne, hogy a lehető legolcsóbban és legmegbízhatóbb módon foglalhasd le álmaid nyaralását, belföldi utazását, párnapos városlátogatását vagy esetleg a számodra legkedvezőbb repülőjegyet. Egyszerűen fogalmazva: levadásszuk Neked a legjobb ajánlatokat! Kell ennél több? Csapatunk tapasztalt, profi utazókból áll, akik az elmúlt évtizedben bejárták a világ összes kontinensét és rengeteg tapasztalatot halmoztak fel, ... további részletek >>

megismerkedtek a legnépszerűbb helyekkel és minden fontos infót gondosan feljegyeztek az adott desztinációról. Küldetésünk és célunk nem más, mint hogy a naponta frissülő utazási ajánlatok közül a legjobbakat és a legkedvezőbbeket kiválogatni utazni vágyó közönségünk számára. A wellness hotel, last minute utak és olcsó repülőjegy ajánlatok szövevényes világában ez nem olyan egyszerű feladat, mint aminek hangzik. Az UtazzFillerekért.hu oldalon nem csak a legolcsóbb repülőjegy kínálat, utazási opciók, szállás ajánlatok, vagy akár ingyenes nyaralás lehetőségek érhetők el, de könnyen inspirációt meríthetsz következő utazásodhoz, pihenésedhez is. Exkluzív választékkal jelentkezünk továbbá mind a belföldi nyaralás, mind pedig a külföldi utazás ajánlatok terén. Oldalunkon egyszerűen hozzáférhetsz autóbérlés keresőnkhöz, választhatsz magadnak útikönyvet és köthetsz utasbiztosítást – egyszóval mindent megtalálsz, ami a tökéletes utazás előkészítéséhez szükséges lehet! Belföldi és külföldi utazás ajánlatok egy helyen Ahhoz, hogy naprakész lehess és azonnal kihasználhasd a legkedvezőbb, legizgalmasabb utazási ajánlatokat és belföldi pihenés lehetőségeket, egyszerűen iratkozz fel hírlevelünkre e-mail címed megadásával oldalunk bal felső részén és lájkold Facebook oldalunkat! Amennyiben ajánlataink között nem találsz megfelelőt, szívesen segítünk megtalálni a számodra legjobb repülőjegy és szállás opciót. Írj nekünk bátran!


Feladva: 2016-10-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: ajánlatoklegjobbbelföldinemutazásUtazzFillerekértegyszerűenhogyajánlatokatutazásirepülőjegyvagymintszálláshelyenszámodralehetőlegkedvezőbbmind

Forrás: pepitahirdeto.multiapro.com

Vezetőket és munkatársakat keresek online munkához. Számodra mi a legfontosabb: - egészség? - pénz? - szabadidő? - anyagi függetlenség? Nem kell választanod, mert kitartó munkával mindegyik elérhető . Csatlakozz a Moringa Life csapatához. Velünk és egy automatizált rendszer segítségével építsd fel saját üzleted.


Feladva: 2017-06-15    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekVezetőketfelAlizelérhetőpénzépítsdKádármindegyikegészségsegítségévelmunkávallegfontosabbrendszerkitartóSzámodraautomatizáltmertcomegy

Forrás: pepitahirdeto.multiapro.com

PC játékok óriási választéka a Konzolvilágban, pénztárcabarát árak és speciális kiadások. Kiemelkedő kiszolgálás, gyors és megbízható futárszolgálat.


Feladva: 2017-09-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: játékokpénztárcabarátKonzolvilágbanválasztékafutárszolgálatóriásimegbízhatógyorsajánlókiszolgálásHirdetőKiemelkedőPepitakiadásokKonzolvilágspeciális

Forrás: pepitahirdeto.multiapro.com

Akciós szépséghibás, kartonsérült és outlet háztartási gépek akár féláron! Új, csomagolássérült, leértékelt és outlet mosógépek, hűtőszekrények, valamint egyéb háztartási gépek széles választékban azonnal, készletről! Üzleteinket személyesen is érdemes meglátogatni, címlista itt: www.leertekelve.hu/content/6-kapcs olat


Feladva: 2017-04-27    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: outletleértékeltgépekháztartásihűtőszekrényekHirdetőszemélyesenmosógépekPepitaÜzleteinketBoltjakészletrőlkapcsolatÁrukazonnalcsomagolássérültcontent

Forrás: pepitahirdeto.multiapro.com

Átalakítható kárpitozott autós gyerekágyak. Traktor gyerekágy, autó gyerekágy, vonat gyerekágy, dömper gyerekágy, pickup gyerekágy www.atalakulok.hu/traktor-autos-gy erek-agy


Feladva: 2016-11-12    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: gyerekágyTraktorautóssepalapickupdömpervonatautógyerekágyakkárpitozottÁtalakítható

Forrás: pepitahirdeto.multiapro.com

Nem online! Személyes segítség! Azonnali társtalálás megbízhatóan általam. Diplomások, Vállalkozók, jó társaság! Azonnali Társközvetítés · 23-96 év közöttieknek Férjet? Feleséget keres? · Hívjon már ma!


Feladva: 2017-07-15    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: Azonnali183FérjetSzemélyesközöttieknekonlineTársközvetítésNemajánlótársaságHirdetőVállalkozókPepitamárDiplomásokIrodájaHívjonáltalamTárskereső

Forrás: pepitahirdeto.multiapro.com

Egy falat Székelyföld, egy falat hagyomány, egy falat egészség. Boltunkban megtalálják a legfinomabb székely kézműves élelmiszereket. A Székely Falat kiváló füstölt hústermékeit, a madarasi, székelyszentléleki és torockói sajtokat, házi vajat, Szász Illyés méhészetéből kikerülő havasi bio mézeket és egyéb mézkülönlegességeket, Gáll Erzsébet házi lekvárjait és szörpjeit, az Ábel székely mustárt, a Csíki áfonyát, a Hargita Gyöngyét és számtalan egyéb székelyföldi manufaktúrákból kikerülő terméket


Feladva: 2015-10-24    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: FalategyszékelyegyébházikikerülőÁbelLászlóIlyésmanufaktúrákbólélelmiszereketszörpjeitBagiSzászszékelyföldikézműveslekvárjaitboltvajatErdélyi

Forrás: pepitahirdeto.multiapro.com

A tragikus 2013-as síbaleset óta nem sokat hallottunk a legendás Forma-1 bajnokról. Most se lehet túl sokat tudni az állapotáról, de legalább a körülményekhez képest jól van... (A kép forrása: nepszava.hu)


Feladva: 2017-11-13    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: sokatkörülményekhezhallottunkhíreklegalábbnemkeresikállapotárólótaSokantudnisíbaleset2013nepszavatúltragikusforrásalehetajánlásképMostvan

Forrás: pepitahirdeto.multiapro.com

Cseh és magyar szövegek fordításával foglalkozó csehországi számlaképes magánvállalkozó vagyok. Aprólékosabb, illetve további információt honlapomon találhat.


Feladva: 2016-08-01    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: CsehtalálhatfordításávalhonlapomonszövegekinformációtmagyartovábbiilletveLetoviceAprólékosabbFerdinandvagyokTóthmagánvállalkozófordításszámlaképes

Forrás: pepitahirdeto.multiapro.com

Clímatrend termékeinket továbbra is ClimaGuard™ Premium üveggel (Ug=0,6 W/m2K), és extraként Swisspacer™ távtartó profillal (meleg perem) gyártjuk. Mindezek ellenére árainkat nem emeljük! Vásároljon extra hőszigetelésű üveggel készült ablakot, erkélyajtót és bejárati ajtót régi áron! Minőségi termékek elérhető áron, Schumacher™ nyílászárók! Kérjen ingyenes árajánlatot! Tel:06-79/478-405 E-mail: info@schumacherajto.hu www.schumacherajto.hu


Feladva: 2016-01-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SchumacherüveggeláronbejáratiellenéreingyenesClimaGuarderkélyajtótMindezekKérjentovábbraablakotgyártjuknyílászáróktermékeinketkészültschumacherajto

Forrás: pepitahirdeto.multiapro.com

Falmatrica, faltetoválás, faldekoráció webáruház. Olcsó falmatricák, óriási választék! Ha unod otthonod egyszínű, fantáziátlan falait...


Feladva: 2016-10-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falmatricashopwwwwebáruházfaldekorációfaltetoválásFalmatricaválasztékóriásifalmatricákOlcsó

Forrás: pepitahirdeto.multiapro.com

Ennyiért még szórólapot sem kap! Kezdő weboldalaknak, weboldalakon, webáruházakban megjelenő akcióknak és internetes figyelemfelhívásoknak kifejezetten ideális! Egyszerűen használható kezelőfelületen beállítható, módosítható, ha kell...


Feladva: 2017-06-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: 000szórólapotfigyelemfelhívásoknakméginternetesEnnyiértakcióknakajánlókellmegjelenőHirdetőmódosíthatówebáruházakbanPepitabeállíthatóweboldalakonért

Forrás: pepitahirdeto.multiapro.com

Nyilván keresett, hiszen ha valaki valamit keres az interneten, akkor ahhoz a döntő többséghez tartozik akik a Google-val keresnek... Európában az emberek 97%-a! Érthető, hogy akik érdekeltek az internetes kereskedelemben, vagy egyéb értékes információk megjelentetésében, azok tesznek azért, hogy a különböző szavak, kifejezések keresésénél előlelő helyen legyenek a találatok között... És ha már megjelennének a keresés begépelése közben, az még előrébb helyezné őket? Hát persze! ... további részletek >>

Sokaknak sokkal vonzóbb a kattintási lehetőség képes ajánlatra, még ha a keresés közbeni legördülő Google ajánláson jelenik is meg! Nálunk elérhető ez a szolgáltatás... Lehet bármilyen tetszőleges internetes tartalomra mutató link: - weboldalak bármely oldala - közösségi oldal nyilvános tartalma (Facebook, Google+, Twitter, stb...) - webcímmel rendelkező PDF fájl Mivel a Pepita Hirdető keresője - kevés kivétellel - minden webhelyünkön megtalálható, ezért jóval több, mint egy hirdetés... Alább az Írjon nekünk! menü linkje látható, ha érdekelné... www.pepitahirdeto.multiapro.com/apro.php?page_id=21471


Feladva: 2017-06-12    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: GooglemegvalamitinternetesHirdetőkeresettPepitakereséshogyakikmárkivételleljeleniktesznekTwitterSokaknakemberekAlábbmutatótalálatokkevésHát

Forrás: pepitahirdeto.multiapro.com

Igényesen dolgozó asztalos vállal konyhabútor készítést Budapesten és Pest megyében. Fő profilom konyhabútor, konyhaszekrény, gardrób és beépített szekrény készítése és beépítése egyedi elképzelései alapján. Modern konyhabútor olcsón, elemes konyhaszekrény akció. Ezen kívül még vállalok más asztalos munkákat is, kérem, hívjon bizalommal: Fogas Zoltán 06 70 636 8214.


Feladva: 2016-05-28    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: konyhabútorasztalosBudapestenZoltánFogaskonyhaszekrényprofilommunkákatmegyébenModernPestmásalapjánvállalokelképzelései8214készítéstmégegyedi636

Forrás: pepitahirdeto.multiapro.com

XIV. kerületben, Zugló Törökőr részén, a Mandala kert tőszomszédságában kínálok számlaképes módon kiadásra lift nélküli társasházban egy teljeskörűen és frissen felújított, 29 m2-es, világos, csendes, 3. emeleti, franciaerkélyes téglalakást elsősorban diáklányoknak, egyedülálló nőknek és gyermektelen fiatal pároknak - háziállat nélkül. Dohányzás kizáró ok. Elrendezése: előszoba (gardrób szekrénnyel), felszerelt teakonyha, háromszárnyú franciaerkélyes ajtón át hangulatosan és kiválóan ... további részletek >>

megvilágított délkeleti tájolású szoba berendezés nélkül (de igény esetén berendezve). Fűtését egyedi Héra gázkazán biztosítja hangulatos cserépkályhába építve, ami jó meleget ad és tart is. A tágas, ablakos fürdőszobában a meleg vizet villanybojler szolgáltatja (zuhanyzó, WC). Fenntartási költségei kedvezőek, a közös költség 7075 Ft/hó, víz-, gáz-, áramfogyasztást egyedi fogyasztásmérők mérik. A ház a főútvonalról közelíthető meg, körbekerített, saját kerttel is rendelkezik, parkos, csendes, zöld környezetben helyezkedik el, mégis frekventált környéken, amely jó infrastruktúrájú és közlekedésű. A közelben több élelmiszerbolt, benzinkút, konditerem található. 7 perces séta vagy 2 megálló a Hungária körút, ahol az 1-es villamos jár, nincs messze a Zugló Vasútállomás, a 77-es trolibusszal pedig csak 5 megálló a piros metró Stadionok megállója. Parkolni az utcában ingyenesen lehet! Költözhető azonnal egy éves hűségidővel, 2 hónap kaucióval és első havi bérleti díjjal. Bérleti díj bútorozatlanul: 90.000 Ft Igény esetén bútorozva: 100.000 Ft Érdeklődni a 30/294-1525 számon lehet 10:00-20:00 között. Ingatlanosok ne keressenek!


Feladva: 2017-09-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 000100nélkülcsendeseseténmegállóIgényegyediegylehetBérletiZuglófelújítottfranciaerkélyesfrissennincsfőútvonalrólberendezveMandalakaucióvaljár

Forrás: pepitahirdeto.multiapro.com

..udvarból a Balatonba léphet... BALATONFENYVESEN közvetlen a Balaton-partján, családias, gyermekbarát környezetben üdülhet, helyben strandolhat, horgászhat. Ingyenes csónak, vízibicikli használat, kényelmes szállás, elegáns környezet. www.balaton-fenyves.hu 305918036 83-318-839


Feladva: 2014-07-16    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: léphetBalatonbabalatonudvarbólBALATONFENYVESfenyveshorgászhatstrandolhatwwwhelybenkörnyezetüdülhetÜDÜLŐPARADICSOMelegánskörnyezetbenszálláskényelmes

Forrás: pepitahirdeto.multiapro.com

Tisztítást igényel valamilyen felületen, de nem tudja, hogy mivel végezze el? Kérdezzen, segítünk. Speciális tisztítószerekkel állunk rendelkezésére. Tisztítószer és mosószer közvetlenül a magyar gyártótól, termelői és viszonteladói áron. Kérjen termékismertetőt! Érdeklődni: 06-30-8531179


Feladva: 2014-02-17    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: miveltudjanemrendelkezésérefelületentermékismertetőtállunkvalamilyenKérjentisztítószerekkeligényeláronSpeciálisTisztítástviszonteladóisegítünkker

Forrás: pepitahirdeto.multiapro.com

Szünetmentes tápegység Kemot tiszta szinuszos Felhasználás terület: a teljesítmény figyelembevételével: - hűtők - hő központok - keringtető szivattyúk - búvárszivattyúk, villanymotorok www.elektroexpressz.hu/spl/499141/ UPS-SZUNETMENTES-TAPEGYSEG


Feladva: 2017-01-22    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: SZUNETMENTESelektroexpresszszinuszostisztatápegységteljesítménysplterületFelhasználáshttpsvillanymotorokbúvárszivattyúkKemotszivattyúkkeringtető300W

Forrás: pepitahirdeto.multiapro.com

Kéziemelő Raklapemelő BÉKA javítás Felújítás Kölcsönzés Eladó. ollósemelő, magasemelő, raklapmozgátó, szb. 06-30-243-4771 Használaton kívüli rosszat, felvásárolunk, javítás vagy eladás esetén, beszámítunk.


Feladva: 2015-10-18    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: javításRaklapemelőBÉKAvagyhttp4771Kéziemelőfelvásárolunk243BudapestrosszatszbHidraulikakívüliraklapmozgátóRakHasználatonmagasemelőhtmollósemelő

Forrás: pepitahirdeto.multiapro.com

Lökhárító, motoridom javítás és műanyag karosszéria javítás, horpadás javítás, műanyaghegesztés. Sérült, törött lökhárítók, fényszórók és egyéb műanyag alkatrészek javítása. Robogók, nagymotorok műanyag burkolatainak javítása. Műanyag háztartási, és egyéb eszközök javítása. Képek és árak itt: http://muanyagjavitas.hu Tel. : (30) 9 124- 279 Budapest 1105, Halom u. 42. http://muanyagjavitas.hu


Feladva: 2017-01-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: javításMűanyagjavításamuanyagjavitashttpegyébBudapestLökhárítófényszórókZentaiKépeklökhárítókMŰANYAGJAVÍTÁStörötteszközökSérültHalom1105horpadás

Forrás: pepitahirdeto.multiapro.com

Sok menyasszony nem tudja, hogy egy parfümvásárlás sokkal összetettebb annál, minthogy a drogéria polcáról leemeljük a pénztárcánkhoz illő, külsőre a leglátványosabbnak bizonyuló kis üvegcsét. Egy illatnak lelke, ereje, és története van. Minden esszencia megkomponálása során szakértő parfümőrök együttes erővel dolgoznak azon, hogy minőséget, harmóniát és szépséget zárjanak egy-egy fiolába. Ilyen illatmágusok készítik a világ luxusmárkáinak, a nagy divatcégeknek illatait, és (bármilyen lelombozó) ... további részletek >>

a sztárok nevével fémjelzett parfümöket is... Itt többet is olvashatsz: www.eskuvoclassic.hu/menyasszony-parfum-kisokos-talald-meg-illat-ami-az-oltarhoz-kiser


Feladva: 2017-10-03    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: egyhogyillatmenyasszonyzárjanakösszetettebbeskuvoclassicsoránillataitbizonyulószépségetsokkalwwwmegkomponálásadivatcégeknekleglátványosabbnakkiser

Forrás: pepitahirdeto.multiapro.com

Lakodalmak, születésnapi bulik és céges rendezvények zeneszolgáltatását vállalom. Számlaképes vagyok! www.genczlertibor.5mp.eu www.genczlertibor.webnode.hu


Feladva: 2017-10-04    [Zene - Hangszer]

Címkék, kulcsszavak: genczlertiborwwwzenészvállalomEgyszemélyeszeneszolgáltatásátrendezvényekcégesbulikwebnodeszületésnapiLakodalmakajánlás5mpHirdetővagyokPepita

Forrás: pepitahirdeto.multiapro.com

Iratmegsemmisítő gépek, tűzőgépek, számológépek, nyomatók, faxok, lamináló gépek javítása, karbantartása.


Feladva: 2017-01-31    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: gépekirodagépfaxoknyomatókszámológépektűzőgépekiratmegsemmisítőBudapestKftkarbantartásaSystemjavításaCopyszervizlamináló

Forrás: pepitahirdeto.multiapro.com

Értékesítőket és Hálózatépítőket keresek az ország minden területéről! Olyanok jelentkezését várom akik szeretnének elérni valamit az életükben és vannak céljaik! Lehetsz: - munkanélküli - gyesen, gyeden lévő anyuka - 18 életévét betöltött diák - nyugdíjas - vállalkozó - vagy aki jövedelmét szeretné kiegészíteni Aki komolyan foglalkozik vele rövid időn belül lehet akár Főállás is! Feltétele a munka kezdéshez: - Internet elérhetőség - Jó kommunikációs készség - Akarat - Kitartás - ... további részletek >>

Célok Akinek felkeltettem az érdeklődését és szeretne a munkatársam lenni, írjon!


Feladva: 2017-01-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekHálózatépítőketÉrtékesítőketszeretneAkivállalkozóAkaratcéljaikmindenbelülnyugdíjaskészségvannakországidőnírjondiákkommunikációséletükben

Forrás: pepitahirdeto.multiapro.com

Már több éve tagja vagyok egy MLM vállalatnak, de csak lassan tudtam haladni az online munkával. Nem igazán ment. Nem a vállalattal volt a hiba, hiszen láttam, hogy sokan milyen szépen gyarapodnak, haladnak. A DXN tökéletes választás volt. Már közel álltam, hogy kimondjam: ez nem nekem való, nekem nem megy. Kb. másfél hónapja szponzorom megmutatott egy új eszközt, ami segíthet nekem is. Gondoltam, mit veszíthetek, kipróbáltam. Eleinte szkeptikus voltam, de jöttek az eredmények. Egy hónap alatt, ... további részletek >>

többen csatlakoztak hozzánk, mint előtte lévő évben összesen. Felcsillant a remény, hogy ezzel én is tudok eredményesen dolgozni! Nagyon megszerettem ezt az automata eszközt! Így már én is meg tudom csinálni. Csatlakozz a csapatunkhoz, hogy kipróbálhasd Te is ingyenesen magadat és az eszközt! Ha dolgozol, garantált a siker, és ez nagyon jó érzés.


Feladva: 2017-09-29    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmárnekemEgyeszköztvoltNagyonÍgyösszesenközelgarantáltingyeneseneredményekhiszenautomataamivállalatnakévbensikerkipróbálhasdjöttek

Forrás: pepitahirdeto.multiapro.com

C#.net programozó állás Debrecenben! Friss diplomásoknak, végzős Programozó és Informatikus hallgatóknak... Feltételek: - Felsőfokú szakirányú végzettség - Minimum középfokú angol nyelvtudás - A programozás szenvedélyes szeretete Részletek: www.jobs.ozeki.hu/index.php?owpn=2 5 Jelentkezés módja: A job@ozek i.hu e-mail címre beküldött fényképes önéletrajzzal és a pozícióhoz kapcsolódó jelentkezési adatlap pontos kitöltésével. Folyamatosan várjuk a jelentkezőket!


Feladva: 2016-03-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: netProgramozójob@ozekiszakirányúpontosmódjaFelsőfokúadatlapOzekiJelentkezésFeltételekjelentkezésifejlesztőszeretetehallgatóknakkapcsolódószenvedélyes

Forrás: pepitahirdeto.multiapro.com

Mistyque FehérneműSzalon Online Márkás termékek: Triumph, Sloggi, Felina, Skiny, Misty, Bahama. Rider papucsok, minőségi fehérneműk, fürdőruhák, harisnyák, zoknik - KIFUTÓ MODELLEK KEDVEZŐ ÁRON! Kínálatunkból: FIORE 40 den-es, mintás harisnyanadrágok, több színben: 1.550 Ft. SKINY Essentials Tolerance női trikó (kék vagy narancs): 4.250 Ft. Átadás személyesen: Budapesten (XVII. ker.), Bálványoson (Somogy), vagy országos kiszállítással. Webáruházunk: www.mistyque.hu


Feladva: 2015-11-27    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: mistyqueMárkásországosfehérneműkOnlinevagyFehérneműSzalonpapucsokRiderSKINYfürdőruháknarancsmintáskékdenminőségitrikóFIORESomogynőiTolerance

Forrás: pepitahirdeto.multiapro.com

Az álmok jelentése a legtöbb embert érdekli. A tudomány sem cáfolja azt a nézőpontot, miszerint álmunkban legbensőbb világunk jelenik meg, félelmeink, vágyaink, reményeink vetülnek ki különböző fantáziákba szőve. Az álom működése azonban még ma sincs teljesen megfejtve. Hogy mit üzennek, gyakran csak találgatni tudjuk, máskor pedig egészen egyértelmű, hogy a napközben átélt helyzeteket dolgozzuk fel általuk. Az álmok megfejtése napjainkra egyfajta “tudományággá” vált, sokszor ... további részletek >>

segítségül hívhatjuk a különböző lelki problémák, konfliktus- és stresszhelyzetek feldolgozásához.


Feladva: 2016-11-08    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: jelentéseálomhogykülönbözőmégálmoktudjuksegítségülműködésefelálmunkbantalálgatniKittisokszordolgozzukmiszerintcsakKellérváltszővehelyzeteket

Forrás: pepitahirdeto.multiapro.com

Forrasztóállomások, pákák egyéb kiegészítők nagy választéka kedvező áron. www.elektroexpressz.hu/spd/CZT_065 10010/ZD-99-analog-forrasztoallomas -150-450-C#page_artdet_tabs


Feladva: 2016-09-28    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: ForrasztóállomásáronkedvezőválasztékanagykiegészítőkegyébpákákForrasztóállomásokELEKTROEXPRESSZpáka

Forrás: pepitahirdeto.multiapro.com

Trapézlemez, cserepes lemez, síklemez közvetlenül a gyártótól maximum 2 hét munkanapos határidővel. Általános méretű lemezek, szegők, kúpok, csavarok, profil kitöltő szivacsok azonnal raktárról. Lemezeink horganyzott és festett, illetve natúr horganyzott alapanyagból készülnek 0,40-0,55 mm anyagvastagságig. I. osztályú horganyzott trapézlemez méretre gyártva 1100 Ft/m2,festett 1120 Ft/m2. II. osztályú trapézlemez 850 Ft/m2. (Az árak az ÁFA-t nem tartalmazzák!) Telephelyünket ... további részletek >>

megtalálják: Győr, Szolnok, Pusztamonostoron a 32-es számú főúton (Szabadság út 53)


Feladva: 2016-08-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: trapézlemezhorganyzottosztályúGyőrfestettközvetlenülilletveSzolnokméretű1120FtsíklemezLemezeinkÁltalánoslemezraktárrólmegtaláljákcom1100cserepes

Forrás: pepitahirdeto.multiapro.com

Egy lépéssel a betörők előtt! Bízza profikra otthona védelmét! Megbízható, pontos, referenciákkal rendelkező cég! Riasztó- és kamerarendszerek, távfelügyelet a legjobb árakon, Budapesten és Pest megyében! Kérje kollégánk segítségét: 06 20 452 2727 Írjon emailt, visszahívjuk!


Feladva: 2012-10-02    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: PestBudapestenvisszahívjukrendelkezőmegyébenemailtpontoskamerákÍrjonreferenciákkalriasztóksegítségétMegbízhatóAkcióskollégánkvédelmétmegyébenKérje

Forrás: pepitahirdeto.multiapro.com

Bogács üdülőövezetében a Termálfürdőtől, horgásztótól öt perc sétára önálló vendégház kiadó. Pihenjen családjával, barátaival úgy, hogy csak ismerősök vegyék körül! Itt nem kell idegenekhez vagy a tulajdonoshoz alkalmazkodnia. 2014 óta változatlan árakkal várjuk vendégeinket.


Feladva: 2017-01-24    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kiadóvendégházBogácscsaládjávalNórakellPihenjenvendégeinketKozmánénemvárjukBogácsonIttárakkalkörülönállóváltozatlanvegyéksétáraótaismerősök

Forrás: pepitahirdeto.multiapro.com

Eladó új Huawei Honor okostelefonok! Honor 5X Honor 7 Honor 7i Honor 8 Honor V8 Honor Note 8 Huawei Mate 8 Részletekért látogasson el weboldalunkra! www.puremobile.hu/huawei


Feladva: 2016-10-28    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: HonorHuaweiokostelefonokpuremobileweboldalunkralátogassonRészletekértMateNoteEladóBudapest

Forrás: pepitahirdeto.multiapro.com

Azért, mert a Gano Excel mellett már 4 éve elköteleztem magam, és amit életem egy jó lépésének tartok. Azért, hogy lecserélhesd a hagyományos kávéd egy egészséges és finom kávéra, amelytől jelentősen javul az energiád és a közérzeted. Azért, ganodermát, a spirulinát, és a Cordycepst tartalmaznak termékeink, és ezek jótékony hatására bármikor szükséged lehet. Egészség és szépség egy helyen! Azért, mert nekem már jövedelmem van ebből a „munkából”, és segíthetek Neked is ... további részletek >>

abban, hogy Te is tisztes jövedelemre tegyél szert. Persze csak akkor vagyok jó választás a számodra, ha neked is fontos a szabadság, az anyagi függetlenség és az egészség.


Feladva: 2017-08-16    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AzértegyegészségmárnekedhogymertExcelválasszakkorspirulináthagyományosmunkábólGanoszépségengemcsakganodermátlecserélhesd8222Tatabányalehet

Forrás: pepitahirdeto.multiapro.com

Autódekoráció tervezése digitális nyomással, betűkivágással, hosszú élettartamú fóliákkal. Mágnesfóliára is. Fényképes ajándéktárgyak bögre,egérpad. Digitális képek nyomása vászonra, ponyvára, pólóra naptárra. Nyomtatás és riccelés egy menetben. Kiadványszerkesztés, grafikai tervezés, arculattervezés. Esküvői meghívó, névjegy készítése. Reklámtábla, kirakatdekoráció tervezése kivitelezése. Szitanyomás fémre,üvegre, textilre. Bp. Veres P. út 83. Tel.: (1) 401-0931 vagy (20) 570-3007


Feladva: 2017-04-11    [Autó - Motor - Jármű]

Címkék, kulcsszavak: betűkivágássalDigitálisAutódekorációtervezéseReklámtáblatervezésnyomásaSzitanyomásgrafikaiképek3007nyomássalkivitelezéseKiadványszerkesztés570menetben

Forrás: pepitahirdeto.multiapro.com

Új Kocsik Érkeztek!!! Most Több Darabból Választhat! Téliesített, Kiváló Állapotban Lévő Büfékocsi Berendezéssel Együtt Kiadó! Rendelkezik a szükséges szakhatósági engedélyekkel, személyautóval, B-s jogosítvánnyal kényelmesen vontatható, azonnal munkára fogható! A bérléshez 1 havi bérleti díjnak megfelelő kaució szükséges! Külföldi használat esetén a bérleti díj havi 400,- Euró, a kaució pedig Magyarországtól való távolságtól függ! Egész Szezonra Történő Bérlés, és előre fizetés esetén ... további részletek >>

díjkedvezményt biztosítunk! Büfékocsi Kölcsönző Eger, A Legjobb Feltételekkel!!! Nyitva: H-P: 08-16:30; SZ: 08-12; V: Zárva Kérem a fenti időpontokban érdeklődjenek!!! Kérem tekintse meg honlapunkat!


Feladva: 2016-10-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BüfékocsibérletiKölcsönzőKéremszükségeseseténkaucióBérléshaviEgerEgészÁllapotbanmegkényelmesenfüggKiválótekintsehasználatjogosítvánnyalKülföldi

Forrás: pepitahirdeto.multiapro.com

Keresünk 1 festőt 1 fém lakatost 1 segédmunkást Szolnokra. Érdeklődni telefonon reggel 8 tól este 6 ig.


Feladva: 2017-09-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: KeresünktelefononÉrdeklődniSzolnokrasegédmunkástlakatostfémfestőtesteSzolnoktólCsillareggelNádas

Forrás: pepitahirdeto.multiapro.com

Motormentés, motorszállítás. Budapest területén átalánydíj 6000.- Budapesten kívül 6000.- + Budapest határától, Budapest határáig 100.-/km.


Feladva: 2017-08-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BudapestMotormentés6000határátólkívülBudapestenátalánydíjterületénmotorszállítás100határáig

Forrás: pepitahirdeto.multiapro.com

Nem elég a keresete? Szeretne jobban élni. Akkor most ön jó helyen jár. Hiszen megfelelő időben jó helyen lenni az ami meghozhassa az ön számára is az üzleti életében a siker lehetőségét. Magyarországról nyitott Európa felé az Axxa So Plus termékével az Axxa Global cég. Terméke kiváló, rendkívül népszerű ázsiai országokban. Világ sikere elkerülhetetlen. Axxa Global termék tanácsadóként akár komolyabb plusz bevételi forrás elérése lehetséges. Ha érdekli a lehetőség, regisztráljon ... további részletek >>

Axxa global céghez, a www.axxasoplus.hu, vagy az axxasoplus.blog.hu segítségével, vagy keressen elérhetőségeimen. Kovács Zoltán www.axxasoplus.blog.hu www.axxasoplus.blog.hu infó: axxaglobal2017@gmal.com Tel:06-20/8012282


Feladva: 2017-10-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AxxaaxxasoplusblogglobalwwwtermékhttpZoltánPlushelyenvagyregisztráljonszámáraélnitermékévellehetőségmeghozhassaelkerülhetetlenjobbanérdekli

Forrás: pepitahirdeto.multiapro.com

Angol - igény szerint, minden szinten: - nyelvoktatás, korrepetálás, kiegészítő tanítás, - szintentartás, felzárkóztatás, - felvételire, nyelvvizsgára, érettségire, állásinterjúra, pótvizsgára, osztályozó vizsgára felkészítés, - tanulócsoportok mentorálása, konzultáció, - fordítás, - online tolmácsolás (előre egyeztetett idópontban) - az angol nyelvhez és kultúrterülethez tartozó témában célirányos felkészítés Tanítási módszerem: részletes magyarázat, stabil elméleti ... további részletek >>

alapok, házi feladat, gyakorlatorientáltság Óradíj és Fizetés: tanóra: 2700 Ft/50 perc fordítás, tolmácsolás: megegyezés szerint fizetés módja: átutalással bankszámlára Számlaképes vagyok. Rugalmas időbeosztással várom a tanulni vágyókat! A rendszeresség az egyik legfontosabb a nyelvtanulás során. Elfoglalt vagy? Sok a dolgod? Nem probléma: a tanóra időtartama megegyezés alapján akár 20 perc is lehet (ennek megfelelő árral)!


Feladva: 2017-04-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: angoltanórafizetésszerinttolmácsolásfordításpercfelkészítésmegegyezésidőtartamaalapokkorrepetálásegyikkultúrterülethezmódjaosztályozóelméletistabil

Forrás: pepitahirdeto.multiapro.com

Parkolási megoldás, Parkolóházi parkolás, az Erzsébet krt, József krt, Rákóczi út találkozásánál, a Blahánál, az Akácfa utcában 1072. Budapest, Akácfa utca 12-14 EZ Akácfa Parkolóházban Parkolásért már nem érdemes aggódni. Alkalmi óradíjas parkolás 220 Ft/ fél óránként, Napidíjas Parkolás kedvezményesen, 24 órára elővételben. Parkolóházi havi bérletek 15 960 Ft-tól www.ezpark.hu/parkolohazak/akacfa- parkolo


Feladva: 2017-01-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: AkácfaParkoláskrtBudapestParkolóházParkolóházióráranemRákóczikedvezményesenmárParkolásértJózsefNapidíjasParkolóházbanErzsébetóránkénttólmegoldás

Forrás: pepitahirdeto.multiapro.com

Frappáns – vicces és hasznos ajándék ötletek nagyon jó áron Mindenkinek! Ha csak ötletekre vágysz, akkor is szívesen látunk weboldalunkon vagy facebook oldalunkon! Nálunk minden alkalomra találsz jó ötletet, legyen az születésnap, névnap, karácsony, évforduló, Valentin-nap, nőnap, ballagás, házavató! Kínálatunkat folyamatosan frissítjük. Személyes átvételi lehetőségünk Budapesten, a Márton utca 5. szám alatt, ahol kipróbálhatod termékeinket. Honlapunk: http://atomzsir.hu


Feladva: 2016-09-30    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: atomzsirajándékötletekkipróbálhatodlátunkfolyamatosanhasznoslegyenaholszívesenKínálatunkatviccesötletetalattakkorházavató8211találszszámvágysz

Forrás: pepitahirdeto.multiapro.com

Ez a vergődés ismétlődik már több éve hónapról hónapra? Változtasson rajta! Változtatás nélkül nincs változás! Ha nem változtat az életén, akkor mitől vár változást? Élni akarja az álmait vagy álmodni a céljait? Ugye nagyszerűnek tűnik, hogy hetente akár több ezer Dollárt is kereshet játszi könnyedséggel? Minden internetes munkával foglalkozó ember álma egy ilyen lehetőség, de a helyzet az, hogy az álom ez esetben mindenképpen csak álom marad. Több átveréssel is lehet találkozni az internetes ... további részletek >>

munka lehetőségek közt. Ha ilyen kétes kimenetelű ajánlatot keres, akkor csalódni fog. mert nem Önn ek szól. Munkát ajánlunk kiemelten magas fizetésért. Az okos ember előre gondolkodik, a buta a múltban él, és a még butább azt gondolja, hogy ha nem tesz semmit sem, akkor sokkal jobb lesz Neki! Sajnos ezért is sok család fog úgy élni, mint most, sok év múlva is, sőt sokkal rosszabbul! Ajánlat azoknak, akiknek komoly céljai vannak és olyan havi jövedelemre van szükségük, amelyből kényelmesen biztosíthatják családjuk megélhetését: / kb. 500.000,- / hónap / Pl: Első sorban több szabadidővel rendelkezők, kiskeresetűek széles kapcsolatokkal rendelkezők vagy több gyermekes családok, stb. Munkaidő: Heti 30 – 40 óra Egyedülálló, rendkívülien magas jutalékkal keresek olyan embereket, akik széleskörű ismeretséggel és kapcsolatokkal rendelkeznek! Jelentkezzen ha konkrét céljai vannak, mindenben segítek. Kérem, hogy az email címemen jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-05-08    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogytöbbnemakkorolyanélnivannakembercéljaimagasspórolvagyfogálombárrendelkezőkfizetésébőljelentkezzenilyenkapcsolatokkalsokkalvégéigjön

Forrás: pepitahirdeto.multiapro.com

EXACT Personal Bajorországi bejegyzésű cég és Németországba közvetítünk dolgozókat. Minden állásunknál legalább A2 némettudás szükséges. Szállás megoldott.. http://www.nemetmunka.hu/betonelem-gyarto.html Fenti linkeken részletes leírás van. Kivonat állásunk leírásából: BETONELEM készítő, (Nr. 56/2017) volt házgyári munkás, stb (KÖMŰVES, építőipari munkás, stb) legalább B1 némettel, Landshut közelében lévő betonelem gyártó ütemben. Az ott dolgozó munkások fizetése 13-19€ / óra. Az új ... további részletek >>

kolléga fizetése egyéni megegyezés szerint direkt a céggel. A betonelem gyártás munkafázisai a következők: reggel kizsaluzás, zsaluk tisztítása, bezsaluzás, tartozékok beépítése, beton beöntése, munkahely takarítása. TÖBB INFÓ az állásról a fenti linkre kattintva a weboldalon van. Állásainknál mindig direkt a német cég a munkaadó! (NEM Zeitfirmák, mert munkaerőkölcsönzőkkel nem dolgozunk.) Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1./ E-mailben: info@nemetmunka.hu 2./ Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3./ Telefonon munkaidőben a magyar 06 1 920 3433 ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9,00-17,00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-11-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: betonelemnémetnemetmunkawwwcéglegalábbTeamstbMunkadirekthtmlmunkásmailbenvanBajorországbanhttpTelefononfentikattintvanemlinkrekészítővagy

Forrás: pepitahirdeto.multiapro.com

Mixerbeton bedolgozás meggyorsításához és könnyebbé tételéhez rendelhet nálunk betonszivattyút huszonhárom méteres gémhossztól egészen ötven méteresig, melyeket igény esetén meg is lehet hosszabbítani földre fektetett csövek összeszerelésével. Óradíjainkat megtalálja weboldalunkon mixerbeton árlistánkban!


Feladva: 2014-01-16    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: mixerbetonbetonarwwwlehetbetonszivattyútárlistánkbanmegnálunkeseténrendelhetweboldalunkonigénytételéhezmegtaláljamelyeketkönnyebbéÓradíjainkatötven

Forrás: pepitahirdeto.multiapro.com

A magas fehérvérsejt szám rendellenes állapot, mely általában fertőzést mutat. Ugyanakkor pajzsmirigy túlműködés is állhat drasztikus mértékű megemelkedésének hátterében. Az alacsony fehérvérsejt szám szintén nem ideális, hiszen fogékonyabbá tesz a betegségekre. Ez általában kemoterápia, sugárkezelés, csontvelő rendellenesség és vírusfertőzés miatt fordul elő. Egy egészséges szervezetben a fehérvérsejtek az összes sejt 1%-át teszik ki, az ennél magasabb és alacsonyabb arány betegség meglétét ... további részletek >>

mutatja. A fehérvérsejt és vörösvérsejt terápiák a kiváltó ok ismeretében kezdhetők meg.


Feladva: 2016-08-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fehérvérsejtállapotáltalábanvörösvérsejtszámkemoterápiamutatjahátterébenszervezetbenmeglététmegemelkedésénekegészségesrendellenesbetegségekrebetegség

Forrás: pepitahirdeto.multiapro.com

Nadrágok, ruhák, szoknyák és kabátok rövidítését, szűkítését, vagy karcsúsítását vállaljuk rövid határidőre, korrekt áron. Cipzárcsere, cipzárjavítás szakszerűen! Cím: Budapest IX. Tompa utca 22. Ruhaszerviz Nyitva: h,sz,p,: 9,15-17,00-ig k,cs,: 10,00-18,00-ig A szombati nyitva tartásról érdemes előzetesen érdeklődni! Tel.: 06-1-215-7047 Várom szeretettel! www.divatruha.hu/index.php?page=ru haszerviz


Feladva: 2016-07-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: RuhaszervízFERENCVÁROSBANNEKEDBudapest251kítésétérdeklődjöncipzárjavításrövidítésétnyitvatartásrólCipzárcserekabátokszombatiáronszoknyákNyitvakorrekt

Forrás: pepitahirdeto.multiapro.com

A bevásárlóközpontok, plázák, mallok világszerte méltán népszerűek... Olyan igényt elégítenek ki, amivel mindenki nyer! Magyarországon is jelentősen növekedik az e-kereskedelem. Számtalan webáruházat találhatunk, jót is és kevésbé jót is... Azoknak a kereskedőknek figyelmére mindenképpen számítunk, akik már megtapasztalták a saját webhelyeiken nem csak az éppen hatályos jogszabályoknak kell megfelelni, hanem folyamatosan karban kell tartani a webhelyet, annak az elérhetőségét, különben a ... további részletek >>

látogatottság, vele együtt az üzleti eredmény is elmarad. Azok figyelmére is számítunk, akik (esetleg földrajzi adottságaik miatt?) fejlődésre csak az interneten keresztül számíthatnak. Internetes kereskedelemről van szó, pláza szerű webes környezetben! Nem feltétlenül mindenki alkalmas azonnal árusítani termékét, interneten forgalmazható szolgáltatását. Ismerjük meg egymást! Ön tudni szeretné, hogy miképp lehet kereskedő webplázánkban, mi pedig azt, hogy Ön milyen gyakorlattal (ismeretekkel) rendelkezik már az internetes kereskedelemben, milyen árucikkeket, termékcsoportokat forgalmazna. Ezen a helyen biztonságosan üzenetet küldhet, egy rövid bemutatkozást, cégismertetőt kérünk! Ha van webhelye, kérjük írja meg webcímét is! Minden olvasónak köszönet az érdeklődésért, az üzenetekre a legrövidebb időn belül válaszolunk!


Feladva: 2017-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: márNemhogyjótvaninternetenakikesetlegmilyenplázaszámítunkfigyelméreinternetesmegkellMagyarországonmindenkicsakkérjükegymástüzletinyeridőn

Forrás: pepitahirdeto.multiapro.com

Miért népszerűek a videók? Talán azért, mert képesek sokkal több vizuális üzenetet közvetíteni viszonylag rövid idő alatt... Meglehet, azonkívül még szórakoztatóbbak is néha, mint a megszokott webtartalmak. Így, vagy úgy nem véletlen, hogy egyre többen használjuk hirdetni valamit! Ennek ellenére egyenlőre nem fedezték a legtöbben azt, a videók is webtartalmak. Alapból nem kereshetőek, csak a videót tároló szolgáltatónál (például YouTube, Vimeo), ahová nem mindenki látogat azért el, ... további részletek >>

lássuk be! Léteznek a videók népszerűsítésére más módok is, mint nálunk is, a beágyazás... Jó ez is, de ez esetben a mi látogatóinknak válik kereshetővé csak, ami azért nem utolsó, de... Miért ne jelenne meg a Google keresésekben egy videó? Pláne, ha ott nagyságrendekkel többen keresnek valamit minden másodpercben! A Pepita Hirdető minden nyilvános videót kereshetővé tud tenni a Google-on, pont ugyan úgy, ahogy a hirdetéseket és a hirdetők webhelyeit! Csak kérnie kell! (Nem jár automatikusan senkinek sem sajnos...) Alább, a YouTube csatornánkon összeválogatunk néhány hirdetői videót... www.youtube.com/playlist?list=PLJKQOllTKBIMgTYld2pKPoldbPj5rcrYw


Feladva: 2017-07-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: nemcsakazértvideótvideókkereshetővéúgymindenvalamitwebtartalmakGoogleMiértmintYouTubetöbbenHirdetőPepitamégsokkalmindenkihirdetéseketpersze

Forrás: pepitahirdeto.multiapro.com

Könyvkötés, könyvjavítás, valódi BŐRKÖTÉS. Egyedi ajándékok készítése. SZAKDOLGOZAT, SOS felár hélkül! Diploma, bekötése előrendeléssel megvárható. Nyomtatás színes lézerrel. Fénymásolás, spirálozás, riccelés, aranyozás, bélyegző, dombornyomó készítés.


Feladva: 2014-03-17    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: NyomtatásKönyvkötésSZAKDOLGOZATkészítéseLászlószínesajándékokKunEgyedimegvárhatóBŐRKÖTÉSkészítéselőrendelésselvalódidombornyomóbekötésekönyvjavítás

Forrás: pepitahirdeto.multiapro.com

Ritka lehetőség! Csopakon eladó egy 128 nm alapterületű (+ 40 nm beépített tetőtér), tájjellegű, de mégis modern családi ház, 1200 négyzetméteres ősfás kerttel, patakkal. A nádtetős épület 2013-ban jelentős mértékű felújításon esett át. A házban nappali, + négy hálószoba, három konyha, három fürdőszoba található, a terasz 25 négyzetméteres. A nyílászárók fából készültek, a fűtést két kandalló segíti. A házhoz duplagarázs épült, Hörmann ajtókkal,valamint egy külön kis műhely, és van egy ... további részletek >>

nagyméretű boltíves borospince is. A ház egyik része két jól felszerelt , szépen berendezett apartmanként üzemel, és 8 fő fogadásra alkalmas, a másik része egy teljesen elszeparált önálló lakást képez. A vételár tartalmazza a berendezést csakúgy, mint a vendégkört. Irányár: 54,9 millió Forint. Kód: 207 Az összes jelentős bank kínálatából legalkalmasabbat megkeresve 150 millió Ft-ig teljes körű hitel ügyintézést vállalunk! www.immobalaton.com/ingatlan/elado/207


Feladva: 2017-10-13    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egyházeladó207milliókétrészenégyzetméterescomimmobalatonháromjelentősnádtetősönállófűtést128szépennégykörűForintkiskerttelelszeparált

Forrás: pepitahirdeto.multiapro.com

Akrobatikus tűzzsonglőr és tűztánc show, színpadi pirotechnika, tűzijáték, UV & LED show, gólyalábasok, rendezvényszervezés. Acrobatic firejuggler and firedance show, stage pyrotechnics, fireworks, UV & LED show, stilts, event organizing.


Feladva: 2016-05-08    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: showtűzzsonglőrLEDfiredanceAkrobatikusandBudapestfirejugglerBeátaorganizingAcrobaticILLÉSeventrendezvényszervezéscsapatstiltsgólyalábasokprodukció

Forrás: pepitahirdeto.multiapro.com

Ausztriai és németországi munkára keresek szakembereket. (Néhány esetben nem kell, de a legtöbb esetben valamennyi nyelvtudás szükséges.) Bővebb információ, érdeklődés a teke.eszter@prohuman.hu e-mail címen vagy a 0670 197 5293-as telefonszámon. Betöltendő munkakörök: Autogén csőhegesztők / Asztalos / AWI-CO hegesztő-lakatos / Betonelem gyártó / CNC élhajlító / CNC Esztergályos / CNC Heidenhain programozó / CNC köszörűs (Schleifer) / CNC maró gépbeállító / CNC marós gépkezelő / CNC ... további részletek >>

marós programozó / CNC Trumpf élhajlító gépkezelő / CNC Trumpf lézergépkezelő / CNC Zayer Portálmarós / Co hegesztő + lakatos / Fémszerkezet szerelő / Kapcsolószekrény szerelő / Lakatos, hegesztő / Lézergépkezelő Magyar bejelentés, külföldi kiküldetés.


Feladva: 2017-09-16    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: CNChegesztőLakatosLézergépkezelőélhajlítóesetbenprogramozómarósszerelőtekekülföldiTrumpfgépkezelővagyAWIEsztercímenlegtöbbAsztalosállásmail

Forrás: pepitahirdeto.multiapro.com

Otthonról is végezhető munkát keresel, de nem tudod fog-e menni? Egy hónap elég lenne, hogy kipróbáld magad? Mit szólnál egy harminc napos ingyenes próbához? Ráadásul egy automata eszköz elvégzi a munka nehezét helyetted. Megkeresi azokat, akiket érdekel az ajánlatod, és bemutatja nekik. Ne töprengj, hanem vágj bele most azonnal. Csatlakozz, és már kezdheted is. Még regisztrációs díjat sem kell fizetned. A cég napi fogyasztási cikkekkel foglalkozik, tehát biztos a kereslet. A jutalékod miatt ... további részletek >>

sem kell aggódnod, mert megkapod forintban. A videókból mindent megtudhatsz. Mutasd meg ismerőseidnek, milyen remek lehetőséget találtál, még mielőtt ők mutatják neked ugyanezt. Katt ide és nézd meg a videókat! => http://bit.ly/tesikered


Feladva: 2017-10-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: megegysemkellcégszólnálmilyenhanemnemmunkanézdfizetnedMitismerőseidnektöprengjkereselmiattelvégziidedíjatmagadMutasdnekikmunkáteszköz

Forrás: pepitahirdeto.multiapro.com

Az Aloe Vera és tizenkét értékes növényi kivonat hatékony kombinációja. Védőrétegként vonja be az igénybe vett bőrt. Nyugtat és hűsít.


Feladva: 2017-03-18    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: VeraAloehűsítértékesNyugtattizenkétbőrtvettigénybePécsvonjaÉvaVédőrétegként500kombinációjaSprayhatékonykivonatnövényi

Forrás: pepitahirdeto.multiapro.com

A moringa, azaz a csodafa természetes multivitamin, melynek leveléből tápanyagokban bővelkedő étrendkiegészítő készül. Rendszeresen fogyasztva a vitalitás növekedését, az erőnlét fokozódását tapasztalhatjuk. A moringa multivitamin antioxidáns gyerekeknek és felnőtteknek egyaránt segít megőrizni az egészséget, illetve betegség esetén hatékony támogatást nyújt a gyógyulás érdekében. Több mint 40 féle antioxidánssal védi a sejteket és veri vissza a káros szabadgyökök támadásait, ezzel pedig ... további részletek >>

sokat tesz a betegségek és az öregedés ellen. Természetes multivitamin moringa porból - Információk és rendelés 1 perc alatt! www.multivitamin.moringa.bolt.hu/multivitamin


Feladva: 2017-09-15    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: moringamultivitaminTermészeteslevelébőlantioxidánssalcsodafapercilletvesokatnövekedésétféleazazrendelésegészségetpedigvitalitásmintKittimegőrizni

Forrás: pepitahirdeto.multiapro.com

Ne törődjön bele abba, hogy nem néz ki úgy, ahogy szeretne. Van segítség! Dr. Rusz Zoltán, plasztikai sebész vagyok. Honlapomon megtalálja szakmai önéletrajzomat és itt a referenciamunkáimról készült fotókat is meg tudja tekintetni.


Feladva: 2017-10-15    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ZoltánRuszplasztikaiabbafotókatbelekészülttörődjönreferenciamunkáimrólsegítségkerületittVanBudapestönéletrajzomatszeretnesebészetszakmaiahogy

Forrás: pepitahirdeto.multiapro.com

KOBRA AF.1 - a leggyorsabb automata iratmegsemmisítő - 24 óra folyamatos használat - fém hajtáslánc, acél fogaskerekek, edzett acél vágókések - nem szükséges olajozni a vágókéseket - 135 literes hulladéktartály www.kobra-shredder.eu/hu/af1


Feladva: 2016-08-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: kobrairatmegsemmisítőautomatashredderacélwwwhasználatvágókéseketfolyamatosolajoznióraszükségesnemvágókésekleggyorsabbedzettfogaskerekekhajtáslánc

Forrás: pepitahirdeto.multiapro.com

Sziasztok, ki szeretne otthonról: 🔸suli 🔸gyed 🔸gyes vagy 🔸meló mellett is akár egy kis plusz pénzt keresni? Ha elmúltál 18 éves, akár fő vagy mellékállásban is dolgozhatsz, saját időbeosztásoddal, azonnali jutalékkal! Te döntöd el mikor, honnan és mennyit dolgozol.   Nincs semmi másra szükséged csak egy okostelora vagy egy laptopra és internetre. Teljesen ingyenes! Én ezt teszem és te? Ha érdekel, írj privát, és küldöm a részleteket! ... további részletek >>

Nekem bejött!


Feladva: 2017-10-17    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 128312vagyegyakárTeljesen12288DolgozzbejöttmellékállásbaninternetregyesdolgozolNekemlaptopragyedmennyitrészleteketévessulihonnanküldömmikor

Forrás: pepitahirdeto.multiapro.com

Horvátországi ingatlanok. REN Ingatlanközvetítő (15 éve partnerünk) ajánlatából helyeztük el az oldalon. A linkeken, az oldalukra jutva sok ház, villa, lakás, és isztriai ház közt válogathat… www.kekadria.hu/ingatlan/hingatlan 1.html


Feladva: 2017-10-05    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: ingatlanokHorvátországiKékAdriaházpartnerünkisztriaiévelakásIngatlanközvetítővillaRENsokjutvaoldalukralinkekenoldalakon8230oldaloneladókiadó

Forrás: pepitahirdeto.multiapro.com

A 2835 chippel szerelt LED szalagok hatalmas fényerővel rendelkeznek, így alkalmasak konyhai munkafelületek ledes világításához, LED fővilágítások készítésére, kirakatok figyelemfelhívó világítására! 2835 szalag 60 db LED egy méteren - bruttó 1.990 Ft 2835 szalag 120 db LED egy méteren - bruttó 2.885 Ft Kültéri, azaz szilikonbevonatos változatban is elérhetőek, így víznek-párának kitett helyen is használhatóak ezek a LED csíkok! Raktárról 1-3 munkanapon belül leszállítható! (ANRO) ... további részletek >>


Feladva: 2014-11-06    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: LED2835szalaghatalmasszalagokszereltbruttóANROchippelméterenegyígyváltozatban1990csíkokrendelkeznekszilikonbevonatosvilágításárafényerővelazaz

Forrás: pepitahirdeto.multiapro.com

Exkluzív névre szóló étkészletek, evőeszközök kiegészítőkkel! Ha egyedi ajándékkal szeretnéd meglepni az ifjú párt, vagy ha a saját esküvőd szeretnéd egyedibbé és meghittebbé tenni, nézz körül nálunk! Webáruházunk rendeléseit országosan kiszállítjuk.


Feladva: 2015-04-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szeretnédétkészletekesküvődszólósajátnévrevagyExkluzívpártÁcsnálunkifjúBoglárkakörülmeglepniPappnénézzajándékkalajándékoktenniegyediEsküvői

Forrás: pepitahirdeto.multiapro.com

Palatetõ tisztítás, festés, javítás, felújítás cseréptetõ tisztítása festése felújítása Cserepes és trapéz lemeztetõk tisztítása festése! Garanciával!


Feladva: 2017-03-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 245festésetisztításatrapézmegszüntetéseCserepesBeázásokfelújításacseréptetfelújításjavításGaranciávalfestéstisztításPalatetLajoslemeztetKocsis

Forrás: pepitahirdeto.multiapro.com

Balatonboglár és vonzáskörzetében lévő ~ 180 kiadó szálláshely fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Több mint 2000 fényképpel a szálláshelyekről és a településekről! - Úszómedencével rendelkező szállások. - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó balatoni szállások. - Egész évben nyitva ... további részletek >>

tartó szálláshelyek Balatonbogláron. - Weblap: www.zimmerinfo.hu/boglar/hu.htm


Feladva: 2017-05-10    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szállásokzimmerinfokiadóBalatonboglárbalatonigyűjtőoldala2000KözvetlenelfogadófényképesmintwwwtérképpelPihenőkártyaszálláshelyTöbbhttpSzéchenyi

Forrás: pepitahirdeto.multiapro.com

Adatrögzítést, gépelést vállalok. Jegyzőkönyv készítését értekezletről, közgyűlésről, konferenciáról, gyorsírással, hanganyag készítésével. Gépelést, szövegszerkesztést, hanganyagok leírását, adatfeldolgozást, adatbázis feltöltést. Szakdolgozatok, fordítások, könyvek, használati útmutatók, diplomamunkák, kéziratok, életrajzok, önéletrajzok leírását. Interjúk, cikkek, háttéranyagok leírását diktálással is. www.kattyca.mindenkilapja.hu/html/ 22219339/render/bemutatkozas


Feladva: 2015-07-17    [Vegyes hirdetések]

Címkék, kulcsszavak: leírásátkattycakészítésétJegyzőkönyvGépeléstmindenkilapjaértekezletrőlInterjúkadatbázisönéletrajzokadatfeldolgozástwwwéletrajzokhanganyagokcomvállalok

Forrás: pepitahirdeto.multiapro.com

Lakberendezés Egyéni Igényekre Teljes körű Építészeti és Belsőépítészeti 3D Látványtervezést kínálunk: Tervezőknek · Gyártóknak · Beruházóknak · Magánszemélyeknek


Feladva: 2017-07-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 183MagánszemélyeknekIgényekreEgyéniBeruházóknakLakberendezésGyártóknakajánlóTervezőknekHirdetőkínálunkPepitaLátványtervezéstLátványtervezésValósághű

Forrás: pepitahirdeto.multiapro.com

Ásvány ékszerek hihetetlen árakon nagyszerű kedvezményekkel akár 60% kedvezménnyel a Lili Bizsu webáruházban www.lilibizsu.hu Házhoz szállítás már 650 Ft-tól akár ingyenesen is


Feladva: 2017-10-29    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÁsványBizsuLiliakárnagyszerűmárárakonszállításhihetetlenHázhozékszereklilibizsuwwwWEBÁRUHÁZwebáruházbanolcsóniyeningyenesenékszertkedvezménnyel

Forrás: pepitahirdeto.multiapro.com

Eladó tulajdonostól Bpest. Rákoshegy - Nagyhangácson az Orgoványi utcában 620,2 nm-es, külterületen lévő bekerített kertgazdasági, szántó, gazdasági épület, kivett lakóház, udvar megjelölésű ingatlan és a hozzá tartózó 44,8 nm szolgalmi út. A telken villany és a vezetékes víz bekötve a házba, gáz az utcában, gyűrűs kút, bontandó vagy erősen felújításra szoruló 36 nm-es faház (2 helység, külön WC, tusolós mosdó, veranda és 26 nm-es fedett tároló) van. Csatorna, szennyvíztároló nincs. ... további részletek >>

Személygépkocsi tárolás kerítésen belül megoldható. Utca fronti személykapu, oldalsó gk. bejárat. A terület átminősítése gazdasági területté a Fővárosnál folyamatban van. Befektetésnek is ajánljuk. BKV busszal 10 perc a KöKi . Tájékoztatás csak telefonon! Az ár alkuképes irányár.


Feladva: 2017-10-16    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vanEladógazdaságiutcábanirányárfedettkivettRákoshegyerősenUtcavillanyépületalkuképes26nmBpestfolyamatbanvagymegoldhatótelkenszántótelefonon

Forrás: pepitahirdeto.multiapro.com

Az alacsony vérnyomás tünetei leginkább közérzetünket rontják. Aki gyakran fáradt és nem talál erre magyarázatot, sokszor szenved fejfájástól, hányingertől és gyengének érzi magát, érdemes megmérnie a vérnyomását. Ha az értékek a kelleténél alacsonyabbak, több módon is tehetünk azért, hogy a vérnyomást egészséges szintre állítsuk be. Alacsony vérnyomás és magas pulzus ellen a legjobb, ha mozogni kezdünk. Ilyenkor a vérnyomás megemelkedik, a pulzusszám pedig csökkenni fog. Ha rendszeresen fennáll ... további részletek >>

ez a helyzet, mindenképpen kivizsgálás javasolt, mivel emögött pajzsmirigy túlműködés, vashiányos vérszegénység is meghúzódhat.


Feladva: 2016-11-07    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vérnyomásAlacsonykezdünknemhogyhelyzetmagátmozognifáradtmeghúzódhatazértfennállérzilegjobbgyakranvérszegénységtehetünkrendszeresengyengénekAki

Forrás: pepitahirdeto.multiapro.com

Kézzel készített férfi és gyermek csokornyakkendők nagy választékban. Fényes, matt, virágos, kockás, pöttyös, vintázs kivitelben.


Feladva: 2017-08-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: kivitelbenférfivintázskészítettpöttyösKézzelkockásajánlóvirágosHirdetőmattPepitaFényesCsokornyakkendőboltválasztékbannagycsokornyakkendőkgyermek

Forrás: pepitahirdeto.multiapro.com

Értékesítőket keresünk PC játékok, szoftverek eladásához. Jutalék alapú fizetés. Kötetlen munkaidő, magas jutalék! Nem szükséges végzettség, tapasztalat. Bővebb infó a linken: https://goo.gl/TbG2mW


Feladva: 2017-08-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: jutalékhttpsKötetlenlinkenfizetésinfóalapúBővebbeladásáhoztapasztalatszoftverekvégzettségjátékokszükségeskeresünkNemÉrtékesítőketSuhancTbG2mW

Forrás: pepitahirdeto.multiapro.com

Szerelmes akarsz lenni? Akkor tedd meg az első lépést! Új esélyek szingliknek! Teljesen ingyenes a társkereső oldal, ahol csak 10 másodperc a regisztrálás és bármi elképzelhető. INGYENES!!!


Feladva: 2016-01-04    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: INGYENEStárskeresőfelszedleklennioldalakarszSzerelmesTeljesenDianawwwszingliknekelképzelhetőesélyekbármilépéstregisztráláselsőmásodpercmegegy

Forrás: pepitahirdeto.multiapro.com

2000-es évjáratú Twingo eladó. Műszaki érvényessége: 2019. 06.19. Elektromos ablak, tükör beállítás, légzsák, szervókormány HIBÁI: sajnos a jobboldali ablak elektromossága hibás, nehéz felhúzni, a fényszórók rossz bekötés miatt nem megfelelően működnek. Mivel már nem fiatal, természetesen van rajta mit csinálni, igény szerint... Ára: 170.000,- Ft Alkuképes!


Feladva: 2017-10-05    [Autó - Motor - Jármű]

Címkék, kulcsszavak: ablakeladóTwingonemMivelszerintMűszakiműködnekjobboldaliigénymegfelelőensajnoscsinálnimiattHIBÁImitévjáratúbekötésszervókormányrajta2000van

Forrás: pepitahirdeto.multiapro.com

Hitelkártyák, személyi hitelek, egyesítése egy hitelbe! Jelenlegi hiteleinek havi törlesztését akár 50-40%-ra is le tudjuk csökkenteni. Még mielőtt fizetésképtelenné válik, jelentkezzen! Az ügyintézésért jutalékot nem kérünk, bankokkal vagyunk szerződve! Szűcsné B. Erzsi Személyi kölcsön értékesítő vezető 1214 Budapest Csepeli út 83. Telefon: 06-30-841-0329 E-mail: i nfo.szbe@gmail.com Web: www.hitel-city.hu és www.hitelügyintézés.com


Feladva: 2017-07-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzemélyiegyesítésehitelekcomBudapestcitytörlesztésétvezetőSándorjutalékothitelhaviértékesítőSzűcsügyintézésértszbe@gmailhiteleinekkölcsöninfo

Forrás: pepitahirdeto.multiapro.com

Kiemelt specifikációk: - Rendszermemória (RAM) 2 GB - Operációs rendszer verzió Android 7.1.1 (Nougat) - Kijelző átlója 5.2 - Kijelző felbontás 720 x 1280 - Fényképező felbontása, tulajdonságai 13 MP, f/2.0, phase detection autofocus, 1/3 - Processzor sebessége Octa-core 1.4 GHz Cortex-A53 - Akkumulátor kapacitása 3000 mAh Ingyenes kiszállítás 24 hónap garancia Minden gyári tartozékkal Magyar nyelvű készülék VIP Phone szaküzlet 1138 Budapest, Váci út 136/c. +3670-930-4414 ... további részletek >>


Feladva: 2017-07-12    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: mobiltelefonnokiavipkeksimKijelzőphone3000PepitadetectionnyelvűAndroidkapacitásakártyafüggetlenphasewwwMagyarverzióAkkumulátorDual4414A53

Forrás: pepitahirdeto.multiapro.com

Szépen kidolgozott, kecses 19 colos LCD az LG-től. Az elektronika egy része a talpban és a csatlakozó házában lett elhelyezve, így a monitor oldalról és hátulról is mutatós, nem bumszli. Bekapcsolt állapotban a talpban látható kör pirosan világít, ami nagyon mutatós. Külső tápot igényel, ezt természetesen adom hozzá. Csatlakozása DVI. Bővebben: www.sokcuc.com/list.php?id=29


Feladva: 2017-09-30    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: talpbanmutatósLCDmonitorkörelhelyezvetermészetesenkidolgozottláthatóphpletteztSzépenlistházábanigényelajánlásállapotbancomcsatlakozótápot

Forrás: pepitahirdeto.multiapro.com

Pest megyéből taxi transzferek igen kedvezően Liszt Ferenc (Ferihegy) reptérre. Aktuális ajánlatokért telefonáljon (06 70 2387924), látogassa meg honlapunkat.


Feladva: 2015-06-02    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: taxiFerencLisztlátogassatranszferek2387924telefonáljonmegyébőlajánlatokértPestAktuálishathazireptérreajánlatokFerihegytranszferreptérihonlapunkat

Forrás: pepitahirdeto.multiapro.com

Több mint ezer féle divatékszer és kiegészítő, mobil és táblagép kiegészítő, kozmetikai cikkek, ásványok, csillámtetoválás, pénztárca, tetoválás, óra, piercing és még sok minden más a lehető legjobb árakon. Rengeteg állandó és aktuális, egymással összevonható kedvezmény! Törzsvásárlói program és ingyenes kiszállítás! Ez mind és még sok minden más a LILI BIZSU Webáruházban. Ilyen olcsón még nem vásárolt....


Feladva: 2017-02-18    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: mégsokkiegészítőBIZSULILImásmindenlegolcsóbbanRengetegvásároltkozmetikaimindkiegészítőkárakonnemkiszállításÉkszereklegjobbtáblagépingyenesóra

Forrás: pepitahirdeto.multiapro.com

Konzol szaküzlet és szerviz Békéscsaba belvárosában. Használt játékok széles választékban garanciával! Megunt konzolodat és játékaidat is beszámoljuk.


Feladva: 2016-12-31    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: BékéscsabaXboxjátékokgépekOnebeszámoljukszervizjátékaidatszaküzlet360konzolodatKonzolPS4MeguntajánlóPS3garanciávalHirdetőválasztékbanPepita

Forrás: pepitahirdeto.multiapro.com

Modern és klasszikus olasz gyerekbútorok prémium kivitelben. Számtalan színből és elemből válogathat. Látogasson el üzletünkbe. 1093 Budapest Közraktár utca 20./a Telefon: 061-215-33-74


Feladva: 2017-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: olaszwwwBudapest1093klasszikusmatracfutarüzletünkbeModernLátogassonBútoráruházlineaflexbutorválogathatLineaflexwebelembőlgyerekbútor215színből061

Forrás: pepitahirdeto.multiapro.com

Hordozható cserépkályha 160.000 Ft-tól 320.000 Ft-ig. Akciós és egyedi kézzel készült csempéből! Hagyományosan járatokkal ellátva, hőtárolós kivitelben. Rendkívül gazdaságosak! A fűtési módok közül a leghatékonyabb. Kiváló ár-érték arány jellemzi a saját magunk készített cserépkályhákat. Minden darab egyedi! Építünk, cserépkályhákat, kandalló típusú cserépkályhákat, tartályos cserépkályha-kandallókat. Web: www.cserepkalyhak-mobilcserepkalyhak.hu Email: pollakferi@icloud.com Tel.: ... további részletek >>

06-20-397-91-02


Feladva: 2016-12-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: cserépkályhacserépkályhákat000HordozhatóegyediAkcióskandallókatmagunkRendkívül320sajátkivitelbentartályostóljellemzi397hőtárolós140arányTel

Forrás: pepitahirdeto.multiapro.com

Édesség, aprósütemény, teasütemény, linzersütemény gyártás, készítés, forgalmazás.


Feladva: 2016-11-04    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: gyártásteasüteményaprósüteményislerlinzersüteményzserbólinzerÉdességbékéscsabaGabriellaPatakiforgalmazóforgalmazáskészitőkészitésgyártó

Forrás: pepitahirdeto.multiapro.com

Egyre több az anyagi helyzetével elégedetlen fiatal! A harmadik ikszbe lépve már senki nem engedheti meg azt a luxust, hogy ne törődjön saját és családja jövőjével. Legkésőbb harmincas évei során mindenkinek szembesülnie kell azzal, hogy felelősséggel tartozik saját és esetleges családja jövőjéért, ha tetszik ha nem. Éppen ezért 30-as éveiben kell alaposan megterveznie a jövőjét pénzügyei szempontból is. Nem kifogás, hogy a jövőt senki nem látja előre, hiszen ha van egy terve, még egy ... további részletek >>

bizonytalanságból eredő esetleges akadályokat is sokkal jobban fogja venni. A most negyvenes éveiben járó szendvicsgeneráció 15-20 év múlva szorult helyzetbe kerülhet, hiszen amellett, hogy a gyermekeit támogatja majd, valószínűleg részben a szüleiről is gondoskodnia kell. Ön mikor tervezi, hogy megtegye a szükséges lépéseket ahhoz, hogy emberi életet éljen nyugdíjas korában? Felajánlom az elégedetlen fiataloknak egy zseniális lehetőséget, mert sokszor még családalapítás előtt vannak, még van idejük pár év kemény munkájával, hosszú ideig élvezni a boldog életet. Ha nem lépnek időben, akkor sajnos nagy az esélye, hogy sokan egyre lentebb fognak csúszni az életben, és ez a társadalomra is súlyos kihatása lesz! Ha valaki saját magán nem akar segíteni, akkor mi sem tudunk segíteni, de ha hajlandó megismerni új lehetőségeket, akkor minden segítséget meg tudunk adni annak érdekében, hogy a családjuknak sokkal jobb életszínvonalat biztosítsanak Jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-03-28    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmegegyresajátakkoregyelégedetlenkelléletetesetlegestudunkéveibenfiatalsokkalsenkihelyzetévelanyagihiszencsaládjatöbbvansegíteni

Forrás: pepitahirdeto.multiapro.com

Szálláshelyek és szállásfoglalás Erdélyben. Foglalja le már most erdélyi szálláshelyét, nyaralásához. Erdelybe.hu és szallas-erdely.hu oldalainkon válogatott erdélyi szálláshelyeket találhat. Szálláshelyeinknen már többezer elégedett vendégünk megfordult. Az erdélyi szálláshelyek közül csak a legjobbakat válogattuk ki Önnek, hogy egyszerű legyen a választás.


Feladva: 2017-02-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekerdélyimárErdélybentöbbezerszálláshelyétÖnnekmostválogattukSzálláshelyeinknenFoglaljalegjobbakattalálhatcsakszálláshelyeketszállásfoglalás

Forrás: pepitahirdeto.multiapro.com

Akác kerítéslécek közvetlenül a gyártótól. Többféle minta és méret.Akár egyedi igények készítését is vállaljuk. Szeletelt akác. Kerítések kivitelezése. Kérje ingyenes árajánlatunkat email-ben.


Feladva: 2017-05-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: gyártótólakáckerítésingyenesméretKerítéslécKérjemintakivitelezéseTöbbféleKerítésekközvetlenülSzeleteltkerítéslécekvállaljukÉrdkészítésétAttilaben

Forrás: pepitahirdeto.multiapro.com

Egy olyan rendkívüli fizetési mód kezdett elterjedni Magyarországról kiindulva a világon, amely a következő években, évtizedekben, teljesen átalakítja a fizetési szokásokat! Már elindult, legyen Ön is az elsők között. Minden embernek gyökeresen megváltoztathatja az életét, de az első pár millió embernek soha nem látott vagyont is jelenthet. Az eddig ismert összes fizetési mód együttesen nem tud annyi előnyt biztosítani, mint a cégünk által az egész világon levédett, egyedüli és rendkívül ... további részletek >>

egyszerű fizetési rendszerünk. Képzeljen el egy olyan fizetési módot, ahol Önnek szó szerint semmilyen fizetőeszközre nincs szüksége. Érdekesnek találja? Képzeljen el egy fizetési módot, melynek köszönhetően nemzetközi szinten is sok millió ember mindennapos vásárlása után, minden egyes másodpercben jövedelme keletkezik. Garantálom, hogy nem kell befektetnie, vagy befizetnie felesleges csomagokra, nem kell semmit sem eladnia MLM rendszerben, nincsenek kötelezettségei, és garantáltan több pénze lehet, kevesebb nem! Kizárólag a mindennapi megszokott vásárlásokból! Kérje e-mailen mindenre kiterjedő információs levelem. Email: rozsabusiness@gmail.com


Feladva: 2017-04-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemfizetésiegyKépzeljenolyanmillióembernekmódkellvilágonmindenmódotvagyontErrőlnincsenekbefektetnielegyenemberbiztosítaniMagyarországrólhogy

Forrás: pepitahirdeto.multiapro.com

HA ÖNNEK VAN ELADÓ MÁRKÁS KARÓRÁJA, AKKOR ÉRDEKLŐDJÖN A 06 30 350 319-ES TELEFONSZÁMON, VAGY AZ ALÁBBI E-MAIL CÍMEN: E-mail: aranybazarkft@gmail.com Óra, karóra felvásárlás Ha szeretné eladni márkás karóráját, mi magas áron megvásároljuk boltjaink egyikében, azonnali készpénzfizetéssel. Amennyiben van lehetősége fotókat küldeni a megadott E-mail címre, kérjük tüntesse fel mennyit szeretne érte kapni. Rövid időn belül válaszolunk. Amiket vásárolunk: Patek Philippe, Jager-LeCoultre, ... további részletek >>

Vacheron Constantin, Breguet, Audemars Piguet, Breitling, Panarei, IWC Schaffhausen, Omega, Rolex, ARANY ÓRÁKAT. Amiket nem vásárolunk; Aranyozott órákat, Japán-Kinai kvarcórákat, replika órákat, divat órákat nem vásárolunk. Debrecen, Csapó utca 52 sz. alatti ékszerbolt


Feladva: 2017-02-19    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: órákatmailvásárolunkAmiketDebrecenmárkásszeretnevannemfelvásárláskaróraÓracímreELADÓkvarcórákatboltjainkBreitlingaranybazarkft@gmailékszerbolt

Forrás: pepitahirdeto.multiapro.com

Törökországban, Alanyaban élő magyar házaspár vagyunk. Itt egész évben szezon van, egész évben segítséget nyújtunk a Török Riviérára utazó turistáknak. Fő profilunk: fakultatív programok, egyéni utazások szervezése, lakások eladása-vétele, letelepedési ügyek intézése, cégalapítás. Élérhetőségeinket megtalálja a hirdetés alján! Telefonszámunk nem emelt díjas! Ha utazást, üzleti tevékenységet tervez, állunk rendelkezésére!


Feladva: 2015-11-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: syedrawww5mptorok534nyujtunkRobertszervezesetelsegitsegettoursrivieranutazasokcomvallaljukhomesfelegyenihomes@hotmailevbenElerhetosegeink

Forrás: pepitahirdeto.multiapro.com

Balatonlellén családi ház már 5 személytől max 16 főre kiadó. Családoknak ideális. Ingyenes wifi, biztonságos parkolás zárt udvarban. Ár megegyezés szerint.


Feladva: 2015-10-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: családiBalatonlellénkiadóházudvarbanzártparkolásBalatonlellebiztonságosJánoswifiSzabóIngyenesideálisCsaládoknakszerintfőremegegyezés

Forrás: pepitahirdeto.multiapro.com

Ablakredõny, reluxa, harmonikaajtó, roletta, szalagfüggöny, lehúzható,-elhúzható aluminium szúnyogháló, fix mûanyagkeretes üvegszálas szúnyogháló. Redõny felhúzógurtnik, redõnyautomaták, redõny alkatrészek azonnali cseréje. A szakmával összefüggõ munkák, javítások végzése szakszerûen, garanciával! Minden hónapban más termék akciós áron a készlet elejéig. Keresse honlapunkon az Akciós Árnyékolástechnikai Termékeket! Várjuk megrendelését.


Feladva: 2016-08-06    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 245redAkciós251szúnyoghálóanyagkeretestermékÁrnyékolásösszefüggmegrendelésétfixmásPerzsaszakmávalVárjukaluminiumhónapbanDebrecenbencseréjeáron

Forrás: pepitahirdeto.multiapro.com

Professzionális airbrush munkák, képek, grafikák laptopra, bukósisakra, gépkocsira, motorkerékpárra, falra, stb... akár hozott fotóról, vagy egyedi elképzelés alapján. Portré vagy házi kedvenc, esetleg fantáziaképről legyen szó, egyaránt megvalósítom.


Feladva: 2015-01-19    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: képekairbrushvagygrafikákszófotórólmunkáklegyenhozotthupontfantáziaképrőlakárgrafikakProfesszionálisesetlegstbairbrushkepekZoltánkedvencfalra

Forrás: pepitahirdeto.multiapro.com

Állami támogatás kihelyezésével foglalkozom és mindenféle hitel közvetítésével, valamint biztosításokkal. Ingyenes tanácsadás, igényfelméréssel egybekötve, hogy legalább az információ meglegyen, ami nélkül hozzuk meg sorra a rossz döntéseinket. Kiválasztjuk együtt a legjobb megoldást és elmondom mit hogyan kell csinálni ahhoz, hogy saját otthonod melegét érezd és a saját kertedet szépítsd. Kérjetek visszahívást tőlem itt: www.otthonteremtes-biztonsaggal.webnode.hu vagy itt: ... további részletek >>


Feladva: 2016-11-06    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: hogytámogatásÁllamitanácsadásIngyenesittsajátotthonteremtesegybekötvedöntéseinkethttpigényfelmérésselahhozrossztőlemcsinálniBudapestsorrakell

Forrás: pepitahirdeto.multiapro.com

A chiamag magas rost- és omega-3 zsírsav tartalommal rendelkezik. Természetes gyulladáscsökkentőként működik a szervezetben, ezzel elősegíti a szívbetegség és az elhízás megelőzését. A chia mag szuperélelmiszer, melynek fogyasztása előnyös az agy és az idegrendszer számára is. A kutatások megerősítették, hogy csökkenti a magas koleszterinszintet és a vérnyomást, javítja az agyi funkciókat, rendszeres fogyasztásával megelőzhető az időskori szellemi hanyatlás.


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: magchiachiamagmagascsökkentirendelkezikidőskorihogytartalommalmegelőzhetőmegerősítettékmegelőzésétzsírsavfogyasztásávalkutatásokelhízásomegaszámára

Forrás: pepitahirdeto.multiapro.com

Kitartó, lelkes embereket keresek Bio termékek katalógusból történő árusításához. A munka teljes mértékben otthon végezhető, és nagyon egyszerű, mivel AUTOMATIZÁLT WEBOLDAL segítségével történik, költség és kötelezettségmentesen. Gyes mellett, nyugdíj mellett, de akár munka mellett is, minimális időráfordítással növelheted a bevételed. MUNKATÁRSKÉNT stabil jövedelem lehetősége egy nemzetközi üzlet partnereként - Nincs felső korlát. Annyit kereshetsz, amennyit csak szeretnél. - Az EU ... további részletek >>

országaiban is nyitott a lehetőség! Válassz most BIO készítményeket a mesterséges szemét helyett! Nézd meg a KÍNÁLATOT: www.egeszsegbomba.mylifecare.hu 100% elégedettségi garancia! Regisztrációs és tagsági díj helyett ajándékokkal és folyamatos akciókkal várunk Téged: + AJÁNDÉK utalvány + AJÁNDÉK VIP hűségkártya + AJÁNDÉK katalógus + AJÁNDÉK magazin + AJÁNDÉK termék Hozd létre ingyenesen felhasználói Partner fiókodat és rakd kosárba meglepetéseinket! Ha kedvet érzel hozzá, és szívesen keresnél pénzt ilyen formában, akkor részletesen tájékozódhatsz a weboldalon. Jelentkezzél fel hírleveleinkre is! www.egeszsegbomba.mylifecare.hu A felmerülő kérdéseidre szívesen válaszolok az alábbi e-mail címen: szerencseneked@gmail.com


Feladva: 2016-11-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AJÁNDÉKmellettmunkahelyettszívesenBIOmylifecareegeszsegbombahttphírleveleinkreakciókkalnemzetközikeresekhozzámegcímenHozdszeretnélegyszerűfel

Forrás: pepitahirdeto.multiapro.com

Kútfúrást vállalok! Szigetszentmiklós, Szigethalom, Tököl,Halásztelek, Dunaharaszti, egész Csepel Szigeten és környékén,Délegyháza,Dunavarsány, Alsónémedi, Bugyi,Ócsa, Áporka, Kiskunlacháza, Apaj,Majosháza Budapesten és környékén,Érd, Göd,Sződ, Dunakeszi. ZÁRT ALJJAL. Minőségi szűrőkkel. A jó vízhozamú és homokmentes kút érdekében. KÉZZEL acélcsőben és helyszínen összeszerelt GÉPPEL.40mm-tõl-125mm-ig. Szivattyú telepítéssel is. SZAKMUNKA. Megfizethető árak, garanciával! Hívjon bizalommal


Feladva: 2016-05-31    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GÉPPELgaranciávalkútfúrásKÉZZELkörnyékénMinőségibizalommalKiskunlacházaHalásztelekALJJALáronHívjonÁporkaösszeszereltTökölZÁRTreálisÓcsahelyszínen

Forrás: pepitahirdeto.multiapro.com

1 órán belül ott vagyunk, nincs kiszállási díj! Hétvégén és ünnepnapon is hívhat bizalommal, nonstop! Kerti kút, szökőkút vagy akár medence bekötését is vállalunk. Megoldunk mindent: legyen az átfúrt vízcső, ázás, -csap, - mosdó vagy akár -kádcsere, vagy vizes blokk teljes generálja, hívjon bátran. Mindenre van megoldás!


Feladva: 2016-08-12    [Lakossági szolgáltatás]

Címkék, kulcsszavak: vagyakármosdószökőkútvagyunkMindenrecsapkútottbátranázásKertibelülhívjonvízcsőnonstopórángeneráljaátfúrtbizalommalBudapestteljeslegyen

Forrás: pepitahirdeto.multiapro.com

Munkatársat keresek. Egészségtudatos, kitartó, célorientált, magáért tenni akaró személyt keresek, számítógépes ismeret előnyt jelent, mivel profi online eszközökkel dolgozunk.


Feladva: 2017-09-18    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekMunkatársatproficélorientáltmivelkitartójelentEgészségtudatoselőnytismeretArankaszámítógépesszemélytdolgozunkakaróeszközökkeltennionline

Forrás: pepitahirdeto.multiapro.com

Sasszem Magánnyomozó és Tanácsadó Iroda Fontos Önnek az eredmény, a diszkréció, a gyorsaság és a precizitás? Ha igen, akkor válasszon minket magánnyomozói megbízása végrehajtására! Szolgáltatásaink: - Leplezett megfigyelés, követés - Hűtlenség bizonyítása, leleplezése - Eltűnt személyek, tárgyak felkutatása - Hűségteszt, hűségpróba - Adósságbehajtás - Cégen belüli (bűn)cselekmények felderítése - Számítástechnikai eszközök védelme - Környezettanulmány, személyek átvilágítása - ... további részletek >>

Információk, bizonyítékok beszerzése - Csapatépítés. Próbálja ki magát!


Feladva: 2017-05-22    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: SasszemszemélyekIrodaMagánnyomozóbizonyításabeszerzéseakkorbűnHűtlenségbizonyítékokigenbelüliajánlókövetésInformációkprecizitásCégenHirdetőPepita

Forrás: pepitahirdeto.multiapro.com

Számtalan pénzkeresési lehetőség van arra, hogy otthonról dolgozva jövedelmed legyen. A weboldalon megosztok veled néhány ötletet, lehetőséget ebben a témában. Bővebb információ a weboldalon: http://allasokotthon.uw.hu/


Feladva: 2016-07-18    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: weboldalonotthonrólvanötletetlehetőségnéhánypénzkeresésiveledSzámtalanallasokotthonmegosztokálláshttplegyenmunkaajánlatokjövedelmedvégezhetőBővebb

Forrás: pepitahirdeto.multiapro.com

Hogyan kaphat ajándékba egy olyan pénztermelő gépezetet, ami nulláról indulva, alig 29 nap alatt, képes volt 3.748 eurós jövedelmet generálni, miközben emberek tucatjainak tettük egészségesebbé az életét…


Feladva: 2017-08-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8230egészségesenvoltegyéletétvégreképesajándékbaegészségesebbéSzeretnealattkaphatsztettüknapHogyantucatjainakalig8220emberekindulvaJózsef

Forrás: pepitahirdeto.multiapro.com

Nemtudom szilva fa csemete, és magonc milotai10-es diófa csemete eladó. Alanynak és oltásra kiváló.


Feladva: 2017-02-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: csemeteeladóbajcsydiófamilotai10magoncszilvaNemtudomKérsemjénkiválóTótholtásraBarnabasalanynakut10

Forrás: pepitahirdeto.multiapro.com

A vesekő diéta segítségével megelőzhető a kövek kialakulása. Egy kis odafigyeléssel könnyen kivitelezhető, hogy kevesebb sót fogyasszunk, együnk több zöldséget, gyümölcsöt, csökkentsük a kávéfogyasztást. Ha már kialakult, a vesekő eltávolítása lehetséges akár otthoni módszerekkel is. Ehhez használhatunk vízhajtó teákat vagy speciálisan összeállított teakeveréket. A népi orvoslásnak az egyik leghatékonyabb gyógynövénye a vesekő tünetei ellen a nyírfalevél, melynek teája megakadályozza a kő ... további részletek >>

kialakulását, de a meglévő követ is képes elmorzsolni. Gyors és biztonságos beavatkozás az endoszkópos kőeltávolítás, mely után a beteg gyorsan felépül.


Feladva: 2017-03-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vesekőeltávolításakövetgyümölcsötleghatékonyabbkisbetegEhhezmeglévőzöldségetegyikEgyutánmódszerekkelkialakulásáttöbborvoslásnakkialakulásamely

Forrás: pepitahirdeto.multiapro.com

Becsületes, nemzetközi üzlet a legnagyobb, piacvezető céggel, a DXN-nel A legjobb minőségű kávé 100% tiszta Ganoderma kivonattal Profi weboldal 16 nyelven a regisztrációval: -minden szükséges tréninganyaggal és -üzletépítéshez szükséges eszközzel Páratlan marketing terv: -folyamatos bónusz felhalmozás, -nincs havonkénti nullázódás! Csatlakozz most: www.kavekiraly.hu/uzleti_lehetoseg


Feladva: 2016-03-03    [Pénzkeresés - MLM]

Címkék, kulcsszavak: Ganodermaüzletnemzetköziszükséges100kávéDXNlehetosegfolyamatosweboldalcéggeluzletitervProfipiacvezetőkavekiralymarketingkivonattallegnagyobbnel

Forrás: pepitahirdeto.multiapro.com

Legújabb digitális festékrétegmérő készülékünk az elmatronic F/NF HANDY. Nagyméretű LCD kijelzője könnyedén leolvasható, sőt a FLIP DISPLAY szolgáltatásnak köszönhetően az LCD kijelzőn megjelenő információk egy gombnyomással 180 fokban megfordíthatóak. Így a mérési eredmények minden esetben kényelmesen olvashatóak. Beépített mérőszonda, automatikus alapanyag felismeréssel. Gyors mérési sebesség, rendkívül egyszerű kalibrálás! 1 évgarancia! Magyar nyelvű használati útmutató! Áfás számla! ... további részletek >>

Szállítás raktárról azonnal! Ár: 49.000.-Ft Bruttó! Honlap: www.elmatronic.webnode.hu/products/elmatronic-f-nf-handy-digitalis-retegmero-keszulek


Feladva: 2017-02-26    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elmatronichandyLCDmérésifestékrétegmérődigitáliskeszulekdigitalisesetbenSzállításkijelzőnsebességkészülékünkmindenszámlaeredményekÁfásköszönhetően

Forrás: pepitahirdeto.multiapro.com

Legyen részese és társtuladonosa egy új közlekedési iparágnak... Hogyan? Regisztráljon ingyenesen, amivel 100 darab ingyenes részvényhez juthat. Csatlakozzon ön is a társtuladonosok közzé, aés megtudhatja, hogy lehet öné további részvények. Info és csatlakozás www.skywaycapital.hu


Feladva: 2017-07-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: részvényekrészvényheztárstuladonosatovábbiingyenesrészeseönédarabLegyenlehet100ZoltánhogyamiveljövedelemmegtudhatjaingyenesenKiegészítőaésközzé

Forrás: pepitahirdeto.multiapro.com

Problémás a matek? Tanulj a ”Rendhagyó matek” sorozat könyveiből! Szeretsz gondolkodni, logikai feladatokat megoldani? Rengeteg feladatot találsz megoldásokkal a ”Gondolkodj!” című könyvben. Esetleg a természetbe vágysz? Szívesen olvasnál túraleírást, érdekel a Kéktúra? Akkor olvasd el a ”69 nap alatt Magyarország körül” című kiadványt. A megadott honlapon valamennyi könyvbe bele is olvashatsz.


Feladva: 2015-10-21    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: 8221matekcíműEsetlegbeleSzeretsznapkönyvbenkönyvbekönyveibőlolvasdGondolkodjvalamennyisorozatAkkormegoldásokkalhonlaponKéktúratalálszmegadott

Forrás: pepitahirdeto.multiapro.com

Meg sem kell hirdetni a láthatatlansági versenyt, mert eszméletlen jó benne mindenki! Akadhatnak renitens weboldal készítők, bloggerek és hirdetők, akik nemet mondanak a láthatatlanságra, mert ŐK LÁTSZANI AKARNAK! Igazából őket szeretnénk kiszolgálni, hiszen csak ők szeretnének valamit, amit a többiek nem... Hogy miért van ez így, erről többet a Google oldalán többet is lehet olvasni, a címe: A spam elleni küzdelem - ... további részletek >>


Feladva: 2017-06-03    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: láthatatlanságigooglespammerttöbbetakikcomígykiszolgálniállunkhirdetőkvanhirdetniszeretnénkrendelkezésérebloggerekwwwmiértkellőketigényli

Forrás: pepitahirdeto.multiapro.com

Az arctisztítás új dimenziója Tiszta és ragyogó bőr elérése a ZEITGARD arctisztító segítségével. Az innovatív elektromos arctisztító kefe forradalmasítja a hagyományos arctisztítást. 10-szer hatékonyabban távolítja el a sminket és a szennyeződéseket anélkül, hogy a bőrt túlzottan igénybe venné. Szabadalmi oltalom alatt álló termék minden bőrtípusra! Fedezd fel a ZEITGARD-ot! Nézd meg a videót a honlapon!


Feladva: 2015-12-04    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: 8482MicroSilverarctisztítóelpusztítjasegítségévelkefeszálakbanfokontávolítjaműködikZEITGARDhigiéniamagashatékonyabbanvédőpajzskénteléréseEgyedülálló

Forrás: pepitahirdeto.multiapro.com

A megbízható méhpempő boltok közös jellemzője, hogy feldolgozás nélküli étrendkiegészítőket lehet tőlük vásárolni. Ez azt jelenti, hogy a többszörösen is ellenőrzött méhészeti termék semmilyen vegyi vagy fizikai eljáráson nem esik át, míg a fogyasztóhoz kerül. Eredeti, 100%-ban természetes formájában fogyasztható, ahogyan a méhek előállították! A megbízható méhpempő boltok kínálatában tehát a legjobb minőséget találja! Ezen webshopokat egy helyre gyűjtöttük össze, weboldalunkra kattintva ... további részletek >>

könnyedén válogathat termékkínálatukban! Valódi méhpempő rendelés, megbízható boltokból!


Feladva: 2017-08-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: megbízhatóméhpempőboltokbólrendeléshogyValódiboltokfogyasztóhozgyűjtöttükellenőrzöttelőállítottákjellemzőjemíghelyretöbbszörösenméhekközösesikegy

Forrás: pepitahirdeto.multiapro.com

Fix 10 000 Ft/nap áron kölcsönözhető platós, ponyvás teherautók Budapesten. 3,5 tonnás B-s jogosítvánnyal vezethető. KAUCIÓ VAN!


Feladva: 2017-03-30    [Autó - Motor - Jármű]

Címkék, kulcsszavak: áronfixbérlésteherautókTeherautóponyvásPlatóskölcsönözhetőVANnapKAUKCIÓ000vezethetőjogosítvánnyalBudapesttonnásChriscarBudapesten

Forrás: pepitahirdeto.multiapro.com

3 rétegű üveggel, 80 mm vastag, 6 légkamrás ablakok és ajtók, 2-4 héten belül legyártva a kívánt méretre. Beszerelést is szakszerűen kivitelezzük, 1994 óta nyílászárókkal foglalkozunk. Kizárólag német „A” osztályú minőség, 7 év teljes körű garanciával. Többféle műanyag, fa és alumínium nyílászárót forgalmazunk, biztosan megtalálja az Önnek megfelelőt. A legjobb nyílászáró árak nálunk vannak. Részletes árlisták: www.ablakajtoaruhaz.hu/hu/arlistak.html Rendelje meg most az ... további részletek >>

ablakait, a párkányt ajándékba adjuk minden 200.000.- Ft feletti rendeléshez Július 30-ig. A beépítést 6500.-/m2 áron végezzük. Nézzen körül weboldalunkon és a webáruházunkban: www.ablakajtoaruhaz.hu/hu/aruhaz/category/muanyag-ablak.html


Feladva: 2017-07-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: ablakajtoaruhazhttpshtmlablakáronmuanyagmostmegszakszerűenÖnneküveggelrendeléshezosztályúRendeljeBeszereléstmegtaláljarétegűfeletti8221arlistak

Forrás: pepitahirdeto.multiapro.com

Tectonic Tecto Pack Outdoor kültéri pingpong asztal hálóval, mely nem igényel fel és leszerelést. Egyszemélyes játéklehetőség biztosított! A Tectonic termékek gyártója az elsőosztályú asztalitenisz felszerelések gyártójaként ismert Cornilleau francia gyár. A termék lapjára 3 év garancia vonatkozik, a pingpong asztalra 2 év általános garancia vonatkozik. A Tectonic Tecto Outdoor asztal a márka belépőmodellje a kültéri asztalok között. A termék otthoni szabadidős pingpongozáshoz lett ... további részletek >>

kifejlesztve, könnyen kezelhető No1 minőségű termék. A gyár versenysportban szerzett tapasztalatait az otthoni felhasználásra szánt asztalok gyártási technológiájába átülteti, ennélfogva a pályavonalazás a 4 mm vastag melamine asztallap anyagába van beledolgozva, ezt követi a csillogásmentesítő fedőréteg. Az újító technológiának köszönhetően a pályavonalazás sem mechanikai behatások sem a nap szívó hatására nem fakul, nem károsodik. A Cornilleau kültéri asztalitenisz asztalok szinte egész évben tárolhatóak a szabadban, hóban, fagyban, napsütésben, a teljes mértékben korrózióálló szerkezetnek köszönhetően hosszú éveken át ellenáll az időjárás viszontagságainak. www.tacticsport.hu/termek/cornilleau-tectonic-tecto-outdoor-kulteri-ping-pong-asztal/1448/331


Feladva: 2017-07-15    [Sport - Kemping - Túra]

Címkék, kulcsszavak: kulteritectonicoutdoortectocornilleautermekasztalasztaloknempingpongsemköszönhetőenotthonipályavonalazásasztaliteniszgyárvonatkozikponggarancia

Forrás: pepitahirdeto.multiapro.com

Android mobilalkalmazás programozókat keresünk Debrecenbe, akik annyira elhivatottak a programozás iránt, hogy már zöldülnek #A4C739 kód szerint és növekszik a robot antennájuk. Ha még nem tartasz itt, akkor is jelentkezz, mert ki tudjuk mutatni jó úton haladsz-e a folyamatban. Elõny, ha már a Google Play-en is van fent app-od, amit magadtól, nem céges nyomásra készítettél. További információ a www.jobs.ozeki.hu/index.php?owpn=5 4 oldalon.


Feladva: 2016-06-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: márnemozekiAndroidKfttartasznyomásraprogramozás245fejlesztőoldalonmégcégeselhivatottakfolyamatbanowpnantennájukannyirahaladszphprobotakik

Forrás: pepitahirdeto.multiapro.com

Szeretettel várunk minden négylábú barátunkat! Egyszerre 3 kistestű és 1 nagytestű kutya gondozását, foglalkoztatását és elszállásolását tudjuk vállalni.


Feladva: 2017-09-23    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: vállalninégylábúCSIMAbarátunkatTANYAEgyszerreKutyapanziókistestűPepitanagytestűHirdetőkutyaajánlógondozásátVérteskethelyfoglalkoztatásátSzeretettel

Forrás: pepitahirdeto.multiapro.com

Rozsdamentes fazék 40 liter, Perfect Home 12740 Anyaga: rozsdamentes acél Mérete: átmérő 42 cm; szélessége füllel: 49 cm; magassága: 40 cm Űrtartalma: kb. 40 liter Súlya: 2,73 kg Használható: gáz-, elektromos-, kerámialapos tűzhelyen Tisztítása: Semleges folyékony mosogatószerrel mossa el. Kerülje a karcosodást okozó szerek és eszközök használatát! www.fullmarkt.hu/Rozsdamentes-faze k-40-liter-Perfect-Home-12740


Feladva: 2017-09-21    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: Rozsdamentesliterfazek12740HomePerfecthasználatáttűzhelyenMéreteeszközökkerámialaposacélszerekelektromosAnyagaokozógázajánlókarcosodástHirdető

Forrás: pepitahirdeto.multiapro.com

Szalonunkban a hajhosszabbítás, hajdúsítás gyakorlattal (1997), egyedi hajfelvarrással illetve csomózással, európai póthajjal készül. Hozott hajjal is pótolunk! Látogass el honlapunkra, Facebook-ra: facebook.com/hajhosszabbitas.hajdus itas


Feladva: 2017-01-02    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: facebookhajdúsításhajhosszabbításCsepelcomilletveSzépségszalonhajfelvarrássalCityhonlapunkraegyediLátogass1997pótolunkgyakorlattalhajjalHozottXXI

Forrás: pepitahirdeto.multiapro.com

A Magyar Vakok és Gyengénlátók Országos Szövetsége 90 éve áll a hazai látássérült emberek szolgálatában. Érdekvédelmi tevékenységeinkkel és sokszínű szolgáltatásainkkal próbálunk könnyebb és élhetőbb világot teremteni a vak emberek számára. Pontírásban, hanganyagban és elektronikus formában készült folyóirataink és könyveink egyedülállóan biztosítják számukra az információhoz jutást, kultúrát és a szórakozást. Tankönyvellátó csoportunk szerzi be és alakítja át látássérült tanulóink számára a ... további részletek >>

tananyagot. Segédeszközboltunkban az önálló életvitelt megkönnyítő termékekhez juthatnak hozzá a látássérült emberek. A Magyar Vakok és Gyengénlátók Országos Szövetsége szeretne köszönetet mondani mindazoknak, akik személyi jövedelemadójuk 1 %-ával támogatták szervezetünket, és bízunk jövőbeni támogatásukban is. „Az ember dolga, hogy embernek lenni érdem, Hogy bátor legyen az elrendeltetésben, Az elhullásban és a fölemelkedésben, És nem hihetünk másban, csak e küldetésben” (Juhász Ferenc)


Feladva: 2016-10-15    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: OrszágosGyengénlátókVakokMagyarembereklátássérültSzövetségeHogyszámáraszeretneformábanFerenclegyenmegkönnyítősokszínűbízunkszórakozástTámogassa

Forrás: pepitahirdeto.multiapro.com

Fellépéseket vállalunk szállodákban, éttermekben, sörözőkben, kávéházakban, fesztiválokon. A vendégek szolgálatában állunk minden szinten. Halk vacsorazene, háttérzene, vagy aláfestő zene. Táncolni vágyóknak: Rock & Roll, Cha Cha Cha, keringő, tangó, vidám hangulatos mulatósak. Bővebben: www.orfeusmelody-band.hu Tisztelettel várom a hívását!


Feladva: 2017-01-12    [Zene - Hangszer]

Címkék, kulcsszavak: ChabandorfeusmelodyaláfestőkávéházakbanhangulatosvagysörözőkbenvidámháttérzeneéttermekbentangóvacsorazeneszállodákbanhívásátkeringőHalkvállalunk

Forrás: pepitahirdeto.multiapro.com

Háromgenerációs, 266 m2 nettó alapterületű, 3 szintes, csodálatos panorámájú családi ház Solymár csendes, forgalommentes zsákutcájában eladó. 5 szoba + 34 m2-es nappali, 2 fürdőszoba + zuhanyozó + WC, 30 m2-es garázs, 2 erkély, 46 m2-es terasz + 1 külön bejáratú lakás (szoba, konyha, étkező, fürdőszoba, tároló). A telek 742 m2, termő gyümölcsfákkal. Irányár: 55 millió Ft


Feladva: 2015-09-28    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: fürdőszobaHáromgenerációsszobaSolymárházcsaládi411alapterületűeladó3138nettóétkezőzsákutcájában927266konyhaforgalommentesÉrdeklődnicsendesPéter

Forrás: pepitahirdeto.multiapro.com

FB like, G+, Retweet, Pin-ek, követők szerzést biztosítja ez a nemzetközi weboldal. Ingyenesen is, ha mások posztjait, oldalait megnézed, lájkolod, esetleg megosztod. A választás a Tiéd, amit nem akarsz, azt nem kell! Viszont ami Neked tetszett, vagy megosztottad, azért pontokat kapsz, amit a saját közösségi oldalad, posztod népszerűsítésére használhatsz. Azt is kiválaszthatod, hogy mely országokból érkezzenek a lájkolók, +1-et adók, követőid kizárólagosan! Sok magyar is van már ...


Feladva: 2016-03-14    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: AztlikeamitnemmagyarválasztásbiztosítjamegosztottadFacebookSokmegosztodhasználhatszszerzéstvagykizárólagosanesetlegnépszerűsítésérekövetőkposztod

Forrás: pepitahirdeto.multiapro.com

Munkásszállást keres? Országos adatbázisunkban megtalálhatja az Önnek megfelelőt! Megbízható, korrekt szállásszolgáltatóktól. Miért érné be kevesebbel? Minőségi szállásokat kínálunk munkásszállói árakon! Tiszta, komfortos, kulturált és olcsó szálláshelyeket kínálunk látogatóink számára. Az oldalon található országos adatbázis munkát vállalók számára biztosít lakhatási lehetőséget, de bázisként szolgálhat túrstaszállások kereséséhez is egyéb programokhoz, ideális, olcsó, igényes szállást ... további részletek >>

kereső turistáknak turistaszállásként. A legtöbb szállás kínálatában külön mosdó és televízió csatlakozási lehetőség, ingyenes WIFI található!


Feladva: 2016-10-17    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: olcsószámáraországostalálhatókínálunkMegbízhatómosdóTisztaIdeálismegfelelőtvállalókkülönárakonprogramokhozÖnnekmunkátkínálatábanmunkásszállóiWIFI

Forrás: pepitahirdeto.multiapro.com

Egy immunerősítő gyerekeknek nemcsak akkor hatékony, ha véd a fertőzésektől, hanem ha ahhoz is hozzájárul, hogy a kicsik egészségesen fejlődhessenek. A colostrum éppen ilyen. Immunerősítő gyerekeknek előtejből, melyben megtalálhatók az immunfaktorok, növekedési faktorok és tápanyagok is. A vizsgálatok szerint legalább 50 féle különböző folyamatot támogat az újszülött szervezetében, köztük a védekezőrendszer kiépítését is. A colostrum immunrendszer erősítő gyerekeknek, felnőtteknek, sportolóknak ... további részletek >>

egyformán áldásos hatásokat tartogat a megelőzésben és a teljesítmény fokozásában.


Feladva: 2017-05-02    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: gyerekeknekImmunerősítőcolostrumvizsgálatoktartogatfejlődhessenekvédekezőrendszernemcsaktápanyagokhatásokategészségesenköztükEgyfaktorokáldásoskicsik

Forrás: pepitahirdeto.multiapro.com

Online dogozol, de a sikerek nem úgy jönnek, ahogy szeretnéd? Vagy még csak most keresel online végezhető munkalehetőséget, ám kevésnek érzed a tudásod ehhez? Ha idő- és pénzveszteség nélkül, egy helyen szeretnél minden hasznos tudnivalót elsajátítani, várunk az Online Siker Klub tagjai közé! Részletekért kattints a honlapra!


Feladva: 2017-09-07    [Pénzkeresés - MLM]

Címkék, kulcsszavak: OnlinemégSikerHalmaipénzveszteségcsakNyárinéidőVagyvárunksuliehhezszeretnédelsajátítanitudásodonlinesikerklubahogytudnivalótérzedhttpjönnek

Forrás: pepitahirdeto.multiapro.com

Bécsi úti referenciaszalonba felelősségteljes, munkájára igényes lelkes és kreatív, a szakma iránt elkötelezett fodrász munkatársat keresünk! Ha érdekelnek a vegyszermentes csúcs technológiák, és a környezet tudatos anyagok, és szeretnéd a legjobbat ajánlani vendégeidnek, nálunk a helyed! Elérhetőség: 20/ 323-7254-s számon!


Feladva: 2017-05-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkanyagokirántBudapestszámontudatosszakmaGabriella7254környezetkreatívNovotni323technológiáklelkesFodrásztElérhetőségcsúcsigényeshelyed

Forrás: pepitahirdeto.multiapro.com

Kutyakozmetika, kutyakozmetikus. Szeretettel várjuk Önt és kedves kutyáját kozmetikánkban. Kedvence részese lehet az Ön igénye szerint egy fürdetésben és egy nyírásban. Telefonos időpont egyeztetéssel.


Feladva: 2015-08-25    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: XIIIegyKutyakozmetikakerületegyeztetésselrészesekutyájátidőpontKedvencekedvesTelefonoskozmetikánkbanönttartástalálhatóvárjukNyitvaalattnyírásban

Forrás: pepitahirdeto.multiapro.com

A máj méregtelenítés tünetei már rövid idő alatt megmutatkoznak. Egy néhány napos kúra elegendő ahhoz, hogy a szervezetben felhalmozódott káros anyagok nagy része távozzon. A máj méregtelenítés fokozatosan szabadít meg ezektől a toxinoktól és nemcsak a májat tisztítja meg, de a vastagbelet is alaposan kitakarítja. A gyümölcskúrák segítségével mind a májat, mind az epét regenerálhatjuk, ezzel a módszerrel megelőzhetünk, de a már fennálló betegségek kezelését is kiegészíthetjük. A már ... további részletek >>

méregtelenítés tünetei tapasztalhatók lesznek a májfunkciók, az anyagcsere és a vitalitás javulásában is.


Feladva: 2017-09-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: méregtelenítésmájmármegtüneteimindmájatszabadítkiegészíthetjükahhozsegítségévelKellérfokozatosankezelésételegendőgyümölcskúrákházilagjavulásában

Forrás: pepitahirdeto.multiapro.com

Nem tudja, hogy melyik lakástakarék szerződést válassza? Oldalunkon rengeteg hasznos információt megtalál. Kalkulátorunk segítségével megnézheti mekkora összeget kap. Kérje díjmentesen segítségünket, akár online. www.lakastakarekokosan.hu/blog/156 -melyik-lakastakarekot-valasszam Mire kell odafigyelni, mik lehetnek a buktatók? Ha érdeklődik, látogasson el honlapunkra, vagy kérjen díjmentes visszahívást.


Feladva: 2017-08-14    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: lakástakarékdíjmentesenrengeteglehetnekOkosanKérjeOldalunkonmikkapválasszaodafigyelniösszegetvisszahívástszerződéstkellmekkoradíjmentesMirekérjen

Forrás: pepitahirdeto.multiapro.com

SOFŐR állás FRANKFURT melletti 22 éves német cégnél. „C” jogosítvány, 95-ös bejegyzés és legalább 3 éves LKW-s (nagy kocsis) gyakorlat szükséges, némettudás NEM kell. Munkabér túlórákkal 1800€ nettó, szállás ingyenes. 0049 151 6656 6269 További infók és jelentkezés a www.nemetmunka.hu/sofor.html weboldalon.


Feladva: 2017-02-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: sofornémetFRANKFURTállásévesNEMweboldalunkon8221151némettudáshtml82220049szükségescégnélingyenesgyakorlatnemetmunkaszálláskocsiswwwmelletti

Forrás: pepitahirdeto.multiapro.com

Horvátország, Dalmácia, Zadari Riviéra. Budapesttől 630 km-re, 4 nemzeti park közelében, Zadartól 15 km-re északra Privlakán, közvetlenül a tengerparton 40.000 nm-en fenyőfák árnyékában helyezkedik el a Dalmacija Camp***Holiday Komplex, sekély, homokos, köves öböl szélén, jól kiépített stranddal, parti zuhanyozókkal. Itt minden megtalálható, élelmiszerbolt, zöldséges, pizzéria, bajor söröző, grillház, parti pub, étterem, gyerekjátszótér, szép, tiszta vizesblokkok, wifis pub, fagyizó. Itt ... további részletek >>

ajánlunk összközműves 4-6-8 fős, 2-3 szobás, nappali-konyhás, fürdő-wc-s, klímás, wifis, kábeltv-s mobil-home apartman házakat nagy terasszal, heti (heti 210 euro-tól) és telepített klímás, wifis, tv-s lakókocsikat (heti 30 e Ft-tól). 2007 óta várjuk érkező utasainkat. Áraink 10-20 %-al olcsóbbak a kemping árainál. Magyar iroda, programok, kölcsönző. Videó ajánlásaink: www.youtube.com/user/TravelVirServis


Feladva: 2017-04-13    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: hetiwifisHorvátországpartitólIttpubklímástisztaPrivlakánÁrainkmegtalálhatótelepítettkonyhásKomplexwwwszépészakrautasainkateuromindennappali

Forrás: pepitahirdeto.multiapro.com

Munkánkat telephelyünkön végezzük. Weboldalunkon minden információt megtalál rólunk!


Feladva: 2017-01-27    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: FalusimarásmegmunkáláscncvégezzüktelephelyünkönMunkánkatImre

Forrás: pepitahirdeto.multiapro.com

Kézzel horgolt babacipő, babaszandál, sapi, keresztelő babaszett. Rendelhető keresztelőre, babaszületésre, ünnepre, hétköznapra. Kiváló babaviselet. A babacipő szép és kényelmes. Pamut fonalból készül, természetes szellőzése miatt a baba lába jól mozog és nem izzad benne. Talphossza: 7-12 cm Méret és szín választható! Nézzen be weboldalamra, válogathat a szebbnél szebb babacipők és más horgolt baba termékek között.


Feladva: 2016-11-10    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: horgoltbabacipőbabababaszettkeresztelőbabaszandálszíntermészetesbabaszületésreMéretkészülkeresztelőreTalphosszafonalbólmásRendelhetőbennePamutnem

Forrás: pepitahirdeto.multiapro.com

A mosott kavics 16-32 ára bruttó 4200 Ft/m3. A folyami kavics 16-32 ára bruttó 4200 Ft/m3. A dunai kavics 16-32 ára bruttó 4200 Ft/m3. A dísz kavics ára bruttó 5842 Ft/m3. A gyöngy kavics ára bruttó 5842 Ft/m3. Az osztályozott kavics ára bruttó 5842 Ft/m3. A rostált kavics ára bruttó 5842 Ft/m3. A bánya kavics ára bruttó 3500 Ft/m3. A töltő kavics ára bruttó 3000 Ft/m3. A mosott dunai folyami kavics 24-40 kerti utak, parkok lefedésére, a rostált osztályozott dísz kavics 16-32 ... további részletek >>

lábazatok díszítéséhez, szikkasztóhoz, a gyöngy kavics 4-8 és a gyöngy kavics 8-16 parkok, játszóterek lefedésére, a bánya és a töltő kavics terület feltöltésre, szerelő beton alá használható. A mosott kavics, osztályozott kavics, dísz kavics, gyöngy kavics, kulé kavics, rostált kavics, töltő kavics kapcsán felmerülő kérdéseikre szívesen válaszolunk, e-mail címünk és telefonszámaink honlapunkon megtalálhatóak.


Feladva: 2016-10-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kavicsbruttóáragyöngydíszosztályozottmosott5842rostált4200töltőfolyamidunaikulébányalefedéséreparkokfeltöltésrehonlapunkonszállításterület

Forrás: pepitahirdeto.multiapro.com

Aprósütemények, teasütemények, linzersütemények rendelhetők, közvetlenül a gyártótól! Házias jellegű, kézzel gyártott, minőségi édesipari termékek, nagy választékban! Bővebb tájékoztatás, termékbemutatás, rendelés felvétel a honlapunkon elérhetők!


Feladva: 2015-11-09    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: rendelésHáziaswwwtermékekteasüteményekhttpédesipariAprósüteményekelérhetőkminőségiSütihonlapunkongyártottPatakifelvételkézzelAprósüteményjellegű

Forrás: pepitahirdeto.multiapro.com

ÜZLET AHOL SENKI NEM VESZÍTHET! SunMoney az első világot behálózó KÖZÖSSÉGI NAPERŐMŰ PROGRAM - Az üzletet építheted online is - Itt nincs havi kötelező befizetés - Itt nem terméket kell venni, hanem egy termelő eszközt vásárolunk


Feladva: 2016-09-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemIttsunmoneywebofficeSENKIegyonlinehttpsAHOLhanemépíthetedRegisztrációÜZLETvenniüzletetcomTiborkellPROGRAMsunmoneyonlineNaperőművedbotibi

Forrás: pepitahirdeto.multiapro.com

A Tiwian color mosópor csökkentett foszfáttartalmú mosószer minden típusú mosógéphez javasoljuk. A Tiwian color mosópor alkalmas 30, 40, 60, és 90 ° C-os mosáshoz is. Színvédő adalékot és vízlágyítót tartalmaz. Magas vastartalmú vízben is hatékonyan tisztít. A mosóvízben nagyon jól, maradék nélkül oldódó mosópor. A Tiwian color mosópor hazai környezetbarát mosószer. Gyártja a Cudy Future Kft. www.mososzerbolt.hu/id/00002_Tiwia n-color-mosopor-10-kg-vodros


Feladva: 2017-10-14    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: mosóporcolorTiwianmosószerKftFutureCudySzínvédőGyártjanagyonmosáshozmosóvízbenalkalmaskörnyezetbaráttisztítjavasoljukhazaihatékonyanmosógéphez

Forrás: pepitahirdeto.multiapro.com

A Lada Vesta stílusos, merész és ragyogó – pont, mint amilyennek egy új generációs Ladának lennie kell. A szedán sziluettje korszerű és harmonikus, az X forma egységként kíséri végig a karosszériát. Az új, bátor stílus könnyen felismerhető a részleteiben: a fekete színnel kiemelt radiátor borításban, a lenyomatokban az oldalakon, a hátsó fényszórók fényvisszaverőin. A megemelt öv vonalának, meghosszabbított motorháztetőnek illetve lejtős tetőnek köszönhetően a Vesta külsőre is sportos és ... további részletek >>

dinamikus. Egy ilyen autóval nehéz észrevétlennek maradni az utakon. Vesta. A LADA új arca. www.ladaszolnok.hu/vesta_sedan_ismerteto


Feladva: 2017-04-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: vestaLADAEgymeghosszabbítottmintsedanszínnelilyenformavonalánakpontfeketeharmonikusmegemelt8211ladaszolnokrészleteibendinamikuskorszerűragyogó

Forrás: pepitahirdeto.multiapro.com

Asztalos munkát, egyedi bútorok készítést, ajtó-ablakszigetelést, ablakfelújítást, mázolást, üvegezést, zár javítást vállalunk Pest megyében! Munkáink: - galériaépítés, beltéri tolóajtó készítés - gardrób szekrény gyártás, beépítés - lambériázás - szalagparkettázás - laminált burkolatok - zár javítás - egyedi bútorok készítése (konyha-, szoba-, irodabútorok) - nyílászárók gyártása, cseréje, mázolása, javítása és hőszigetelt üveg berakása - ajtó-, ablakszigetelés (hő-, por-, hang ... további részletek >>

ellen) A szigetelés svéd bemarásos technológiával, szilikon gumi felhasználásával történik. Előnyei: huzatmentesség, hőmérséklet emelkedés, porzárás. Bejárati beltéri-, kültéri ajtók javítása passzítása, pótlását, festése, záraik cseréje. Foglalkozunk műanyag ablakok (hagyományos nyíló-bukó és amerikai toló- és emelőpaneles), bejárati ajtók és erkélyajtók, beépítésével, cseréjével. Az ablakcsere utáni helyreállítást is vállaljuk, így Önnek nem kell külön kőműves szakembert megbíznia a régi ablakok bontása során - a falon - keletkezett sérülések javítása miatt. Rövid határidő, ingyenes kiszállás.


Feladva: 2017-02-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: javításaegyedibeltérizárablakokAsztalosajtókcseréjebejáratiajtóbútorokgumigardróbsoránhelyreállítástberakásaablakfelújítástbukóígyszilikonnem

Forrás: pepitahirdeto.multiapro.com

Sok szeretettel várunk mindenkit webáruházunkba! Azokat is, akik szeretik a bársonytalpúakat és azokat is, akik az irántuk rajongó barátaikat, vagy hozzátartozóikat szeretnék meglepni az itt található több száz Cickaság valamelyikével. Rugalmas ügyintézéssel igyekszünk a különleges kéréseknek is eleget tenni, valamint többféle fizetési és szállítási móddal tesszük a vásárlást még inkább egyénre szabottá. A Cickaságok köre folyamatosan változik majd a Te igényeid szerint, így várjuk a ... további részletek >>

véleményedet, illetve javaslatokat, amit direkt el is küldhetsz a honlapunkon, továbbá a hivatalos Facebook oldalunkon. (www.facebook.com/Cickasarok.hu)


Feladva: 2017-09-11    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: FacebookCickasarokakikazokatkéréseknekígymeglepnimégwebáruházunkbahivataloskülönlegesoldalunkonszerintszeretnékvásárlástmindenkittovábbáigyekszünk

Forrás: pepitahirdeto.multiapro.com

Partneriskolánk felkészít a sikeres érettségire, neked csak be kell járnod az esti órákra és tanulnod kell! Miért ezt a budapesti esti gimnáziumot válaszd? - Az érettségid megszerzését az állam támogatja, ezért havonta csak 7000 Ft-ba kerül - Ha már valamelyik gimnáziumban vagy szakközépben teljesítetted a 9-10. évfolyam követelményeit, vagy szakmunkás bizonyítvánnyal rendelkezel, akkor 2 tanév alatt megszerezheted az érettségi bizonyítványodat. - Célirányos képzés - csak azt tanítjuk, ... további részletek >>

amire szükséged van - Jól képzett tanári kar, professzionális oktatás - Érettségi megszerzése jó eredménnyel Budapesten - A jelentkezés nincs korhatárhoz kötve - Tanulóinknak ingyenes internet használatot biztosítunk Ne hagyd ki ezt az ajánlatot és jelentkezz a tanfolyamunkra: www.tanfolyamokj.hu/esti-erettsegi-budapesten-a-xi-keruletben


Feladva: 2017-08-15    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: erettsegiestibudapestencsakkeruletbenkellvagytanfolyamokjezteredménnyelkerültanítjukMiérthagydbizonyítvánnyalBudapestmegszerzése7000aztoktatás

Forrás: pepitahirdeto.multiapro.com

Buszvezető Németország 5 fő buszvezető (nyelvtudás nélkül) Demmelmair Lechhauser Str. 25 D-86316 Friedberg Tel: 0049-821-2628880 Dinamikusan terjeszkedő, németországi, bajor autóbuszos cégünk keres azonnali belépéssel, teljes munkaidőben helyközi személyszállításra és különjáratra 5 fő buszsofőrt Feltételeink: Lelkes, precíz munkavégzés, megbízhatóság, kulturált megjelenés. Német nyelvtudás előny, de nem feltétel. Lakáskeresésben és a hivatalos ügyek intézésében segítünk. ... további részletek >>

Szakmai fényképes önéletrajzát e-mailben várjuk: busfahrer0821@gmail.com vagy blasi@demmelmair-bus-reisen.de


Feladva: 2017-10-18    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: nyelvtudásnélkülNemetorszagBuszvezetobuszsofőrtmailbenbajorelőnyLechhauserkülönjáratraönéletrajzátnémetországiDemmelmairszemélyszállításrafényképesbus

Forrás: pepitahirdeto.multiapro.com

Hajsütővas, gőzállomás, waffelsütő, gofrisütő, melegszendvicssütő, porszívó, páraelszívó, fagyasztó, hűtő, szárítógép, mosógép, hősugárzó, olajradiátor, olajsütő, kenyérpirító. A tökéletes nászajándékok, karácsonyi ajándékok széles választéka! Személyes átvétel Budapesten. Link: www.stacioshop.hu Facebook: www.facebook.com/stacioshop Tel: 36704551969 E-mail: in fo@stacioshop.hu


Feladva: 2017-05-16    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: stacioshopfacebookwwwátvételhősugárzóinfo@stacioshopHajsütővasSzemélyesmosógépmailajánlóválasztékaszárítógép36704551969HirdetőszéleshűtőTelPepita

Forrás: pepitahirdeto.multiapro.com

Az igazi Mikulás - eredeti hófehér szakáll, bajusz, haj és szemöldök, méretre készült exkluzív jelmez, hatalmas vesszőfonatos aranyszínű puttony, pásztorbot - házhoz jön! 4 eredeti erdei manóval (a legmagasabb manó: Charlie 88 cm, a többiek Catie, Andy, és Alex kisebbek) minőségi méretre készült jelmezben, exkluzív rekvizitekkel... Mécseslámpások, mini tűzijáték, száncsengő, bot, nagykönyv, puttony, manósapka, manóbot... Mindez 15 percben. Továbbiak a honlapon!


Feladva: 2017-09-18    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: készültputtonyméretreeredetijönházhozMikulásigaziexkluzívmanóvalhajerdeinagykönyvbajuszminőségibotszakállkisebbekszáncsengőhófehérAlexAndy

Forrás: pepitahirdeto.multiapro.com

Akciós AEG, Electrolux, Zanussi háztartási gépek - raktárról azonnal, akár 5 év kiterjesztett garancia - egyedülálló videó termékbemutatók - ha nem tudsz eljönni, nézd meg és rendelj online - országos házhoz szállítással!


Feladva: 2017-09-21    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: háztartásiZanussiElectroluxAEGgépektudsznemtermékbemutatókszállítássalvideóházhozegyedülállóAkciósországosgaranciaajánlóonlinekiterjesztettakár

Forrás: pepitahirdeto.multiapro.com

Gyomaendrődön a Bonom-zugon közvetlen vízparti összkomfortos nyaraló 3 szoba 6-8 főre kiadó. Ágynemű biztosítva. Fedett stég, csónak van. Fogható Halak: Ponty, amur, harcsa, süllő, csuka, angolna, keszeg, kárász, busa, törpeharcsa. Pontytilalom nincs! Híres gyógyvízének köszönhetően a gyógyulást kereső és strandolni vágyók számára a Gyomaendrődi Liget Fürdő áll rendelkezésükre. Zárt bekerített telek, az udvarba három-négy autó beállhat.


Feladva: 2015-11-20    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: foghatószámáravágyókGyomaendrődönköszönhetőencsukarendelkezésükreÁgyneműKIKAPCSOLÓDNIgyógyvízéneksüllőállkiadóHORGÁSZNIHíresharcsaFürdőfőreÜDÜLNI

Forrás: pepitahirdeto.multiapro.com

Kreatív hobbi kis- és nagykereskedelem - Webáruház Kategóriák: Akciós kifutó termékek Bizsualkatrészek Csomagoló anyagok Díszíthető tárgyak Festékek lakkok ragasztók Fűző anyagok Gyöngyök Könyvek Kreatív alapanyagok Modellezés formaöntés Órakészítés Papíráru Szalvétatechnika Szerszámok eszközök Textilek szalagok Zsanérok csatok zárak csavarok


Feladva: 2017-09-21    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: WebáruházKreatívanyagokSzalvétatechnikaragasztókPapírárulakkoknagykereskedelemÓrakészítésFestékekcsavarokkisformaöntéstárgyakzárakhobbiModellezés

Forrás: pepitahirdeto.multiapro.com

Mind az 50 államban tudunk céget alapítani. Először kérjen időpontot egy ingyenes konzultációra amikor igényeihez mérve segítünk kiválasztani a legmegfelelőbb államot, hogy igazán sikeres legyen a nemzetközi vizeken. Budapesti irodánk hétfőtől péntekig várja meglévő és leendő ügyfeleinket a személyes találkozótól kezdve, az amerikai kontinensen található képviselők több nyelvű ügyintézéséig, a hét minden napján.


Feladva: 2014-08-16    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: amerikaiBudapestimérvekezdvetudunkvizekennapjánigényeiheztalálkozótólállambannemzetközimindenamikorszemélyesMindlegyenhétkonzultációraBUDAPEST

Forrás: pepitahirdeto.multiapro.com

Kedves Vendégek! Sok szeretettel várjuk Önöket a Büki Gyógyfürdő bejáratától 250 m-re található apartmanházainkban!


Feladva: 2016-08-17    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SzállásÖnöketvárjukszeretettelSokVendégekapartmanházainkbanKedvestalálhatóBükfürdő250ApartmanbejáratátólMolnárGyógyfürdőBükfürdőnBüki

Forrás: pepitahirdeto.multiapro.com

Parabola antenna szerelés, közösségi antennák, karbantartás és átalakítás, MinDig TV DVB-T Földi digitális antenna, UPC Direct, forgatható parabola antennák szerelése, kábel TV lakáson belüli javítása, elosztása és a jelszint szakszerű erősítése. Elöregedett, tönkrement, nem használt régi tetőantennák, árbocok lebontása. Meglévő antenna házhálózatok javítása, fejlesztése.


Feladva: 2017-05-22    [Lakossági szolgáltatás]

Címkék, kulcsszavak: antennaBerkesSZERVÍzantennákparabolajavítása2912222szerelőLászlóárbócokbelüliDVBtetőantennáklakásonMinDigBudapestrégiKábelátalakításLaszlo

Forrás: pepitahirdeto.multiapro.com

Trump megnyittatja a Kennedy-gyilkosság titkos aktáit A rejtély, hogy Oswald volt-e a gyilkos, és ha igen, magányos elkövető volt-e, vagy egy szélesebb összeesküvés része, a mai napig nem oldódott meg. Itt olvashatsz róla: www.goo.gl/FCQvko Itt, pedig tovább kereshetsz (Google keresőnk): www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60546


Feladva: 2017-10-27    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: KennedygyilkosságvoltIttwwwFCQvkopageOswaldmaipedig60546napigtovábbPepitagyilkosnemkereshetszHirdetőigenoldódottGoogleajánlásmagányos

Forrás: pepitahirdeto.multiapro.com

Fogyni szeretnél? Hogyan tudnál a leghatékonyabban lefogyni úgy, hogy a kilók ne kússzanak vissza? A weboldalon megismerheted azokat a technikákat, amelyek segítenek a fogyást akadályozó lelki okok megszüntetésre. Bízom abban, hogy Te is könnyen megtalálhatod azt, ami segíthet végre beindítani a fogyást. A lelki okok megszüntetésére és a stressz oldására nagyon egyszerű módszereket találsz. www.blog.topponleszel.com/fogyokur a-2


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: okoklelkifogyásthogyakadályozóamitechnikákatnagyonHogyanaztazokatoldásáraszeretnélmegtalálhatodmegismerhetedstresszFogynikönnyenfogyokuraTréner

Forrás: pepitahirdeto.multiapro.com

A fogyókúrák ideje alatt szigorú diétát kell betartani. Korlátozottan fogyaszthatók a gabonafélék, a fehérliszt, a cukor, a zsírok fogyasztása még kis mértékben is keresztbe húzhatja terveinket. A természetes fogyókúrák segítségével biztonságosan szabadulhatunk meg a felesleges kilóktól, sok gyógynövényt felhasználhatunk a méregtelenítéshez, az anyagcsere serkentéséhez, zsírégetéshez. Ha ránk törne a nassolási vágy, igyunk jó sok vizet vagy egy csésze borsmenta teát, ami kitűnő éhségűző. A jól ... további részletek >>

megtervezett, egészséges fogyókúrák mindenkinek segítenek minőségibb életet élni.


Feladva: 2016-11-10    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogyókúráksokmegKellérzsírégetéshezsegíteneksegítségévelgabonafélékcsészeházilagserkentéséhezmindenkinektermészetesfogyaszthatókegyFogyókúravagyjól

Forrás: pepitahirdeto.multiapro.com

Budapest első fogyatékossággal élő emberek által alapított kávézója. A kávézóban dolgozó csapat nagyon színes és nagy szeretettel vár minden látogatót. Egy pár szó rólunk: www.nemadomfelkavezo.hu/rolunk.php


Feladva: 2016-10-06    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: nagyfogyatékossággalszíneselsőnagyonBudapestcsapatStevedolgozókávézókávézóbanfelkávézójaadomlátogatótalapítottNemmindenáltalváremberekélő

Forrás: pepitahirdeto.multiapro.com

Tuti Turi Ptc Kiegészítő jövedelemre van szükséged? Gyere és dolgozz velünk! 2017. Magyarország egyetlen PTC oldala! Ami ingyen is elkezdhető, és csinálható! Napi kereset változó! Jutalék rendszer és más egyéb lehetőségek! Csak rajtad múlik, hogy mennyit akarsz keresni! Az első 2000 Tag, ajándék tagságban részesül! Link... http://tutituriptc.xyz/?ref=ijoco< /a>


Feladva: 2017-05-20    [
Pénzkeresés - MLM]

Címkék, kulcsszavak: PTColdalaijocoegyetlenMagyarország2017ajándékvanlehetőségekAmiTagjövedelemreegyéb2000KiegészítőmáselsőTurirendszerrefkeresniTutiJutalék

Forrás: pepitahirdeto.multiapro.com

Eddig az MLM-ben az új emberek látták el pénzzel a már meglévő hálózatot. Nálunk ez most megfordul, az MLM történetében először: a már bent lévő, kereső emberek segítik meg az újonnan érkezőket!!! Sőt arra sem kérlek hogy abba amit már elkezdtél. Érdekel hogyan? Nézd végig a 8 perces videót és csatlakozz pénzügyi kockázat nélkül! www.youtube.com/watch?time_continu e=6&v=1t-isPFBqLA


Feladva: 2017-10-04    [Pénzkeresés - MLM]

Címkék, kulcsszavak: máremberekMLMhogyanKONCEPCIÓérkezőketmegfordulwwwÉrdekelÜZLETIújonnanmosthttpselkezdtélLEHETŐSÉGmegNálunknélkülsegítikkockázathálózatotamit

Forrás: pepitahirdeto.multiapro.com

Minőségi, bontatlan bálás használtruha, számos fajtáit kínáljuk, értékesítés céljából, különböző kategóriákba sorolva. Friss gyűjtésű, szezonális, minőségi import, gyerek használtruha, felnőtt használt ruha, használt munkásruha, és lakástextil, valamint ágynemű. Nyers bálásruha, és válogatott, zsákos kiszerelések! Érintetlen, eredeti csomagolások! Nagykereskedelmi árak, magánszemélyek részére is! Ingyenes házhoz szállítás országosan. Tel: 0670-579-1452 (Viber is!) Web: ... további részletek >>


Feladva: 2017-02-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: használtruhaminőségibáláshasználtimportNagykereskedelmibontatlanlakástextil1452FrisscsomagolásokGyulamunkásruha579sorolvaeredetiangol0670ruha

Forrás: pepitahirdeto.multiapro.com

Logisztikai és szállítási munkára keresünk Munkatársakat Németországba akár AZONNALI kezdéssel BRUTTO 8,91 EURO / ora kezdō fizetéssel Amit kinalunk: -europai szintu fizetes BRUTTO 8,91 EURO / ora + 1,7 EURO NETTO ejszakai potlek orankent -a szallas a ceg altal biztositva lesz -a bejelentes minden esetben Nemetorszagban a kinti jogviszonyoknak megfeleloen fog megtortenni Amit elvarunk: -MINIMUM tarsalgasi szintu angol vagy nemet nyelvtudas -erkolcsi bizonyitvany (postan vagy ... további részletek >>

ugyfelkapun keresztul ingyenesen kikerheto) -terhelhetoseg Regisztráljon ingyenesen a www.nrgkulfoldimunka.hu oldalon es mi felvesszük Önnel a kapcsolatot, vagy hívjon bizalommal az alábbi telefonszámokon: +3670/627-5010 +3670/908-5010


Feladva: 2017-10-24    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: EUROvagy3670szállításiLogisztikaiingyenesenszintuoraBRUTTOAmit5010bizonyitvanyeuropai908fogmunkáraoldaloncegerkolcsikinalunkmegfeleloen627

Forrás: pepitahirdeto.multiapro.com

Ki az ön kedvenc STAR WARS szereplője? A jókhoz húz a szíve, mint Luke Skywalker, Anakin Skywalker, Obi-Wan Kenobi, Yoda, Han Solo, Leia Organa, Padmé Amidala, Jar Jar Binks, Csubakka, Qui-Gon Jinn, Poe Dameron, Finn (FN-2187) vagy Ray? Netán a droidokat - R2-D2, C-3Po és BB-8 - szereti? Esetleg a sötét oldalon álló Darth Wader, Kylo Ren, Darth Maul, Palpatine alias Darth Sidious, Dooku gróf / Darth Tyrannus, Grievous tábornok, vagy Jabba a kedvenc hőse? Böngésszen termékeink között, és találja ... további részletek >>

meg az Önnek vagy Star Wars rajongó családtagjának, barátjának leginkább megfelelő ajándékot. Csillagok háborúja - Star Wars Shop www.starwars.boltaneten.hu


Feladva: 2017-01-18    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: WarsStarDarthvagykedvencJarSkywalkerWebshopBinksstarwarsMaulObicsaládtagjánakNetánJabbahttpRenrajongóRaytábornokAmidalaShopKyloAnakin

Forrás: pepitahirdeto.multiapro.com

Állást keres? Vizsgázik? A táblázatkezelés, az adatbázis-kezelés egyáltalán nem nehéz! Meg fogja látni, mennyire egyszerű az Excel, az Access, vagy a Word, a PowerPoint. Milyen szép dolgokat lehet Corel vagy Flash segítségével létrehozni. Egyszerűen, gyorsan megérthető. Forduljon hozzám! Tapasztalataim szerint az egyéni foglalkozás előnye, hogy kevesebb idő alatt, hatékonyabban lehet elsajátítani az új ismereteket, mivel csak Önre figyelek, mindennel csak addig foglalkozunk, ameddig ... további részletek >>

Ön igényli, nem kell senkihez sem igazodnia. Fontos előny az is, hogy nincs ”kihagyott” óra. Csoportban, ha Ön nem ér rá, nem tud az órára eljönni, a csoport halad tovább, Így Önnek, ha a lépést tartani akarja, pótolnia kell a kimaradt óra anyagát. Szívesen tanítok csoportokat is, ebben is hosszú múltra tekinthetek vissza.


Feladva: 2016-07-21    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nemtáblázatkezeléshogyóravagykelllehet8221kezelésadatbázisEgyszerűencsakkevesebbtovábblétrehoznimindennelExcelanyagátelőnyeVizsgázikhalad

Forrás: pepitahirdeto.multiapro.com

Hidraulika importőr cégünk megvételre hirdet: Hidraulika szivattyú, hidraulika pumpa, hidraulika fogaskerék szivattyú, hidraulika axial szivattyú, hidraulika szelep, hidraulika vezérlő, hidraulika útváltó, hidraulika tömb, hidraulika ágyú, hidraulika tőke, hidraulika henger, hidraulika munkahenger, hidraulika teleszkóp, hidraulika billentő henger, hidraulika


Feladva: 2017-10-17    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: hidraulikaszivattyúhengermegvételreágyúcégünktömbimportőrútváltóNagytarcsavezérlőPaszkalszelepPhilippaxialbillentőfogaskerékteleszkóppumpatőke

Forrás: pepitahirdeto.multiapro.com

A lakásfelújítás stressz mentes lebonyolításáért hívjon minket, bontástól a kulcsátadásig, nálunk minden egy kézben.


Feladva: 2017-03-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: lakásfelújításkulcsátadásigBudapestenbontástólminkethívjonlebonyolításáértmentesstresszkézbenegyBudapestmindenÁdámnálunkHomenszki

Forrás: pepitahirdeto.multiapro.com

Tama RHYTHM MATE széria: 9 rétegű 7.5 mm fóliázott nyárfa testek. Méretek: 22”x16” Lábdob 10”x7” Tam 12”x8” Tam 16”x15” Állótam 14”x5” Pergõ Állványzat: Lábcitányér Állvány Lábgép Pergõ Állvány Gémes Állvány Egyenes Állvány Dobszék + 3 darabos MEINL BCS cintányér készlet 14” Lábcintányér 16” Beütő cintányér 20” Ride cintányér Színek: WH (White) BK (Black) RDS (Red Stream) GXS ... további részletek >>

(Galaxy Silver) CCM (Charcoal Mist) WR (Wine Red) Hardware szín: Króm www.hofferhangszer.hu/termekek/tama/tama-dobfelszereles/tama-rhythm-mate-rm52kh6c-szett


Feladva: 2017-07-14    [Zene - Hangszer]

Címkék, kulcsszavak: 8221tamaÁllványmaterhythmcintányérszettrm52kh6cRedTam245PergMEINLÁllótamHardwareSopronBlackdarabosx15ajánlóWhiteDobszékWineHirdetőx16

Forrás: pepitahirdeto.multiapro.com

Érettségizzen Ebesen, a Báthori István Gimnáziumban! Kiváló tanári kar, diákigazolvány, családi pótlék, minimális díj, előzetes tanulmányok beszámítása, ingyenes tankönyvek, jó közlekedés! Indult Vámospércsen is, ne hagyja ki!


Feladva: 2016-11-12    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: IstvánBáthoriminimálisÉrettségizzenhagyjapótlékEbesVámospércsencsaládiGimnáziumIndultdiákigazolványfelnőtteknekközlekedéskarÉrettségitankönyvekdíj

Forrás: pepitahirdeto.multiapro.com

Vízálló, csúszásmentes meleg burkolatok, fahatású, kőhatású, szövött és minimál design padlók széles választéka. Click és Loose-Lay padlórendszerek. Az anyag rugalmassága miatt minden helységbe alkalmas, akár falra, pultra, bútor homlokzatra is rögzíthető. Mikrofózolt élekkel, sima, előkészített burkolaton egy 1-3mm-es ragasztóágyba helyezve, gyorsan, kosz-és zajmentesen lerakható, padlófűtéshez is! A különböző termékcsaládjainkat és a színválasztékot megtalálja a www.magicfloor.hu oldalon!


Feladva: 2017-03-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: magicfloorburkolatokVízállókoszszövöttrögzíthetőVinyloldalonanyaggyorsankőhatásúhomlokzatraLuxuspadlórendszerekhelyezvefahatásúbútorwwwLayLoose

Forrás: pepitahirdeto.multiapro.com

LAPRA SZERELT IKEA - KIKA - RETZ BÚTOROK ÖSSZEÁLLÍTÁSA 06209884170. Háztartási gépek bekötése, lakásfelszerelési tárgyak felfúrása beton és tégla falra. Egyedi karnis, előszobafogas, gardrób gyártás, meglévő bútorok otthoni javítása.


Feladva: 2016-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: IKEASZERELTbútorokLAPRAEgyediÖSSZEÁLLÍTÁSAfalraRETZtéglaKIKAjavításabetonotthonifelfúrásatárgyakmeglévőlakásfelszerelésiBudapestgyártásbekötése

Forrás: pepitahirdeto.multiapro.com

Lakásunk dekorálására rengeteg lehetőség áll rendelkezésünkre a különböző bútorok, berendezési tárgyak, függönyök, textíliák és növények mellett a falmatricák és dekor matricák is remek lehetőséget nyújthatnak ahhoz, hogy teljes mértékig személyre szabjuk otthonunkat. Számos lehetőség közül választhatunk, ha a falmatricák alkalmazása mellett döntünk. A különböző nonfiguratív, állatokat vagy képeket ábrázoló dekor matricáktól kezdve, az egész falat beterítő képekig bármi lehetséges ezzel a ... további részletek >>

felettébb egyszerű módszerrel. A falmatricák hatalmas előnye továbbá, hogy felhelyezésük nem igényel szaktudást és gyorsan elvégezhető, valamit hogy kedvünk szerint kombinálhatjuk őket, ha valami még egyedibbre vágyunk. A színesebbnél-színesebb virágminták, sorminták, egyedi nonfiguratív és állatokat ábrázoló falmatricák csak arra várnak, hogy kiéld velük kreativitásod otthonod falain! Vásárolj nálunk különböző dekor matricákat, és teremts olyan hangulatot lakásodban melyre mindig is vágytál!


Feladva: 2016-10-08    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falmatricák