0.57 húsüzembe - MultiApro.com hirdetések - Ingyen apróhirdetés, egyszerűen több apróhirdető oldalra
Nincs találat .... Nézze meg kiemelt hirdétéseinket.

húsüzembe

Mesefigurás gyerekágyak leesésgátlóval jó minőségben, jó áron! Ez az ifjúsági ágy gyermekének is garantáltan tetszeni fog, mert kinézetre pont olyan, amilyet szeretne. Szép, mutatós kidolgozású gyerekágy lekerekített élekkel, jó minőségben. A körbetámlás gyerekágy biztonságos és balesetmentes, mert nem esik le a gyerek. Kényelmes és könnyen összeszerelhető gyerekagyak csak nálunk. A gyerekbútor webáruház többféle forma és színválasztékában biztosan megtalálja a megfelelőt! Válasszon!


Feladva: 2015-11-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: gyerekágymertárongyerekágyakMesefigurásminőségbentöbbféleágynemSzépwebáruházifjúságiszeretnegyerekbútorbalesetmentesamilyetnálunkleesésgátlóval

Forrás: pepitahirdeto.multiapro.com

A fogszabályozás kiváló lehetőséget jelent Önnek fogai megszépítésére. Jöjjön el rendelőnkbe és ismerje meg a személyre szabott lehetőségeit egy térítésmentes konzultáció keretében. A konzultációra a +36 30 853 1903 -as számon tud jelentkezni.


Feladva: 2017-02-24    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogszabályozásfogszabalyozascentrumegylehetőségethttplehetőségeitkiválójelentkezniszemélyreszabotttudmegBudapestszámonismerjeBudán1903rendelőnkbe

Forrás: pepitahirdeto.multiapro.com

Olyan kereskedelmi szakmát akarsz tanulni, amivel könnyedén indíthatsz egy saját vállalkozást? Szeretnél online reklámozással is foglalkozni és szívesen tanulnál a különféle marketing eszközökről? Eladó szakképesítéssel rendelkezel és szeretnéd fejleszteni a tudásodat? Jelentkezz Budapesten induló Boltvezető OKJ-s tanfolyamunkra! A tanfolyam árát részletekben is fizetheted. A Boltvezető tanfolyam rövid időtartalommal fut, így néhány hónap alatt már a kezedben lehet az OKJ-s bizonyítvány. A ... további részletek >>

tanfolyamhoz szükséges szakmai előképzettség: 34 341 01 Eladó szakképesítés. Ha bármi kérdésed lenne vagy érdeklődni szeretnél, kattints a weboldalunkra és töltsd ki az egyik űrlapot: www.tanfolyamokj.hu/boltvezeto-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: tanfolyamokjboltvezetobudapestentanfolyamokjEladószeretnéllehetindíthatszrészletekbenmarketingkérdésedkezedbenkönnyedénáráthttpsbármikülönfélemár

Forrás: pepitahirdeto.multiapro.com

A budapesti Széll Kálmán téren kerestek munkát azok, akik nevére, mint kiderült, egy bűnbanda cseh cégeit íratták. A bűnszövetség irányítói előzetes letartóztatásban vannak. A teljes cikk: www.promenad.hu/cikk/munkat-kereso k-adataival-eltek-vissza-183564


Feladva: 2017-11-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: munkátkeresokcikkvisszaeltekadataivalbűnszövetségírattákkerestekmunkatcégeittérencsehKálmánpromenadbűnbandaSzéllwwwegybudapestiteljesvannak

Forrás: pepitahirdeto.multiapro.com

Pest megyéből taxi transzferek igen kedvezően Liszt Ferenc (Ferihegy) reptérre. Aktuális ajánlatokért telefonáljon (06 70 2387924), látogassa meg honlapunkat.


Feladva: 2015-06-02    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: taxiFerencLisztlátogassatranszferek2387924telefonáljonmegyébőlajánlatokértPestAktuálishathazireptérreajánlatokFerihegytranszferreptérihonlapunkat

Forrás: pepitahirdeto.multiapro.com

Összkomfortos 3 szobás ház eladó! Nagy kerttel és melléképülettel rendelkezik.


Feladva: 2017-08-15    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: OldigeszrendelkezikKépírónémelléképülettelmesszekerttelnincsNagyBalatonhozeladóházszobásÖsszkomfortosSzentgáloskérIbolya

Forrás: pepitahirdeto.multiapro.com

PD Generál Kft Bontásban az első! Gépi földmunkát vállalunk, főképpen Baranyában, de nagyobb volumenű munka miatt az országba bárhova képesek vagyunk elmenni. Az ár mennyiségtől - időtartamtól és helytől függ. Hívjon minket bizalommal, biztosan meg egyezünk!


Feladva: 2016-10-12    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GépiegyezünkföldmunkavagyunkföldmunkátmegbontásképesekbiztosanbárhovaelsőbizalommalországbaBontásbanminketmiattKftHívjonmunkaGenerálfügg

Forrás: pepitahirdeto.multiapro.com

Számtalan pénzkeresési lehetőség van arra, hogy otthonról dolgozva jövedelmed legyen. A weboldalon megosztok veled néhány ötletet, lehetőséget ebben a témában. Bővebb információ a weboldalon: http://allasokotthon.uw.hu/


Feladva: 2016-07-18    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: weboldalonotthonrólvanötletetlehetőségnéhánypénzkeresésiveledSzámtalanallasokotthonmegosztokálláshttplegyenmunkaajánlatokjövedelmedvégezhetőBővebb

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Olcsó, kiadó, azonnal beköltözhető albérletetet keresünk sürgősen!!! 2 felnőtt és 1 gyermek részére lenne... Kaució max. 1 hónap legyen! Lakáspályázat is érdekel! Tel.: 30/883-5695 E-mail: voti 75@citromail.


Feladva: 2017-08-18    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: OlcsókeresünkbeköltözhetőhónapazonnalmaxkiadóKaucióvoti75@citromaillenneBudapestmailrészéreAndrás5695gyermekalbérletet883felnőttTelsürgősen

Forrás: pepitahirdeto.multiapro.com

Mikulás Házhoz rendelhető 20 000.-tól! Krampusszal vagy Manóval vagy Hótündérrel még rendelhetők! Gyermekműsor , szülinapra , varázslóval, bohóccal egész évben! Információ :702364755


Feladva: 2017-11-06    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: MikulásvagyrendelhetőHázhozGyermekműsorrendelhetőkpaulmégHótündérrel702364755InformációManóvalévbenKrampusszalegésztólbohóccal000varázslóval

Forrás: pepitahirdeto.multiapro.com

A bárányhimlő felnőttkorban súlyos szövődményeket okozhat, terhes nőkre nézve pedig különösen veszélyes, mert maradandó károsodást okozhat a magzatnak. A bárányhimlő lefolyása után a szervezet immunis lesz a vírusra, így aki egyszer már elkapta, többet nem fog szenvedni a betegségtől. Főként a téli és a tavaszi hónapokban terjed, lappangási ideje 2-3 hét, ezután jelentkeznek a bőrön a piros pöttyök. Mit tegyünk bárányhimlő ellen? Bárányhimlő ellen sokféle gyógymód létezik, általában csak a ... további részletek >>

tüneteket kell kezelni, azaz a viszketést csillapítani, mert az elvakart hólyagok heget hagyhatnak maguk után.


Feladva: 2016-10-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BárányhimlőutánmertellenokozhatterjedfelnőttkorbanazazmártegyünkkárosodásthónapokbanKittikezelniegyszerMitmaradandótavasziKellérkellakitéli

Forrás: pepitahirdeto.multiapro.com

Érzékelőtípus: Exmor CMOS Kijelző mérete: 2,7 ” Kijelző felbontása: 230000 képpont Kijelző típusa: Kihajtható, dönthető Képstabilizátor: Optikai Zoom: 27x Digitális zoom: 320x Támogatott memóriakártya típusok: Memory Stick Micro (M2) MicroSD MicroSDHC MicroSDXC Beépített vaku: Nem Állványmenet: Igen Videó módok: 1920x1080 Állóképfelbontás: 2,1 MP Beépített mikrofon: Sztereó Fejhallgató kimenet: Nem AV kimenet: Igen Fő szín: Fekete


Feladva: 2016-12-08    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: KijelzőIgenkimenetzoomNemBeépített1920x1080ajánlótípusokFeketetípusamódokHirdetőmemóriakártyaszínVideóPepitaTámogatottképpontÁllványmenet320x

Forrás: pepitahirdeto.multiapro.com

Tel: 06 20 2374592 gazm ester@agl.hu Ne engedje hogy a rágcsálók megzavarják Budapesti otthona nyugalmát! Rágcsálóirtásnál fokozott figyelmet fordítunk arra hogy illetéktelenek valamint a haszonállatok ne férjenek Budapesten hozzá a rágcsálóknak szánt irtószerhez. Hogyan veheti igénybe budapesti rágcsálóirtási szolgáltatásunkat?


Feladva: 2017-10-21    [Lakossági szolgáltatás]

Címkék, kulcsszavak: budapestihogyfigyelmetrágcsaloirtórágcsálóknakfokozottegérirtáshozzáRágcsálóirtásnálpatkányirtásBudapestennyugalmátszolgáltatásunkatRágcsálóirtásférjenek

Forrás: pepitahirdeto.multiapro.com

Eladó bazalt, andezit kockakő új és bontott állapotban. 10x10, 20x20-as méretekben. 4500 Ft/m2 ártól. Érdeklődni telefonon lehet: 06705887417


Feladva: 2017-05-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kockakőBazaltEladólászlóméretekben20x2010x10állapotbanbontott06705887417lehetAndezittelefononÉrdeklődniártólBudapest4500ft

Forrás: pepitahirdeto.multiapro.com

Esküvőre, családi rendezvényre, céges összejövetelre, felvonulásokra, koszorúzásra csak minket hívjon! Emelje rendezvénye fényét a Pomázi Tűzoltózenekarral!


Feladva: 2017-09-27    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: PomáziTűzoltózenekarkoszorúzásrafelvonulásokraösszejövetelreTűzoltózenekarralcégesrendezvényrefényétcsaládirendezvényeEsküvőreEmeljeajánlóhívjonHirdető

Forrás: pepitahirdeto.multiapro.com

Nyugodt természeti környezetben, 2 szintes családi házban 4x4 ágyas szobák kiadók. Minimum 3 éjszakára vagy többre kiadó. A vendégházat egy időben csak egy családnak, illetve társaságnak kiadó. A szállás, legalább három éjszakára és minimum 10 fő részére foglalható. Maximum 16 fő, családoknak és baráti köröknek ideális. Minden szobában TV, WIFI. Konyha és fürdőszoba közös használatú. Nagy, parkosított udvar, ahol bográcsozni- nyársalni lehet. Parkolás zárt udvaron. Felnőtt: 2700 Ft/fő/éj + ... további részletek >>

IFA 280 Ft/fő/éj Gyerek: 0-17 éves korig 2700 Ft/fő/éj Fűtési szezonban minimum 3 éjszakára és minimum 10 főnek kiadó a vendégház. Fűtési szezonban Felnőtt: 4700 Ft/fő/éj +IFA 280 Ft/fő/éj Fűtési Szezonban Gyerek: 4700 Ft/fő/éj Eger 18 km-re, Mezőkövesd 12 km-re van Bogácshoz. Lehetőségek: Gyógyvizes strandolás, horgászás, túrázás, este a pincesori borozók, amikben hajnalig lehet szórakozni. OTP, MKB, K&H Szép kártya elfogadó hely. Érkezés: 14 órától Távozás: 10 óráig. A vendégházban lakik a tulajdonos is. www.fpvendeghaz.fw.hu piroska60@freemail.hu 06303756031 Egész évben szeretettel várom vendégeimet!


Feladva: 2017-06-07    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: minimuméjszakáraSzezonbanFűtésikiadóFarkas4700FtGyerek2700Ftegy280FtIFAFelnőttlehetBogácsvendégházPiroskaMezőkövesdMindenEgészÉrkezésfőnek

Forrás: pepitahirdeto.multiapro.com

A noni termékek A-, B-, C- és E-vitaminokat, nátriumot, magnéziumot, káliumot, vasat és sok antioxidánst tartalmaznak. Minden korosztály számára fontos tápanyagok ezek, melyekhez a gyümölcsből természetes formában juthatunk hozzá. A noni ital sokféle hatását nemcsak a polinéz törzsi gyógyítók tapasztalatai alapján ismerjük, de ma már a tudományos alapokon végzett vizsgálatok eredményei is sokat mondanak ennek a gyümölcsnek az előnyeiről. Több mint 100 bioaktív hatóanyagával már a sejtektől ... további részletek >>

segíti egészségünk megőrzését, immunerősítő és gyulladásgátló hatással is rendelkezik. Noni rendelés webshopunkban!


Feladva: 2017-07-26    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Nonimárgyógyítókjuicegyümölcsbőlsegítimondanakvasattörzsimelyekhezsejtektőlsokatkáliumotpolinézwebshopunkbanezekeredményeimagnéziumotnemcsak100

Forrás: pepitahirdeto.multiapro.com

Személyre szabott gyógynövény teák tanácsadással. Minőségi szálas teák, gyógynövényes teakeverékek, tearendelés a termelőtől! Rigó teák Vegyszermentes kistermelés, gyűjtés, gondos válogatás. Íz-illat-harmónia.


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teákgyógynövényszálasMinőségiVegyszermentesszabottSzemélyreRigóteakeverékektanulóillatgyógynövényesIstvánválogatásgondosgyűjtéstanácsadássalEger

Forrás: pepitahirdeto.multiapro.com

A NAGISZ Zrt. Intenzív sertés koncentrátumainak és szemes terményeknek meghatározott arányú keverésével a kis- és közepes gazdaságokban tartott sertések egészséges és gazdaságos felnevelésére alkalmas teljes értékű takarmányok készíthetők. Az Intenzív sertés koncentrátumok kiváló alapanyagai, magas fehérje- és energia tartalma miatt alacsony fajlagos takarmány felhasználás melletti gyors növekedést biztosítanak. ... további részletek >>


Feladva: 2016-10-10    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: IntenzivSertessuldokomarimanterményeknekbiztosítanakfehérjegazdaságoskoncentratumszemesnövekedéstmagasegészségeshizogyorskoncentrátumainakalapanyagai

Forrás: pepitahirdeto.multiapro.com

ANTENNA SZERVÍz 06 30 222 2912 Parabola antenna szerelés, közösségi antennák, karbantartás és átalakítás, MinDig tv DVB-T Földi digitális antenna, Upc Direct , forgatható parabola antennák szerelése, Kábel tv lakáson belüli javítása, elosztása, és a jelszint szakszerű erősítése, Elöregedett vagy tönkrement, nem használt régi tetőantennák, árbócok lebontása. Meglévő antenna házhálózatok javítása, fejlesztése.


Feladva: 2017-10-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: antennaparabolaszerelésantennákjavításaUpcnemjavításszerelésefejlesztésekarbantartástönkrementközösségivagyházhálózatokElöregedettforgatható2912

Forrás: pepitahirdeto.multiapro.com

A szállás Zalakaroson a kilátónál nyugodt, csendes helyen található, a fürdőtől kb. 1300 m-re. A házban két, külön bejáratú apartman van. Az egyikben 4+2, a másikban 2+2 fő elszállásolására van lehetőség. Mindkettőhöz teljesen felszerelt konyha tartozik. A nagyobb apartmanban két fürdőszoba van. Az autóknak zárt udvarban parkolás biztosított. Szórakozási lehetőség: csocsó, darts, lengőteke, grill, bogrács, WiFi, 100 m-re a szállástól étkezési lehetőség. További információk a honlapon.


Feladva: 2016-12-28    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: lehetőségvankilátónálkétapartmanZalakarosonfürdőszobaegyikbenlengőtekehonlapondartsapartmanbanbejáratúinformációkcsocsószállásnagyobbkülönTovábbi

Forrás: pepitahirdeto.multiapro.com

VATTACUKOR ÁRUSÍTÁS MEGRENDELÉSE RENDEZVÉNYEKRE! Az új édesség „Fairy Floss” magyarul annyit tesz: TÜNDÉRPEHELY. Gyermek-napok, koncertek, falu-, városnapok, családi napok, rendezvények rendszeres, megbízható résztvevői vagyunk! Manapság egy rendezvény már nem is képzelhető el vattacukor nélkül! Árainkat megegyezés szerint alakítjuk! Gépeink az összes élelmiszer higiéniai követelménynek megfelelnek! Számlaképesen várunk minden megrendelést, ahol arra szükség van.


Feladva: 2017-05-04    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: vattacukorRENDEZVÉNYEKREMEGRENDELÉSEÁRUSÍTÁSnapokmárszükségvárosnapokösszes8222rendezvényarrafaluGépeinkédességegyaholkoncertekalakítjukGyermek

Forrás: pepitahirdeto.multiapro.com

Középiskolai magyar nyelv és irodalom szakos középiskolai tanár vállal korrepetálást, pótvizsgára, érettségire való felkészítést Zuglóban (városligettől, Zugló vasútállomástól pár percre). Házhoz is megy.


Feladva: 2017-06-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: középiskolainyelvfelkészítéstmagyarvalóBudapestérettségireLászlómegypótvizsgáraKrasznahorkaiházhozkorrepetálástMagyartanításpercrevállalpártanár

Forrás: pepitahirdeto.multiapro.com

Webáruházunkból a kiszállítás 1-2 munkanap. A termék rövid leírása: - kötött - 95 % poliészter - 5% elasztán - Nincs méretezve S/M kis L méretre ajánlott (36-38 kis 40) A termék készleten: www.adryfashion.hu/Bezs-fekete-cir tas-atlapolt-noi-tunika-kotott


Feladva: 2017-09-28    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: feketeBézskisterméktunikakötöttnőicirtásNincsméretezvekiszállításméretreWebáruházunkbólmunkanapajánlottajánláskészletenHirdetőrövidwwwPepita

Forrás: pepitahirdeto.multiapro.com

Szolgáltatások / akár azonnali kiszállítás: -Páncélszekrények, lemezszekrények, irodatechnikai eszközök számítógép-konfigurációk szállítása -Selejtezés, lomtalanítás -Építőanyag szállítás -Épületen, lakáson belüli átrendezés -Zongora, pianínó, valamint egyéb súlyos, nagy kiterjedésű hangszerek szállítása -Szoba vagy konyha bútorát -Lapra szerelt bútorait, Valamelyik háztartási gépét, Kerti bútorait -Irodák költöztetése -Múzeumi tárgyak biztonságos szállítása -Pénztárcabarát ... további részletek >>

szállítási árak -Tehertaxi olcsón: fix szállítási ár felárak nélkül Plató mérete: 420x220 Zárt Dobozos!3,5 tonnás alatti szállításra alkalmas! Rakodó/Rakodók: Biztosítva! Nyíregyházi Telephellyel! Szolgáltatási Terület: Magyarország egész területén! Szállítási idő: 0-24h Szombat/Vasárnap is! Hívjon bizalommal! Tóth Attila +36-30/945-2252


Feladva: 2016-12-06    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: szállításaSzállításibútoraitAttilaTehertaxiTóthTerületháztartásiakárDobozossúlyosbizalommalPénztárcabarátlomtalanításSzolgáltatásiValamelyikZárt24h

Forrás: pepitahirdeto.multiapro.com

SOFŐR állás FRANKFURT melletti 22 éves német cégnél. „C” jogosítvány, 95-ös bejegyzés és legalább 3 éves LKW-s (nagy kocsis) gyakorlat szükséges, némettudás NEM kell. Munkabér túlórákkal 1800€ nettó, szállás ingyenes. 0049 151 6656 6269 További infók és jelentkezés a www.nemetmunka.hu/sofor.html weboldalon.


Feladva: 2017-02-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: sofornémetFRANKFURTállásévesNEMweboldalunkon8221151némettudáshtml82220049szükségescégnélingyenesgyakorlatnemetmunkaszálláskocsiswwwmelletti

Forrás: pepitahirdeto.multiapro.com

A bio gránátalma segít legyőzni a baktériumokat, gombákat, vírusokat, miközben erős antioxidánsaival fiatalon tartja a szervezetet. Szabadgyökfogó képesség tekintetében túltesz a zöld teán és az áfonya levén is! A gránátalma a legbőségesebb ellagsav forrás, aminek óriási szerepe van a rák megelőzésében. Antikarcinogén hatású, ahogyan azt számos vizsgálattal bizonyították az elmúlt években. Az immunerősítés gránátalmával igen hatékonyan megoldható, hiszen legalább 3 féle antioxidáns, rengeteg ... további részletek >>

vitamin és rost található benne, ezeknek pedig mind szerepük van a védekezőképesség működésében. Bio gránátalma vásárlás itt!


Feladva: 2017-03-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: gránátalmaBiovanvásárlásantioxidánsképességbizonyítottáklegyőzniaminekféleSzabadgyökfogóvizsgálattalsegítszerepükforráslegalábbszervezetetszámos

Forrás: pepitahirdeto.multiapro.com

Nem érzed magad biztonságban? Úgy érzed veszélyben van az életed? Van megoldás!!! Egy különleges harcművészet. A leghatékonyabb önvédelmi technikák. Az alapok 6 hónap alatt elsajátíthatóak. A támadó erejét használd fel a győzelemhez! - Önvédelmi tanácsok - Utcai szituációk kezelése - Jogtalan támadások elhárítása - Pszichikai felkészítés Ne legyél áldozat!


Feladva: 2017-09-26    [Sport - Kemping - Túra]

Címkék, kulcsszavak: BajaÖnvédelmiVanönvédelemérzederejétmegoldástámadásokNemtámadó06304670677JogtalanBajánelsajátíthatóakInfoválságindulkezelésealattvégéighónap

Forrás: pepitahirdeto.multiapro.com

Személyesen szeretném bemutatni a következő, megbízható és német precizitással gyártott ALOE VERA termékeket: Sminkek, Babaápolási termékek, Parfümök, Vitaminok, Ivógélek, Hajkondicionálók, Terhességi csík elhalványító krémek és sok minden más hasonlót! Pécsi helyszínen várlak előzetes egyeztetés után tájékoztató .ahol minden terméket kipróbálhatsz, tesztelhetsz saját magad teljesen INGYEN! Ha kérdéseid lennének, keress bátran az alábbi elérhetőségeken!


Feladva: 2016-12-27    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: VERAALOEmindenlennénektermékekettájékoztatóPécselhalványítókérdéseidutánÉvacsíkINGYENegyeztetésPétermannTerhességiteljesengyártottelőzetesmagad

Forrás: pepitahirdeto.multiapro.com

Több mint ezer féle divatékszer és kiegészítő, mobil és táblagép kiegészítő, kozmetikai cikkek, ásványok, csillámtetoválás, pénztárca, tetoválás, óra, piercing és még sok minden más a lehető legjobb árakon. Rengeteg állandó és aktuális, egymással összevonható kedvezmény! Törzsvásárlói program és ingyenes kiszállítás! Ez mind és még sok minden más a LILI BIZSU Webáruházban. Ilyen olcsón még nem vásárolt....


Feladva: 2017-02-18    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: mégsokkiegészítőBIZSULILImásmindenlegolcsóbbanRengetegvásároltkozmetikaimindkiegészítőkárakonnemkiszállításÉkszereklegjobbtáblagépingyenesóra

Forrás: pepitahirdeto.multiapro.com

A SkyWatcher 70/500-as lencsés távcsövét kis méretének, könnyű súlyának köszönhetően egyszerűen magunkkal vihetjük családi kirándulásaink alkalmával. Városoktól távol, sötét égen igen kitűnő mély-eges távcső: hatalmas látómezejébe sziporkázó nyílt halmazok sokasága vagy a kiterjedt, sejtelmes csillagközi ködök is beleférnek. De a távcső nappal sem hagyja unatkozni: jól használható spektívként a környező táj megfigyelésére. Az alaptartozék zenittükör egyenes állású, de jobb-bal irányban ... további részletek >>

megcserélt képet ad. A csomagban 25 mm-es, valamint 10 mm-es Super Bárium okulárokat találunk, melyek 20x és 50x-es nagyítást adnak. Spektívként alkalmazva 8-24 mm zoom okulárt javaslunk, mely a 21x-62x nagyítástartományt fedi le. Még nagyobb nagyítások elérésére egyszerű 2x-es Barlow lencse is a csomagban található. Az AZ-2 mechanika egyszerűen használható, ideális természetfigyelésre. Az okulártálcára számos kiegészítőt helyezhetünk, akár az észlelőteánkat is. A kihúzható alumíniumláb pedig testmagasságunkhoz igazítható. www.tavcso-mikroszkop.hu/termek/skywatcher-70-500-az2-refraktor


Feladva: 2017-07-01    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: skywatchertávcsőSpektívkénthasználhatóegyszerűen500csomagbanmelyködökPepitaigazíthatózoomSuperegestermészetfigyelésremegfigyeléséremagunkkalkitűnő

Forrás: pepitahirdeto.multiapro.com

A Fordított Ozmózis víztisztító berendezés a mosogató alá szerelhető, kis helyigényű. Közvetlen a hideg víz csapjához csatlakoztatjuk a többlépcsős szűrőberendezést. A beszerelése különös szakmai tudást nem igényel, a használati utasításokon leírtak alapján egyszerűen elvégezhető. A víztisztító berendezés csak a szabvány ivóvíz, a vízművek által kibocsájtott víz tisztítására alkalmas. A nem a vízhálózaton keresztül folyó szennyezett származású víz tisztítása nem végezhető el!


Feladva: 2015-06-25    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: víztisztítónemvízszakmaifolyókisberendezésszűrőrendszerkülönöskeresztülszerelhetőbeszerelésevízhálózatonaláelvégezhetőkszűrőberendezéstalkalmasBéla

Forrás: pepitahirdeto.multiapro.com

Az általunk ajánlott technológiával 2 fős személyzettel, egyetlen gépjárművel elvégezhető az aszfaltburkolat javítás, bontási munkálatok nélkül. Ami még fontosabb: a javítás költsége akár 40%-al is kevesebb lehet ezzel a módszerrel, valamint a létrejövő hő-kötés miatt lényegesen tartósabb megoldást nyújt. Végül, de nem utolsó sorban a helyszínen újrahasznosítjuk az összes jelenlévő anyagot, ezáltal hulladékelszállításra sincs szükség. Mi minőséget nyújtunk! Keressen bizalommal!


Feladva: 2014-02-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: télenjavításújrahasznosítjukegyetlenkötésnyújtunkméghelyszínenszemélyzettellétrejövőminőségetamisorbanfősvalamintIlletveutolsótechnológiávalnem

Forrás: pepitahirdeto.multiapro.com

Bontott kisméretű tégla 75 Ft/db Országos kiszállítás! www.bontott-tegla.co.hu


Feladva: 2016-09-12    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: teglabontottkisméretű75FtÉrdKöveswwwkiszállításOrszágos

Forrás: pepitahirdeto.multiapro.com

Nálunk megtalálod álmaid ruháját, vagy kedvenc nadrágodat.. Netán a varrogatáshoz nélkülözhetetlen cipzárat és gumit. Éjjel-nappal nyitva vagyunk, de azért ne telefonálj, csak illendő időben... E-mailt viszont bármikor küldhetsz: in fo@ionixdivat.hu Nézd meg - válaszd ki - rendeld meg - vedd fel!!


Feladva: 2016-04-24    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: megvagymegtalálodviszontcsinosgumitNálunkmailtEgycipzáratfelWEBÁRUHÁZidőbennélkülözhetetlenveddDIVATillendővarrogatáshozIONIXcsaknetánazért

Forrás: pepitahirdeto.multiapro.com

Jégkása készítés, jégkásagép bérlés, rendelhető rendezvényre. Amikor szükség van a Gulliver élménypark egy jó választás velünk népszerűsítse rendezvényét, családi napra, céges rendezvényre lehető legjobb minőségi szolgáltatást nyújtunk.


Feladva: 2016-10-05    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: bérlésjégkásagéprendezvényrekészítésJégkásalegjobbélményparklehetőGullivervancégesszükségnapraAmikorcsaládirendelhetőrendezvényétnépszerűsítseegy

Forrás: pepitahirdeto.multiapro.com

3 rétegű üveggel, 80 mm vastag, 6 légkamrás ablakok és ajtók, 2-4 héten belül legyártva a kívánt méretre. Beszerelést is szakszerűen kivitelezzük, 1994 óta nyílászárókkal foglalkozunk. Kizárólag német „A” osztályú minőség, 7 év teljes körű garanciával. Többféle műanyag, fa és alumínium nyílászárót forgalmazunk, biztosan megtalálja az Önnek megfelelőt. A legjobb nyílászáró árak nálunk vannak. Részletes árlisták: www.ablakajtoaruhaz.hu/hu/arlistak.html Rendelje meg most az ... további részletek >>

ablakait, a párkányt ajándékba adjuk minden 200.000.- Ft feletti rendeléshez Július 30-ig. A beépítést 6500.-/m2 áron végezzük. Nézzen körül weboldalunkon és a webáruházunkban: www.ablakajtoaruhaz.hu/hu/aruhaz/category/muanyag-ablak.html


Feladva: 2017-07-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: ablakajtoaruhazhttpshtmlablakáronmuanyagmostmegszakszerűenÖnneküveggelrendeléshezosztályúRendeljeBeszereléstmegtaláljarétegűfeletti8221arlistak

Forrás: pepitahirdeto.multiapro.com

Szakdolgozatok, házi dolgozatok, bemutatók megírását, tételek kidolgozását, kérdőívek összeállítását és megszerkesztését és egyéb szövegek legépelését vállaljuk. Természetesen formai követelményeknek megfelelően. Gyorsan, olcsón és nem utolsó sorban megbízhatóan dolgozunk! Bővebb részletekért nézd meg a honlapunkat! Ár megegyezés szerint, kérjen árajánlatot üzenetben!


Feladva: 2015-11-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: háziírásszakdogamegirasa@gmailkidolgozásátBővebbkövetkezőTermészetesenamelyettételekdolgozunkhogyvállaljukszerintmegírásátmegbízhatóanÉrtesítjükegyéb

Forrás: pepitahirdeto.multiapro.com

Japánológiával és fordítással foglalkozó, számlaképes fiatalember vagyok. Versenyképes áron: japánul, angolul, magyarul, bármilyen párosításban vállalok fordítást, amelyet a legkörültekintőbb professzionális alapossággal készítek el. Kérés esetén küldöm az általam biztosított szolgáltatásokhoz kötött árakat. Amennyiben felkeltettem érdeklődét, kérem jelezzenek vissza a elérhetőségeim egyikén. Érdeklődni: Soós Kálmán Mobil: +36 20 984-0472


Feladva: 2016-04-27    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: KálmánSoósfordítástvállalokbármilyenjelezzenekJapánológiávaleseténmagyarulkéremangolKérés0472angolulérdeklődétJapánkészítek984japánulMobil

Forrás: pepitahirdeto.multiapro.com

A máj tisztítás csak egészséges felnőtteknek ajánlott, mivel igen igénybe veszi a szervezetet. Azok, akiknek fizikai és lelki állapotuk is megfelelő ahhoz, hogy belevágjanak a kúrába, rengeteg előnyét fogják tapasztalni. A májtisztító kúra hatékonysága megmutatkozik az emésztés javulásában, az allergiás tünetek enyhítésében, az energiaszint növekedésében. Sok egészségi problémán segíthetünk ezzel a természetes módszerrel, hiszen a toxikus anyagok a szervezetben számtalan betegségnek adnak kiváló ... további részletek >>

táptalajt. A máj méregtelenítés, azaz máj tisztítás otthon, egyszerű hozzávalókkal is elvégezhető.


Feladva: 2017-03-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: májtisztításhatékonyságakúramájtisztítófogjáktoxikusakiknekenyhítésébenKittielőnyéthiszenAzoktünetekKellérazazrengetegmódszerrelszervezetethogy

Forrás: pepitahirdeto.multiapro.com

Régen le kellett állnom a kávézással. Magas volt a vérnyomásom és volt, hogy megszédültem, nagyon dobogott a szívem. Nem tudtam élvezni az előnyeit. 3 éve viszont megkóstoltam egy nagyon finom gyógynövény tartalmú kávét. Prémium minőségű brazil Arabica kávéból készül, amihez 100% tiszta organikus Ganoderma gyógygomba kivonatot kevernek. Azóta számos problémám megszűnt, köztük a magas vérnyomás is. Éhgyomorra is iszom egyből reggel, mert lúgosít, nem marja a gyomrom. Nem ver tőle őrült ... további részletek >>

módon a szívem, szépen beszabályozza a vérnyomásom. Szépen szinten tart, nincs túlpörgés és később hirtelen levertség. Naponta megiszom kb 5-öt, amikor jól esik, már csak az íze miatt is. :) Rólam itt olvashatsz: www.kavekiraly.hu/az_en_tortenetem DXN termékek: www.kavekiraly.hu/termekek Egy jó kis videó a pecsétviasz gombáról: www.kavekiraly.hu/ganoderma


Feladva: 2016-12-26    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: NemvérnyomásomszívemEgymagastermekekkavekiralyvolthttpnagyonSzépengombárólbrazilittegybőlelőnyeitlevertségkivonatotGergelypecsétviaszmódon

Forrás: pepitahirdeto.multiapro.com

Tisztítást igényel valamilyen felületen, de nem tudja, hogy mivel végezze el? Kérdezzen, segítünk. Speciális tisztítószerekkel állunk rendelkezésére. Tisztítószer és mosószer közvetlenül a magyar gyártótól, termelői és viszonteladói áron. Kérjen termékismertetőt! Érdeklődni: 06-30-8531179


Feladva: 2014-02-17    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: miveltudjanemrendelkezésérefelületentermékismertetőtállunkvalamilyenKérjentisztítószerekkeligényeláronSpeciálisTisztítástviszonteladóisegítünkker

Forrás: pepitahirdeto.multiapro.com

Fenomenális tisztítási alkalmazás lehetősége: www.smalteam.com/autlanding.php?re ff=Robi78&lang=hu


Feladva: 2017-07-22    [Vegyes hirdetések]

Címkék, kulcsszavak: Robi78FenomenálisreffRóbertphpLantosautlandingautóracomtisztítássmalteamnélküliwwwVízhttplehetőségealkalmazáslangtisztítási

Forrás: pepitahirdeto.multiapro.com

KINEZIOLÓGIA, A TEST KEZELÉSE, A LÉLEK GYÓGYÍTÁSA Egészségmegőrző, gyógyulást elősegítő energetikai kezelés. Segítő beszélgetés - testünk üzenetei, betegségek lelki okai. Stresszoldás. Belső gyógyító energiánk aktiválása. Energia blokkok oldása. Önismeret, készség és képességfejlesztés. Életmód tanácsadás. Családterápia. Bach virágterápia. Budapestről és vonzáskörzetéből várom vendégeimet, telefonon előre egyeztetett időpontokban: 06-30/637-2022


Feladva: 2013-11-10    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: virágterápiaKINEZIOLÓGIABachCsaládterápiaStresszoldásEnergiabeszélgetésaktiválása2022Segítőkerenergiánk637kezelésBudapestgyógyítóidőpontokbanBelső

Forrás: pepitahirdeto.multiapro.com

Motormentés, motorszállítás. Budapest területén átalánydíj 6000.- Budapesten kívül 6000.- + Budapest határától, Budapest határáig 100.-/km.


Feladva: 2017-08-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BudapestMotormentés6000határátólkívülBudapestenátalánydíjterületénmotorszállítás100határáig

Forrás: pepitahirdeto.multiapro.com

Klíma javítás, klímatelepítés - akár hűtésre, akár fűtésre -, karbantartás (gázzal feltöltés, gombátlanítás, fertőtlenítés), áthelyezés garanciával!!! Klíma telepítés 4m csőhosszig nettó 43.000 Ft! Minőségi klímakészülékeink: Panasonic, Nord, Samsung, Midea, Fisher, Fujitsu, Daikin


Feladva: 2015-04-01    [Lakossági szolgáltatás]

Címkék, kulcsszavak: klimaakárgaranciávalKlímaszerelés000wwwnettóDaikincsőhosszighűtésreFujitsutelepítésklímatelepítésFisherjavításMideaáthelyezéstólSamsungNord

Forrás: pepitahirdeto.multiapro.com

Ha egy teljesen legálisan működő, most induló osztrák céggel szívesen dolgoznál együtt - ahol az összes tulajdonost más üzletekből régebb óta személyesen ismerünk -, akkor nincs mire várnod, itt a hét minden egyes napja pénzgyártásról szól!


Feladva: 2017-09-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: együttRomanoczkiakkordolgoználszólFerencismerünkszívesenpénzgyártásrólPénzgyártásszemélyesencéggelnapjaótaosztrákegyesrégebbindulómindenmost

Forrás: pepitahirdeto.multiapro.com

Kedves Látogató! Holecskó János vagyok, a HJ-Graphics Studio vezetője. Fő tevékenységek: portré, figura rajz és festés, grafikai tervezés, dekorációs falfestés – art&design. Több mint 16 éve rajzolok, festek, foglalkozom elektronikus grafikával, végzettségem szerint keramikus vagyok. Remélem, hogy munkáim elnyerik tetszését. Ha valóban művészi szintű ajándékkal akar kedveskedni szeretteinek, vagy csak vágyik egy szép rajzolt emlékre, keressen bizalommal. Tekintse meg munkáimat!


Feladva: 2015-02-20    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: dekorációsJánosHolecskóvagyokportréfalfestésegytetszésétfoglalkozomvágyiktervezéselnyerikfestekcsakgrafikaimunkáimLátogatómunkáimatrajzolokvagy

Forrás: pepitahirdeto.multiapro.com

Nyugtató-lazító hatás: a test átmelegszik, könnyeddé válik az idegek kisimulnak az izmok ellazulnak az idegrendszer megnyugszik a vér- és nyirokkeringés megélénkül javul a sejtek oxigén- és tápanyagellátása salak- és méreganyagok kiválasztása hormonális hatás (érintésre a szervezet endorfin és oxitocin hormont állít elő, amelyek a test saját stressz- és fájdalomcsillapító szerei).


Feladva: 2015-08-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatástestméreganyagokpozitívellazulnakelőNagysalakhogyizmokállítmasszástápanyagellátásacéljakisimulnakhormontrelaxációsoxigénvégzőidegekválik

Forrás: pepitahirdeto.multiapro.com

Konzol szaküzlet és szerviz Békéscsaba belvárosában. Használt játékok széles választékban garanciával! Megunt konzolodat és játékaidat is beszámoljuk.


Feladva: 2016-12-31    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: BékéscsabaXboxjátékokgépekOnebeszámoljukszervizjátékaidatszaküzlet360konzolodatKonzolPS4MeguntajánlóPS3garanciávalHirdetőválasztékbanPepita

Forrás: pepitahirdeto.multiapro.com

Hölgyeim és Uraim! Engedjék meg hogy bemutatkozzam,Ábrahám Zsolt vagyok Esküvői és Parti Dj. Minőségi szolgáltatást nyújtok elérhető áron számlaképesen, országosan! Céges rendezvényre, Születésnapra, vagy egy fergeteges szilveszteri bulira is szívesen megyek. Elérhetőségem: 0620/274-0390 Az Őszi ár akció elkezdődött! 25%kedvezmény, minden Esküvő árából! Leinformálható nívós referenciával, komplett minőségi hang és fénytechnikával,(RCF hang, ledes lámpák fények, Pioneer Dj pult, Shure ill, ... további részletek >>

Sennheiser mikrofonok. Zenéim a hetvenes évektől napjainkig(retro, pop, rock, rock&roll, alternatív, funky, stb. Magyar és külföldi top slágerek, vagy igény szerint mulatós zenéimre táncolhatnak, IDŐKORLÁT NÉLKÜL akár hajnalig.www.edjbier.hu zsoltbraham@freemail.hu Budapest XXII. ker


Feladva: 2017-10-16    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: CégeshangminőségiBudapestrendezvényreZsoltrockÁbrahámvagynyújtokNÉLKÜLUraimMagyarkedvezményZenéimszilveszteriszolgáltatástIDŐKORLÁTRCFHölgyeim

Forrás: pepitahirdeto.multiapro.com

A vadgesztenye kivonat („a vénák balzsama”) a modern terápiás alkalmazásban és a népgyógyászatban sokoldalú alkalmazásáról ismert. Az UW vadgesztenyés lábkrém segít helyreállítani a lábakban jelentkező keringési zavarokat, illetve ödéma és vizenyőellenes hatással bír. Kellemes, nyugtató hatást biztosít a fáradt, túlterhelt lábaknak. Minden bőrtípusra alkalmazható. Ingyenes szállítási lehetőséggel. www.mososzerbolt.hu/id/00242_UW_Va dgesztenyes_labkrem_500_ml_


Feladva: 2016-01-27    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: enyhítivisszérpanaszokattüneteitfellépővéraláfutáskövetkeztébenVisszérgyulladásTerhességKftwebáruházregeneráljaFuturemosószerbőrtCudyHazaidurva

Forrás: pepitahirdeto.multiapro.com

Egy olyan rendkívüli fizetési mód kezdett elterjedni Magyarországról kiindulva a világon, amely a következő években, évtizedekben, teljesen átalakítja a fizetési szokásokat! Már elindult, legyen Ön is az elsők között. Minden embernek gyökeresen megváltoztathatja az életét, de az első pár millió embernek soha nem látott vagyont is jelenthet. Az eddig ismert összes fizetési mód együttesen nem tud annyi előnyt biztosítani, mint a cégünk által az egész világon levédett, egyedüli és rendkívül ... további részletek >>

egyszerű fizetési rendszerünk. Képzeljen el egy olyan fizetési módot, ahol Önnek szó szerint semmilyen fizetőeszközre nincs szüksége. Érdekesnek találja? Képzeljen el egy fizetési módot, melynek köszönhetően nemzetközi szinten is sok millió ember mindennapos vásárlása után, minden egyes másodpercben jövedelme keletkezik. Garantálom, hogy nem kell befektetnie, vagy befizetnie felesleges csomagokra, nem kell semmit sem eladnia MLM rendszerben, nincsenek kötelezettségei, és garantáltan több pénze lehet, kevesebb nem! Kizárólag a mindennapi megszokott vásárlásokból! Kérje e-mailen mindenre kiterjedő információs levelem. Email: rozsabusiness@gmail.com


Feladva: 2017-04-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemfizetésiegyKépzeljenolyanmillióembernekmódkellvilágonmindenmódotvagyontErrőlnincsenekbefektetnielegyenemberbiztosítaniMagyarországrólhogy

Forrás: pepitahirdeto.multiapro.com

Ha túl nagy a lakása, ha inkább a gyermekével foglalkozna, vagy egyszerûen csak nem tudja hogyan fogjon hozzá, de tiszta lakást, átlátható ablakot szeretne, hívjon bizalommal! Kirakatok, ablakok, tükrök, üvegfalak, üvegportálok tisztítása. Üzletek, irodák, csarnokok, lakások, magánházak takarítása. Gyors, tiszta munkavégzés, korrekt árak. Megelégedettségi garancia! Huszka Antal 70/6163797 www.ablaktisztitas.5mp.eu


Feladva: 2017-06-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: AntalHuszkagaranciaMegelégedettségitisztatükrökablaktisztitashogyanGyorsnagyablakokwwwtudjatakarításatúlKirakatok6163797nemmagánházakBudapest

Forrás: pepitahirdeto.multiapro.com

Használt mobiltelefonok, tabletek, laptopok eladása, szoftveres szervizelése Látogass el weboldalamra, várlak szeretettel!


Feladva: 2017-09-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: laptopokKaisertabletekmobiltelefonokHasználtszeretettelTatabányavárlakajánlóweboldalamraHirdetőLátogassPepitaszervizelésewebáruházszoftveresSzerviz

Forrás: pepitahirdeto.multiapro.com

Küldje el digitális fotóját kedvencéről, családtagjáról, barátjáról s mi visszaküldjük 3 dimenziós formában, üvegkockába gravírozva! • A kép legalább 3 megapixeles és a file 800 KB vagy több legyen • Ha régi fényképet szeretne beszkennelni, akkor minimum 300 dpi-ben és .jpg file-ként mentse el! www.gravirexpressz.hu/2d-fotobol-3d-uveghasab-75×9×13-cm Üzleteink: Gravír Expressz Westend 1062 Budapest, Váci út 1-3. Középső szint, főbejárat - a Niagara vízesésnél jobbra a ... további részletek >>

Starbucks kávézóval szemben! Mobil: 06-20/922-2384 Tel./Fax: 06-1/238-7125 Gravír Expressz Mammut 1024 Budapest, Lövőház u. 2-6. Mammut I. 2. emeleti mozgólépcső Mobil: 06-20/922-2356 Tel./Fax: 06-1/345-8165 Gravír Expressz Pólus 1152 Budapest, Szentmihályi út 131. Mobil: +36-20/454-9634 Tel./Fax: +36-1/410-5080 Gravír Expressz Árkád Pécs 7622 Pécs, Bajcsy-Zsilinszky u. 11. A földszinten, az Intersparral szemben Mobil: 06-20/264-1170


Feladva: 2016-09-28    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ExpresszGravírMobilBudapestFaxTelfile8226szemben922PécsMammutSzentmihályimentseajánlóLövőházfényképetÁrkádszintüvegkockábakéntHirdető1170

Forrás: pepitahirdeto.multiapro.com

Eladom bélyeggyűjteményemet egyben vagy darabonként. Érdeklődni lehet: Bodor Csaba: 06-20/556 9841 bodormotor@gmail.com


Feladva: 2017-05-27    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: CsabaBodorÉrdeklődnidarabonkéntvagyegybencombélyeggyűjteményemetbodormotor@gmailEladom9841Tahitótfalu556eladóBélyeglehet

Forrás: pepitahirdeto.multiapro.com

Pihenjen, gyógyuljon és töltődjön fel Hajdúszoboszlón, a Pávai Apartmanházban, 2 személyes, kényelmes apartmanjainkban, melyek a gyógyfürdő bejáratától csak egy rövid sétára találhatóak. Az ajánlat tartalmazza a szállásdíjat 6 éjszakára, a parkolás, internet használatát is. A külön bejáratú, 2 személyes apartmanok mindegyikéhez saját, jól felszerelt konyha, fürdőszoba tartozik. Ágynemű huzat, törölköző, kábel és műholdas tv, Wi-Fi internet, a teraszon, erkélyen kerti bútorok.


Feladva: 2016-11-11    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: PávaiApartmanházinternetszemélyesbejáratátólbútorokfürdőszobaPihenjenparkolásgyógyfürdőkertikonyhaHajdúszoboszlóéjszakáramelyekerkélyenfelszerelt

Forrás: pepitahirdeto.multiapro.com

Gyomaendrődön a Bonom-zugon közvetlen vízparti összkomfortos nyaraló 3 szoba 6-8 főre kiadó. Ágynemű biztosítva. Fedett stég, csónak van. Fogható Halak: Ponty, amur, harcsa, süllő, csuka, angolna, keszeg, kárász, busa, törpeharcsa. Pontytilalom nincs! Híres gyógyvízének köszönhetően a gyógyulást kereső és strandolni vágyók számára a Gyomaendrődi Liget Fürdő áll rendelkezésükre. Zárt bekerített telek, az udvarba három-négy autó beállhat.


Feladva: 2015-11-20    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: foghatószámáravágyókGyomaendrődönköszönhetőencsukarendelkezésükreÁgyneműKIKAPCSOLÓDNIgyógyvízéneksüllőállkiadóHORGÁSZNIHíresharcsaFürdőfőreÜDÜLNI

Forrás: pepitahirdeto.multiapro.com

Csípős Mangalica parasztkolbász. A feltüntetett ár 30 dkg-ra van kiszámolva A pontosan lemért súly alapján számlázunk. www.kolbaszaruhaz.hu/mangalica-kol basz/282-kover-tanya-csipos-mangali ca-kolbasza.html


Feladva: 2017-04-16    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: mangalicacsipostanyakoverpontosankiszámolvavan282dkgkolbaszfeltüntetettkolbaszaruhazparasztkolbászwwwajánlószámlázunkHirdetőhtmlalapjánPepita

Forrás: pepitahirdeto.multiapro.com

ZENEBOLTUNK MEGLEPETÉSE Webáruházunkban a Zenebolt teljes választéka elérhető. Hogy még kényelmesebb legyen a vásárlás, mostantól 16.000 Ft feletti vásárlás esetén a megrendelt termékeket Magyarország egész területén ingyen szállítjuk házhoz!


Feladva: 2017-07-11    [Zene - Hangszer]

Címkék, kulcsszavak: ZENEBOLTvásárlásszállítjukZENEBOLTUNKmostantólházhozMEGLEPETÉSE000WebáruházunkbanfelettiteljeseseténválasztékamegrendeltelérhetőtermékeketKALÁKAmég

Forrás: pepitahirdeto.multiapro.com

3/4-es méretű klasszikus gitár, mely elsősorban gyermekek részére készült, belépő szintű tanulógitár. Agathis testtel, juharfa nyakkal, rózsafa fogólapokkal, 18 bunddal. Méret: 3/4-es Típus: Klasszikus Gitárok Fogás: Jobbkezes Szín: Rózsaszín Test: Agathis Nyak: Juharfa Fogólap: Rózsafa Fedlap: Agathis Híd: Juharfa Nyakhossz: 580 mm www.dj-sound-light.hu/dimavery-ac- 303-34-es-klasszikus-gitar-rozsaszi n-6753


Feladva: 2017-07-03    [Zene - Hangszer]

Címkék, kulcsszavak: klasszikusJuharfaAgathis303RózsafadimaverygitárNyakhosszPepitaJobbkezes6753belépőFogásrozsaszinkészültHídGitárokgitarrészéreTípusgyermekek

Forrás: pepitahirdeto.multiapro.com

A stressz korunk népbetegsége, melyet a rohanó életformának köszönhetünk. Oldalunkkal segítséget szeretnénk nyújtani mindazoknak, akik felismerik, hogy legfőbb érték az egészség és ennek megőrzéséért tenni is akarnak valamit. Stresszoldó technikák: www.blog.topponleszel.com


Feladva: 2017-04-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: StresszoldótechnikáknépbetegségeakikkorunkvalamitmindazoknakstresszakarnaknyújtaniTrénertenniszeretnénkElmemegőrzéséértsegítségetennekOldalunkkal

Forrás: pepitahirdeto.multiapro.com

A meghirdetett pozíció: Junior online technikai marketinges Feltételek: - Gazdaságinformatikai Bsc/Msc végzettség, vagy más informatikai végzettség (vagy utolsó éves hallgatói státusz, amely nem igényel hallgatói jelenlétet) - Szakmai angol nyelvtudás - Érdeklődés az online marketing területe iránt Jelentkezés módja: a job@ozeki.hu email címünkre küldött önéletrajzzal és jelentkezési adatlappal. Az adatlap letölthető: www.jobs.ozeki.hu/index.php?owpn=121 Folyamatosan várjuk a ... további részletek >>

jelentkezőket!


Feladva: 2017-05-10    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: onlinemarketingestechnikaiJuniorvagyvégzettséghallgatóiirántnemFolyamatosanGazdaságinformatikaiterületeamelyadatlappalFeltételekmarketingstátuszmás

Forrás: pepitahirdeto.multiapro.com

Zeneszeretõ - Bakelit rajongók figyelmébe! Az Audió Design Studió hosszú évek óta foglalkozik hangrestaurálásal. A stúdió vállalja minden tipusú hanganyag rendbe hozatalát, archív hangzók feljavítását ujra masterelését. Bakelit lemezek, kazetták, professzionális szinten történõ átirása, zajmentesítése az az, a hangzó anyagok restaurálása, digitális technológiával úgy , hogy a kész anyag megegyezzen az eredeti hangzással. Ne hagyja, hogy kincsei kárba vesszenek!


Feladva: 2017-10-09    [Zene - Hangszer]

Címkék, kulcsszavak: stúdióDesignBakelithogy245anyagévektörténátjátszáshozatalátkészhosszúszintenhangjavításrendbeúgyprofesszionálisDigitalizálásvesszenekhanganyag

Forrás: pepitahirdeto.multiapro.com

Elektromos moped 4 évszakos gumikkal, Garancia + Mobilszerviz, ingyenes, gyors házhoz szállítással és beüzemeléssel! Idősebbeknek, nehezebben mozgóknak mozgáskorlátozottaknak és egészségpénztári tagoknak ajánlunk három kerekű elektromos mopedeket. Járműveink kezelése egyszerű, fenntartása olcsó. Árak 180.000 Ft és 250.000 Ft között.


Feladva: 2016-02-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elektromos000elektromopedmopedmopedeketbeüzemelésselAkcióközöttszállítássalHúsvétikerekűházhoz250háromgyors180ajánlunkingyenesÁraktagoknak433

Forrás: pepitahirdeto.multiapro.com

Autókölcsönző, autókölcsönzés, bérautó, autóbérlés, kaució nélkül!! Nonstop autóbérlés, kilométer megkötés és kaució nélkül, Napi 5.000.-Ft. Hosszútávra megegyezés szerint, Fiatal, megbízható, rendszeresen karbantartott kis fogyasztású autóból álló flotta. Honlap: www.berelhetoauto.hupont.hu


Feladva: 2015-10-25    [Autó - Motor - Jármű]

Címkék, kulcsszavak: autóbérlésautókölcsönzésgyőrautónélkülbérelhetőkauciósopronmosonmegbízhatóNonstophupontFiatalbérautóberelhetoautoszerintmegyébenAutókölcsönzőálló

Forrás: pepitahirdeto.multiapro.com

A látás egyik legnagyobb értékünk. 6 féle olyan gyakorlatot tanulhat meg, aminek otthoni ismétlésével javítani, tudja saját és családja látását. A gyakorlatok könnyen megtanulhatók és együtt ismételheti az egész család. Időpont egyeztetésért, bővebb információért hívjon a 06-30/907-47-86 telefonon. Életmód Stúdió - www.eletmod-debrecen.hupont.hu/36/ a-latas-helyreallitasa-termeszetes- uton


Feladva: 2017-09-17    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: debrecengyakorlatokhelyreallitasagyakorlatotinformációértlátásátlatasolyanbővebbcsaládjahupontféleegyeztetésértsajátértékünkIdőponttudjaeletmod

Forrás: pepitahirdeto.multiapro.com

Az ország legelismertebb és legjobban foglalkoztatott Elvis imitátora, külföldi turnéja után újra Magyarországon vállal fellépéseket. Ő az egyetlen Magyarországon, aki Las Vegasban sajátította el a szakmát. Ha színvonalas műsort szeretne, hívjon bizalommal telefonon!


Feladva: 2016-04-24    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: ElvisMagyarországonLasakifoglalkoztatotttelefononlegjobbanbizalommalegyetlenlegelismertebbhívjonfellépéseketországszeretnevállalélőbenműsortújra

Forrás: pepitahirdeto.multiapro.com

Ablakredõny, reluxa, harmonikaajtó, roletta, szalagfüggöny, lehúzható,-elhúzható aluminium szúnyogháló, fix mûanyagkeretes üvegszálas szúnyogháló. Redõny felhúzógurtnik, redõnyautomaták, redõny alkatrészek azonnali cseréje. A szakmával összefüggõ munkák, javítások végzése szakszerûen, garanciával! Minden hónapban más termék akciós áron a készlet elejéig. Keresse honlapunkon az Akciós Árnyékolástechnikai Termékeket! Várjuk megrendelését.


Feladva: 2016-08-06    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 245redAkciós251szúnyoghálóanyagkeretestermékÁrnyékolásösszefüggmegrendelésétfixmásPerzsaszakmávalVárjukaluminiumhónapbanDebrecenbencseréjeáron

Forrás: pepitahirdeto.multiapro.com

Vízcsapok javítása, mosogatók, mosdók, WC-kagylók cseréje, WC tartályok javítása, mosogató gépek és mosógépek bekötése! Szifonok, lefolyó vezetékek tisztítása, javítása.


Feladva: 2016-02-09    [Lakossági szolgáltatás]

Címkék, kulcsszavak: javításatisztításamosdókvezetékekMosogatóklefolyóVízcsapokSzifonokBudapestbekötéseIstvánmosógépekSzabógépek2525mosogató252tartályokVÍZSZERELŐ

Forrás: pepitahirdeto.multiapro.com

Új tervezésű 2016.évi benzinmotoros fűnyírók a GÜDE től. 1, Az alap: Fűnyíró ECO WHEELER 461 P 95322 2, A TOP: Fűnyíró BIG WHEELER 461 4in1 95333 3, A RITKASÁG: Fűnyíró BIG WHEELER Trike 515 D 95375 4, A LUXUS : Fűnyíró BIG WHEELER 565 BS Önindítós: 95363 www.fjs.hu/benzinmotoros-gepek-k54 072


Feladva: 2016-04-01    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 251WHEELERnyíróBIGbenzinmotorosGÜDEfűnyírók46195322gepekSzolgECOKerLUXUSalapfjsminőség95375tőlwwwnémet515httpakciósTrike95363évi

Forrás: pepitahirdeto.multiapro.com

Olyan pénzügyi szakmát szeretnél tanulni, amivel vállalkozások alapításával, adóügyekkel és hitelügyintézéssel is foglalkozhatsz? Szeretnél pénzügyi szakértőként dolgozni és ügyintézéssel foglalkozni? Szívesen lennél Pénzügyi asszisztens, Banki könyvelő vagy Számviteli előadó? Jelentkezz Budapesten induló Pénzügyi-számviteli ügyintéző OKJ-s tanfolyamunkra! A tanfolyam árát több részletben is fizetheted. A tanfolyamot kevesebb, mint 1 év alatt is elvégezheted és pályakezdőként, akár 200.000 Ft-os ... további részletek >>

fizetésre is számíthatsz. A tanfolyamhoz szükséges szakmai előképzettség: Érettségi végzettség. Ha úgy döntöttél, hogy ez a Te szakmád, akkor jelentkezz weboldalunkra kattintva: www.tanfolyamokj.hu/penzugyi-szamviteli-ugyintezo-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: penzugyiszámvitelibudapestentanfolyamokjugyintezotanfolyamokjSzeretnéljelentkezz200amivelárátszamvitelifoglalkozniúgyakártanulnitanfolyamunkra000

Forrás: pepitahirdeto.multiapro.com

Kertészetünkben fejlett, több hajtásból álló kék áfonya bokor, másnéven vaccinium corymbosum kapható személyes átvétellel vagy az ország bármely pontjára futárszolgálattal, házhozszállítva. www.afonyaporta.hu/termekkategoria /afonya-bokor Áfonya Porta A kertészet Dabas külterületén, a 405-ös főúton található Vitafort Zrt. melletti útról közelíthető meg, melyet táblák jeleznek. .


Feladva: 2017-09-18    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: ÁfonyabokorkaphatóDabaspontjáraállómegkertészetbármelyhajtásbólközelíthetőPortaországtöbbútrólvagyfejlettmellettiátvétellelKertészetünkbenZrt

Forrás: pepitahirdeto.multiapro.com

Statikus szakvélemény készítése: - ingatlan vásárlásnál - falkivételnél - átalakításnál - tetőtér beépítésnél - falak repedéseinél - süllyedésnél vagy csak azért, hogy nyugodt legyen ingatlana állapotára vonatkozóan.


Feladva: 2015-10-26    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: szakvéleményStatikusbeépítésnélingatlanatetőtérlegyenátalakításnálnyugodtfalkivételnélhogyvásárlásnálazértingatlancsakkészítésevagysüllyedésnélKft

Forrás: pepitahirdeto.multiapro.com

Új lakásba, házba költözni nagy öröm, még akkor is, ha csak nekünk új az ingatlan... Díszítse, dekorálja egyéni módon lakását vagy házát! Ha nincs ötlet, elképzelés, mi segítünk! Esetleg a hálószobában egy közös emlékeket idéző falmatrica. Vagy egy gravírozott kávéscsésze vagy müzlis tál, esetleg két - vagy több - névvel ellátott borospohár. Keressen minket és mi megoldjuk!


Feladva: 2016-11-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: vagyesetlegegyidéződekortöbbemlékeketlakasközöshttpkéthálószobábanZamárdisegítünkPétertálajándékozzmegoldjukBuzásmüzlismitminketötleted

Forrás: pepitahirdeto.multiapro.com

A tisztaság fél egészség! Persze a mondás máshogy is szól, mely akár még igaz is lehet. Hiszen minek vesződjön a ruhatisztítással, a fárasztó mosással, vagy a korán sem kíméletes vegytisztítással, amikor van, aki szívesen megcsinálja Ön helyett? A mosoda Budapesten biztosítja azon professzionális ruha- és vegytisztítási szolgáltatásokat, melyek garantáltan foltmentes világot teremtenek. A mosoda Budapesten több évtizedes múltra tekint vissza. Új üzemeltetőként igyekszünk a patinás patyolat ... további részletek >>

hírnevét tovább vinni, munkatársaink a mosást, a vegytisztítást és a ruhatisztítást gyorsan és precízen látják el, olyan kiegészítő szolgáltatásokkal együtt, mint például a frissen mosott ruha házhoz szállítása. Teljes körű szolgáltatásaink, kedvező áraink, szakképzett kollégáink és a professzionális eszközeink teszik lehetővé, hogy a mosoda Budapesten még a háztartási mosógépek világában is versenyképes legyen. Ruhatisztítás Budapesten és egész Pest megyében, gyorsan és precízen!


Feladva: 2016-10-05    [Lakossági szolgáltatás]

Címkék, kulcsszavak: mosodaBudapestenprecízengyorsanmégRuhatisztításruhaprofesszionálismegcsináljamintfárasztóháztartásitovábbteremtenekmondáskedvezőszívesenegyüttaki

Forrás: pepitahirdeto.multiapro.com

Vásároljon most kedvező áron. Minőségi háztartási termékek és konyharobotok! Miért érdemes itt vásárolni? · 14 napig visszaküldhető · Eredeti német termékek · Online fizetési lehetőség Modellek: Modern, Minimál, Klasszikus, Loft Konyhafelszerelések: www.klarstein.hu/Konyhafelszerel-s /Konyhai-seg-t-k/


Feladva: 2017-10-01    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: 183KenyersutogeptermékekfizetésiMiért8206OnlinekonyharobotokklarsteinszállítássalháztartásiwwwingyenesMinőségiKenyérsütőinkAkárnémetáronLoftitt

Forrás: pepitahirdeto.multiapro.com

Adj esélyt az óriási nyereményeknek! Akár 3,5 milliárd Ft nyeremény! * Naponta új nyerési lehetőségek * Alacsony részvételi díj - akár ingyen is! * Könnyen, otthonról játszhatsz


Feladva: 2017-09-21    [Pénzkeresés - MLM]

Címkék, kulcsszavak: akáresélytAdjlehetőségekPepitanyerésiszerencsédnekNapontajátszhatsznyereményotthonrólmilliárdKönnyennyereményeknekingyenóriásidíjrészvételiajánló

Forrás: pepitahirdeto.multiapro.com

Kezelt problémák: fejfájás, nyak-, hátfájás, derékfájás, porckorongsérv, csípő, …váll és egyéb ízületi problémák, idegbecsípődések, végtagzsibbadás, húzódások, izomgörcsök, izomfájdalmak, gyógymasszázs és ízületek kimozgatása. Előre egyeztetett időpontban házhoz megyek! Ha kedves vendég a masszázst nálam akarja igényben venni, előre egyeztet időpontot kell kérnie.


Feladva: 2017-09-16    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: problémákházhozElőreidegbecsípődésekmegyekkérnievégtagzsibbadásízületikedvesKezelthúzódásokegyébvendégajánlóizomgörcsökvállmasszázstHirdető8230

Forrás: pepitahirdeto.multiapro.com

Régiséget szeretne eladni? Minket mindig megtalál: Budapest V. ker. Kálvin tér 1 - Korona Antikvitás AZONNALI KÉSZPÉNZFIZETÉS történik ÜZLETÜNKBEN ÉS HELYSZÍNEN IS!!! AKÁR 20%-KAL TÖBBET FIZETÜNK MINT MÁS KERESKEDŐ! KIEMELT MAGAS ÁRON VÁSÁROLUNK: RÉGISÉGET, ANTIK-HAGYATÉKOT, ANTIK-GYŰJTEMÉNYEKET, MINDENFÉLE ANTIK LAKBERENDEZÉSI DÍSZ- ÉS HASZNÁLATI TÁRGYAKAT! A KISZÁLLÁS MINDEN ESETBEN DÍJTALAN!


Feladva: 2017-07-11    [Régiség - Művészet]

Címkék, kulcsszavak: ANTIKRÉGISÉGETÁRONMAGASAZONNALIszeretneLAKBERENDEZÉSIMÁSAntikvitásajánlóMINTKoronaHirdetőMINDENFÉLEFIZETÜNKtérPepitaGYŰJTEMÉNYEKETTÖBBETKálvin

Forrás: pepitahirdeto.multiapro.com

A Lada Vesta stílusos, merész és ragyogó – pont, mint amilyennek egy új generációs Ladának lennie kell. A szedán sziluettje korszerű és harmonikus, az X forma egységként kíséri végig a karosszériát. Az új, bátor stílus könnyen felismerhető a részleteiben: a fekete színnel kiemelt radiátor borításban, a lenyomatokban az oldalakon, a hátsó fényszórók fényvisszaverőin. A megemelt öv vonalának, meghosszabbított motorháztetőnek illetve lejtős tetőnek köszönhetően a Vesta külsőre is sportos és ... további részletek >>

dinamikus. Egy ilyen autóval nehéz észrevétlennek maradni az utakon. Vesta. A LADA új arca. www.ladaszolnok.hu/vesta_sedan_ismerteto


Feladva: 2017-04-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: vestaLADAEgymeghosszabbítottmintsedanszínnelilyenformavonalánakpontfeketeharmonikusmegemelt8211ladaszolnokrészleteibendinamikuskorszerűragyogó

Forrás: pepitahirdeto.multiapro.com

Szerelmes akarsz lenni? Akkor tedd meg az első lépést! Új esélyek szingliknek! Teljesen ingyenes a társkereső oldal, ahol csak 10 másodperc a regisztrálás és bármi elképzelhető. INGYENES!!!


Feladva: 2016-01-04    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: INGYENEStárskeresőfelszedleklennioldalakarszSzerelmesTeljesenDianawwwszingliknekelképzelhetőesélyekbármilépéstregisztráláselsőmásodpercmegegy

Forrás: pepitahirdeto.multiapro.com

Szeretném eladni ezt a szekrényt! Több, mint 100 éves, fából készült! Hibátlan állapotú! 40.000.- Ft. (a kombinált rész három vízszintes részből áll, szállítható!) Egerben található! Érdeklődni: 20/9680-016.


Feladva: 2017-10-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 100mintTöbbEgerbenévesELADÓrészbőlSZEKRÉNYvízszintesháromrészszekrényt016kombináltezt9680000eladniÉrdeklődniállapotúSzeretnémtalálhatóáll

Forrás: pepitahirdeto.multiapro.com

Mixerbeton bedolgozás meggyorsításához és könnyebbé tételéhez rendelhet nálunk betonszivattyút huszonhárom méteres gémhossztól egészen ötven méteresig, melyeket igény esetén meg is lehet hosszabbítani földre fektetett csövek összeszerelésével. Óradíjainkat megtalálja weboldalunkon mixerbeton árlistánkban!


Feladva: 2014-01-16    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: mixerbetonbetonarwwwlehetbetonszivattyútárlistánkbanmegnálunkeseténrendelhetweboldalunkonigénytételéhezmegtaláljamelyeketkönnyebbéÓradíjainkatötven

Forrás: pepitahirdeto.multiapro.com

Vízálló, csúszásmentes meleg burkolatok, fahatású, kőhatású, szövött és minimál design padlók széles választéka. Click és Loose-Lay padlórendszerek. Az anyag rugalmassága miatt minden helységbe alkalmas, akár falra, pultra, bútor homlokzatra is rögzíthető. Mikrofózolt élekkel, sima, előkészített burkolaton egy 1-3mm-es ragasztóágyba helyezve, gyorsan, kosz-és zajmentesen lerakható, padlófűtéshez is! A különböző termékcsaládjainkat és a színválasztékot megtalálja a www.magicfloor.hu oldalon!


Feladva: 2017-03-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: magicfloorburkolatokVízállókoszszövöttrögzíthetőVinyloldalonanyaggyorsankőhatásúhomlokzatraLuxuspadlórendszerekhelyezvefahatásúbútorwwwLayLoose

Forrás: pepitahirdeto.multiapro.com

Magas nedvszívó hatással rendelkező 130 gr-os felmosófej, zöld-fehér színben. Összetételének köszönhetően kevesebb vegyszert igényel, mégis könnyedén megbirkózik a szennyeződésekkel. Takarékos egyben hatásos is. www.szympyhygi.hu/micromix-zold-fe her-felmosofej-130g-t446987


Feladva: 2017-04-16    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: feherzoldmicromixfelmosófej130ghatássalmégisnedvszívóigényelMagasvegyszertajánlószympyhygikevesebbHirdetőwwwköszönhetőenPepitahatásosegyben

Forrás: pepitahirdeto.multiapro.com

Az Alize Cotton Gold batik fonalcsaládból készült pulcsik, blúzok, ruhák, polók, szoknyák, kardigánok, stb. nagyon kellemes, könnyed viselet 55 % pamuttartalmának köszönhetően! Óriási színválasztékkal rendelkezik, ezért mindenki megtalálja a magának megfelelő egyszínű vagy színátmenetes fonalakat! Kötéshez 3,5-5 mm-es kötőtűt, horgoláshoz 2-4 mm-es horgolótűt ajánlunk. www.kezimunkakellek.hu/termekek.ph p?fcs=1&termek=6348


Feladva: 2017-04-12    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: batikGoldCottonszínválasztékkal6348polókfonalakatHirdetőÓriásifcsruhákszínátmenetesPepitaköszönhetőenphpblúzokvagykötőfonalpamuttartalmánakwww

Forrás: pepitahirdeto.multiapro.com

Már 24 féle hangulat-színváltós nyaklánc közül választhat a legjobb áron a Lili Bizsu Webáruházban www.lilibizsu.hu Házhoz szállítás már 650Ft-tól akár ingyenesen is


Feladva: 2017-10-22    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: színváltóshangulatBizsuLilimárszállításnyakláncHázhozlilibizsuwwwféleWebáruházbanWEBÁRUHÁZnyakláncokingyenesenakárárontóllegjobb650Ftközül

Forrás: pepitahirdeto.multiapro.com

Eddig az MLM-ben az új emberek látták el pénzzel a már meglévő hálózatot. Nálunk ez most megfordul, az MLM történetében először: a már bent lévő, kereső emberek segítik meg az újonnan érkezőket!!! Sőt arra sem kérlek hogy abba amit már elkezdtél. Érdekel hogyan? Nézd végig a 8 perces videót és csatlakozz pénzügyi kockázat nélkül! www.youtube.com/watch?time_continu e=6&v=1t-isPFBqLA


Feladva: 2017-10-04    [Pénzkeresés - MLM]

Címkék, kulcsszavak: máremberekMLMhogyanKONCEPCIÓérkezőketmegfordulwwwÉrdekelÜZLETIújonnanmosthttpselkezdtélLEHETŐSÉGmegNálunknélkülsegítikkockázathálózatotamit

Forrás: pepitahirdeto.multiapro.com

Miért érdemes még hozzánk jönni? ⋅ mert ha valamit nincs nálunk, azt 24-48 órán belül megszerezzük ⋅ mert termékigényét eljuttathatja hozzánk a webáruházon keresztül, vagy e-mail-en, amit aztán célba juttat egy futár, esetleg átveheti egy PickPackPont-on, de akár személyesen is ⋅ mert üzletünkben van: spirálozás, fénymásolás, laminálás, nyomtatás, bélyegzőkészítés és szkennelés, (e-mail-ben juttassa el hozzánk dokumentumait majd a kész kötészeti anyagot vegye át a ... további részletek >>

futártól, vagy a PPPonton. ⋅ mert szakmai tanácsot is adunk (térítés nélkül!). Aki inkább a hagyományos vásárlást részesíti előnyben, azt szeretettel várjuk kiskereskedelmi üzletünkben: 1133 Budapest, Dráva u. 5/d. H - CS: 9.00 - 17.00; P: 9:00 - 16:00 óra között.


Feladva: 2017-10-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: mert8901hozzánkaztvagymailBudapestegyüzletünkbennélkülesetleganyagotbelülnyomtatásajánláskiskereskedelmitérítésfutárkötészetióránlaminálás

Forrás: pepitahirdeto.multiapro.com

A Google kereső algoritmusa folyamatosan változik, mondhatni finomodik... Ennek lehetséges következménye lehet, hogy néhány - addig jól kereshető - weboldal, esetleg hirdetés kereshetetlenné válik, eltűnik. Általánosságban természetesen törekszünk arra, hogy a hirdetéseinkkel ez ne történjen meg! Garantáltan megóvni azonban csak azokat a felügyelt tartalmakat tudjuk, melyekre konkrétan felkérnek. Köszönjük a bizalmat, amit egy-egy hirdetés feladással kifejeznek a kedves látogatóink, ... további részletek >>

de a legjobb az lenne, ha a fontos dolgokra külön fel is hívnák üzenetben a figyelmünket egy üzenettel! Marad a mottónk, mely alapján keresőinket is üzemeltetjük: Nekünk az a fontos, ami Önnek az!


Feladva: 2017-05-19    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: egyhogyfontoshirdetéshívnákÁltalánosságbanamitkövetkezményeüzemeltetjükazonbanHirdetőfeleltűnikbizalmatlehetségeskeresőinketmegóvniPepitakülön

Forrás: pepitahirdeto.multiapro.com

Egy falat Székelyföld, egy falat hagyomány, egy falat egészség. Boltunkban megtalálják a legfinomabb székely kézműves élelmiszereket. A Székely Falat kiváló füstölt hústermékeit, a madarasi, székelyszentléleki és torockói sajtokat, házi vajat, Szász Illyés méhészetéből kikerülő havasi bio mézeket és egyéb mézkülönlegességeket, Gáll Erzsébet házi lekvárjait és szörpjeit, az Ábel székely mustárt, a Csíki áfonyát, a Hargita Gyöngyét és számtalan egyéb székelyföldi manufaktúrákból kikerülő terméket


Feladva: 2015-10-24    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: FalategyszékelyegyébházikikerülőÁbelLászlóIlyésmanufaktúrákbólélelmiszereketszörpjeitBagiSzászszékelyföldikézműveslekvárjaitboltvajatErdélyi

Forrás: pepitahirdeto.multiapro.com

Nem online! Személyes segítség! Azonnali társtalálás megbízhatóan általam. Diplomások, Vállalkozók, jó társaság! Azonnali Társközvetítés · 23-96 év közöttieknek Férjet? Feleséget keres? · Hívjon már ma!


Feladva: 2017-07-15    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: Azonnali183FérjetSzemélyesközöttieknekonlineTársközvetítésNemajánlótársaságHirdetőVállalkozókPepitamárDiplomásokIrodájaHívjonáltalamTárskereső

Forrás: pepitahirdeto.multiapro.com

HP DesignJet plotterek javítása, karbantartása. Bordásszíj csere soron kívül. Papír és kellékanyag. Machine World Bt. Pécs, Farkas István u. 8. Tel: 72/538-072 Web: www.machineworld.hu/plotter


Feladva: 2017-02-22    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: javításaPécsplotterekDesignJetMachineImrewwwkellékanyagKovácshttpPapírWebkívül072soron538csereTelBordásszíjIstvánkarbantartásaFarkasWorld

Forrás: pepitahirdeto.multiapro.com

Non-stop bútorszállítás, költöztetés, lomtalanítás! Ügyfeleink időbeosztásához rugalmasan igazodunk, hétvégén és éjszaka is dolgozunk, telefonon a nap minden órájában elérhetőek vagyunk! Több éves tapasztalattal, jó referenciákkal, gyors és pontos munkavégzéssel hétvégén is hétköznapi árakon állunk rendelkezésükre! Igény szerint csomagolunk csomagolóanyagot kiszállítunk, szerelést is vállalunk! Tel: +36 70 2353403


Feladva: 2017-02-20    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: költöztetéshétvégénmindenbútorszállításcsomagolunkBudapestreferenciákkaléjszakaszerintCsacsitransztapasztalattaligazodunkIgénynapjánévesrugalmasanhét

Forrás: pepitahirdeto.multiapro.com

Ha szeretnél magadnak jövedelem kiegészítést, 100% online munkával, ehhez tudok ajánlani és megoldást adni, úgy hogy érdekelni fog! www.dollar-persely.iwk.hu


Feladva: 2017-05-18    [Pénzkeresés - MLM]

Címkék, kulcsszavak: megoldástSzakálajánlaniElviraiwktudokfelhívhatodperselyehhezfigyelmétdollarmunkávalmásokhttponlineamirefog100ötletérdekelnikiegészítéstEgy

Forrás: pepitahirdeto.multiapro.com

Cégünk személyszállítást vállal kényelmes, 9 személyes mikrobuszokkal. Extra nagy csomagtérrel, dupla klímával, állítható ülésekkel, TV-vel, DVD lejátszóval. Buszainkon 220 voltos töltés lehetőség. Kedvező, 0% os áfás számlás árak. Fiatal korszerű, Euro 4-es motorral felszerelt, biztonságos kisbuszok, képzett hivatásos sofőrök, komoly referenciák.‪


Feladva: 2017-10-10    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: áfáscsomagtérrelképzettmikrobusszalKedvezőnagykisbuszokSzemélyszállítástöltésExtrabiztonságosvoltosmikrobuszokkalfelszerelt220személyesmotorralvel

Forrás: pepitahirdeto.multiapro.com

Az Ezermester Magyarország legrégibb és legnépszerűbb általános technológiai magazinja. Gépek, szerszámok, technológiák, építés, kert, újdonságok, ötletek. Facebook oldal: www.facebook.com/ezermester.hu


Feladva: 2017-09-11    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: ezermesterfacebookáltalánosoldallegnépszerűbbötleteklegrégibbújdonságokMagyarországkertajánlóépítésHirdetőtechnológiákPepitaszerszámokHobbimagazin

Forrás: pepitahirdeto.multiapro.com

Rendelhető !!!!!!! ZEITGARD 1 arctisztító készülék a ragyogóan tiszta bőrért Zeitgard Discover Az arctisztítás új dimenziója Tiszta és ragyogó bőr elérése a ZEITGARD 1 arctisztító készülék segítségével. Az innovatív elektromos arctisztító kefe forradalmasítja a hagyományos arctisztítást. 10-szer hatékonyabban távolítja el a sminket és a szennyeződéseket anélkül, hogy a bőrt túlzottan igénybe venné. Egyedülálló higiénia A kefeszálakban található MicroSilver BG™ antibakteriális ... további részletek >>

hatóanyag biztosítja a higiénikus használatot. A MicroSilver BG™ védőpajzsként működik: elpusztítja a bőrről a kefeszálakra átkerülő baktériumokat, és megakadályozza az újraképződésüket. A bőrtisztítás új dimenziója Az innovatív ZEITGARD 1 arctisztító készülék forradalmasítja a hagyományos arctisztítást. Egyszerre hatékony és kíméletes a bőrhöz. Az elektromos arctisztító készülék és a kifejezetten hozzá kifejlesztett arctisztító készítmény láthatatlan hálót képez a bőrön, melynek segítségével a bőrön található szennyeződéseket eltávolítja. Használatukkal bőröd felkészíted az arcápolás további lépéseire. A bőr finom lesz, simább és ragyogó. Innovatív Zeitgard Innovative Principle ZEITGARD 1 arctisztító készülék A ZEITGARD arctisztító rendszert a legapróbb részletekig átgondoltuk: az oszcilláló mozgású kefe még a pórusok mélyén található szennyeződéseket is eltávolítja. A speciálisan a keféhez kifejlesztett arctisztító készítmények textúráját pedig úgy alakítottuk ki, hogy könnyedén eltávolítsa a bőr felső, elhalt hámrétegeit is. Az eredmény láthatóan tiszta és ragyogó bőr. Az arctisztító készülék keféjében rejlik az egyedisége Az egyedileg kidolgozott, legömbölyített végű kefeszálaknak köszönhetően lágyan tisztítja a bőrt. A kefe fejének 7.000 rezgés/perces sebessége gondoskodik az alapos tisztításról, ami lehetővé teszi a szennyeződések és a smink eltávolítását az arcbőrről. Tiszta és ragyogó arcbőrt eredményez. Tapasztald meg te magad! Könnyű használni Zeitgard Application Sugárzóan tiszta bőr 1 perc alatt? Bőrgyógyászatilag igazolt: a bőrgyógyászati vizsgálatok azt bizonyítják, hogy a ZEITGARD 1 arctisztító készülékkel 10-szer hatékonyabb az arctisztítás, összehasonlítva a hagyományos kézi tisztítással. Tisztítsd az arcbőr különböző területeit (homlok, orr, arc mindkét oldala, áll) körülbelül 20 másodpercig területenként. Bőröd olyan tapintású lesz, mint egy alapos krémezés után. Hatékony ápolás Ragyogó arcbőr 1 perc alatt. Használd naponta 1 percig a gyorsan látható eredmény érdekében. A ZEITGARD 1 arctisztító készülék és a ZEITGARD arctisztító készítmények tökéletesen kiegészítik egymást. Látható eredmény Javítja a bőr állapotát a mélytisztítás eredményeképpen Hatékonyabb felkészülés az arcápolás további lépéseire Ragyogóbb arcszín a bőr élénkebb mikrokeringésének köszönhetően Feszesebb, simább bőr


Feladva: 2016-10-23    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: arctisztítóZEITGARDbőrkészülékRagyogótisztakefehogytalálhatóeredményhagyományosszennyeződéseketInnovatívarctisztításdimenziója8482alattszerlesz

Forrás: pepitahirdeto.multiapro.com

Olyan vendéglátóipari szakképesítést szeretnél, amivel könnyedén nyithatsz egy Street Food éttermet? Mindig is imádtad a gasztronómiai különlegességeket? Szívesen készítenél diétás, gluténmentes vagy laktózmentes ételeket? Jelentkezz Budapesten induló Szakács OKJ-s tanfolyamunkra! A tanfolyamra való jelentkezéshez csak alapfokú iskolai végzettség szükséges, így szakmai előképzettség nélkül jelentkezhetsz. 9 hónap, kitartó tanulás, sikeres vizsgák és már a kezedben is van az OKJ-s bizonyítvány. ... további részletek >>

Ha szeretnél kiemelkedő gasztronómiai tudást szerezni, akkor a Szakács szakma Neked való. Nincs más dolgod, csak kattints a honlapunkra és jelentkezz a tanfolyamra: www.tanfolyamokj.hu/szakacs-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: okjbudapestenSzakácsjelentkezzcsakgasztronómiaitanfolyamszeretnélvalótanfolyamokjtanfolyamravégzettségakkorkészítenélsikeresamivelhonlapunkratudást

Forrás: pepitahirdeto.multiapro.com

A DXN-nél semmi... Átáll a cég egy másik, mobil barát kinézetre. Hát abba már nem fér bele az a fajta blogolás, amit néhányan annak tartottak. Feltételezhető azonban, hogy van rengeteg normális DXN üzletépítő, akik azért még folytatnák... Nekik fenntartunk egy lehetőséget, amivel a saját DXN oldalukra tudnak látogatókat szerezni. Titok nincs, kereshetőnek kell lenni! (Persze csak annak, aki kereshető akar lenni...) ... további részletek >>


Feladva: 2017-08-16    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: DXNlenniannakblogolásegyhogyajánlófenntartunkwwwazonbanabbaTitokHirdetőNekikFeltételezhetőHátszerezniPepitahtmlfolytatnákakartartottakmég

Forrás: pepitahirdeto.multiapro.com

Én étkezés előtt fél órával fogyasztom ezt a bio Spirulina, oroszlánsörény gomba, bolhafű, zöldtea és még sok más kiváló fűszer és gyógynövény tartalmú terméket. Én karácsonykor sem híztam meg, pedig nassoltam rendesen. A DXN Myco Veggie por megtisztítja a táplálék útját a belekben és javítja az emésztést. Kiváló választás fogyókúrához is, de a napi mozgást nem váltja ki. Én így fogyasztom: www.kavekiraly.hu/blog-2017-01-21-Gomboc_Artur_es_a_DXN_MycoVeggie_gyogynoveny_keverek webáruház: ... további részletek >>


Feladva: 2017-01-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: DXNKiválómegkavekiralyfogyasztomhttpgyógynövényMycoVeggieveggiemycoGomboczöldteaGergelyproducts2017bolhafűemésztéstTakácshíztambloggombawww

Forrás: pepitahirdeto.multiapro.com

GH3X kalapácsmechanikás digitális zongora, állványzat, USB. Ingyenes szállítás! GH3X kalapácsmechanikás digitális zongora, állványzat, USB Billentyűzet: 88-billentyűs GH3X kalapácsmechanikás billentyűzet, szintetikus elefántcsont és ébenfa takarólap, kiváltópont Hangszínek: 36 hangszín, Yamaha CFX és Bösendorfer zongorák, VRM (Virtual Resonance modeling), Smooth Release és Key-off Sample Stílusok: 20 ritmus Effektek: 6 zengető, 3 chorus, 7 brilliance, 11 egyéb Dalok: 19 hangszín ... további részletek >>

demo, 50 klasszikus, 303 oktató, USB-ről Wav lejátszás Dalfelvevő: 250 dal, 16 sáv, USB-re Audio felvevő Adattároló: 1,5 MB beépített memória, USB memória (pl. pendrive) Funkciók: transzponálás, finomhangolás, metronóm, Dual (két hangszín megszólaltatása egyszerre), Split (billentyűzet két külön hangszínen megszólaló szekcióra osztása), Duo (billentyűzet két egyforma szekcióra osztása, közös tanuláshoz) Kijelző: 128 x 64 pixeles LCD Hangszóró: 2x 30 Watt, 2x 16 cm) hangszórók Vezérlők: 3 pedálos konzol Analóg csatlakozók: 2 fejhallgató kimenet, AUX in (vonal bement például mp3 lejátszó csatlakoztatásához), AUX out (vonal kimenet, pl. tovább hangosításhoz, felvétel készítéséhez) Digitális csatlakozók: MIDI (be/ki/át), USB To Host (zongora-számítógép csatlakoztatás), USB To Device (zongora-pendrive csatlakoztatás) Egyéb: kihúzható billentyűfedél, Acoustic optimizer, Intelligent Acoustic Control, Stereophonic optimizer Méret: 1461 x 459 x 927 mm Súly: 56 kg Tartozék: állványzat, pedálkonzol, fejhallgató akasztó, kottatartó Bővíthetőség: USB vezeték nélküli LAN adapter (UD-WL01), vezeték nélküli MIDI adapter (MD-BT01, UD-BT01, fejhallgató, zongoraszék, stb. Szín: matt rózsafa (R: Rosewood) www.hangszeraruhaz.hu/yamaha-clp-635r-clavinova-digitalis-zongora/P34732


Feladva: 2017-06-06    [Zene - Hangszer]

Címkék, kulcsszavak: USBzongoradigitálisbillentyűzetGH3XYamahakéthangszínállványzatfejhallgatókalapácsmechanikásClavinovacsatlakoztatás635RadapterCLPBT01csatlakozók

Forrás: pepitahirdeto.multiapro.com

Megbízható józan életű villanyszerelő brigád munkát vállal. Lakás, házak teljes elektromos hálózatának kiépítése (akár szükséges ELMÜ ügyintézéssel), igény szerint internetes hálózat, riasztók, kamerák, kaputelefonok telepítése. Budapest területén és vonzáskörzetében.06203535368 Kivitelezők jelentkezését is várjuk. 06203535368


Feladva: 2017-08-30    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 06203535368LakásKivitelezőkigényvállalvonzáskörzetébenügyintézésselmunkátterületénELMÜbrigádBudapestszükségesvillanyszerelőtelepítéseakáréletűjózan

Forrás: pepitahirdeto.multiapro.com

Non Stop Lakatos Budapest! Non-Stop Zármentés Budapest. A Non Stop Zárszerviz Budapest és környéke vállalja zárak cseréjét és javítását, postaládák zárcseréjét. Hevederzárak szerelése, javítása. Ellopták a kulcsait?Illetéktelen személyhez került a kulcs? Zárcsere!Ne váljon betörés ill. lopás áldozatává! A zárcserére és a biztonságtechnikára fordított összeg, többszörösen megtérülhet! Minket éjjel-nappal hívhat, mindig fix árakon dolgozunk. Munkánkról és a beépített anyagokról mindig ... további részletek >>

számlát és garanciát adunk! Tehát zárcsere, zárszerviz, lakatos munkák, vagyonvédelem és hevederzár szerelés Budapesten. Zárjavítás Budapest 0-24! Műanyag bejárati ajtó javítás és zárcsere. Felhúzó kilincses ajtók javítása és zárcseréje garanciával. HI-SEC ajtó zárcsere és javítás. Az elvégzett munkára és a beépített anyagokra garanciát adunk! Hevederzárak kínai ajtókra is! Kínai ajtó zárcsere és javítás. Hívjon bizalommal, minőség és szakértelem megfizethető áron! Hevederzár szerelés Budapesten és Pest Megyében. Minőségi hevederzárak kedvező áron, akár 3 év garanciával. Gyors és precíz, kiváló szakmunka a hevederzár specialistától! Személyre szabott vagyonvédelmi szaktanácsadás. A legjobb hevederzár árak! Biztibuk hevederzár, Prezidium hevederzár. Hevederzár zárbetétek kedvező áron. Hevederzár zárcsere, olcsón minőségi anyagokkal. Hevederzárak műanyag ajtókra is!!! Hevederzár kínai ajtóra is!!! Hívhat non-stop!


Feladva: 2016-10-12    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: HevederzárzárcserenonStopBudapestHevederzárakkínaizárszervizjavításajtóáronlakatosajtókraműanyagjavításagaranciávalmindigminőségiadunkgaranciát

Forrás: pepitahirdeto.multiapro.com

A Tilta Gravity G1 egy rendkívül könnyű, egyszerűen kezelhető, csúcsminőségű egykezes gimbal, professzionális használatra. Köszönhetően a 0-tól 3 kg-ig terjedő terhelhetőségének, kompatibilitása egyedülálló: a nehezebb DSLR konfigurációtól, a MILC és GoPro kamerákon át az okostelefonig szinte bármivel használható. Ezt nem csak a kifinomult vezérlésnek és a páratlanul erős motoroknak, hanem az egyedülálló váz-kialakításnak köszönheti, amely hosszabb és erősebb, mint bármely más egykezes ... további részletek >>

gimbalnál. Kiterjeszti az alkalmazhatóságát a gimbal markolat felett elhelyezkedő jobb és baloldali rozetta, amelyre monitor, mobil telefon (élőképhez), follow focus vagy más kiegészítő csatlakoztatható. A Gravity G1 markolata egy mozdulattal eltávolítható és a rozetták segítségével egyszerűen kétkezes gimballá alakítható. A működés finomhangolása bluetooth kapcsolaton keresztül a TILTA Assistant App (Androidra és iPhone-ra) segítségével történik. Bővebben: www.gaia.hu/tilta-gravity-g1-gimbal-stabilizator-grt02g1.html


Feladva: 2017-09-04    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: gimbalgravitytiltamássegítségévelegyszerűenegyedülállóegyegykezesbármelyKöszönhetőenfinomhangolásaerőskameracsatlakoztathatókamerákonBővebbenmint

Forrás: pepitahirdeto.multiapro.com

Trump megnyittatja a Kennedy-gyilkosság titkos aktáit A rejtély, hogy Oswald volt-e a gyilkos, és ha igen, magányos elkövető volt-e, vagy egy szélesebb összeesküvés része, a mai napig nem oldódott meg. Itt olvashatsz róla: www.goo.gl/FCQvko Itt, pedig tovább kereshetsz (Google keresőnk): www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60546


Feladva: 2017-10-27    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: KennedygyilkosságvoltIttwwwFCQvkopageOswaldmaipedig60546napigtovábbPepitagyilkosnemkereshetszHirdetőigenoldódottGoogleajánlásmagányos

Forrás: pepitahirdeto.multiapro.com

Törökbálinton a Depóba raktári takarítási munkára keresünk főállású takarítókat délelőttre, illetve délutánra egyaránt (reggel 6 és délután 18 óra között elosztva 2 x 8 órában átfedéssel). Feladatok: kézi és gépi takarítás egy szép igényes rendezett raktárban. Napi 8 órás munkaidő hétfőtől péntekig, a hétvégék szabadok. Elsősorban férfi alkalmazottat keresnénk, de minden megoldásra nyitottak vagyunk. Jelentkezni telefonon a 20/9-268-790-es számon, illetve önéletrajz küldésével lehet, ... további részletek >>

fizetési igény megjelölésével.


Feladva: 2017-05-29    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: illetveküldésévelátfedésselmindenállásúNapiállásönéletrajzórábankeresnénkkeresünkraktárbantakarítóelosztvaalkalmazottatmunkárarendezettszámon790

Forrás: pepitahirdeto.multiapro.com

Esküvői fehérgalamb röptetést vállalok Tarcal 150 km-es körzetében. A röptetés történhet kosárból 2, 5, 10, 15 vagy 20 galambbal, valamint kézből is engedhető 1-1 galamb. Az összes kategóriához szaktanácsadás jár, a megjelenés és a kosár is alkalomhoz illő. A galambok szállítása Tarcalon ingyenes, Tarcal 150 km-es körzetében 80 Ft/km. Megrendelés telefonon. További információkért az alábbi telefonszámon, vagy üzenetben elérhet! Tegye meghitté élete nagy napját!


Feladva: 2016-01-22    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: Tarcalröptetés150vagyfehérgalambEsküvőikörzetébenjárelérhetszaktanácsadáscímenvállalokkategóriáhozmailröptetéstingyenesösszesTarcalongalambhttp

Forrás: pepitahirdeto.multiapro.com

Minőségi Ablakcsere akció ELŐLEG NÉLKÜL is! Műanyag nyílászárók 6-7 és 8 légkamrás kivitelben kiváló gyári minőségű alapanyagból, garanciával! Ezen túlmenően kínálunk még szintén gyári minőségben redőnyt, rovarhálót és reluxát is bontással-beszereléssel és az esetleges javítási munkálatokkal együtt.


Feladva: 2016-09-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: gyárinyílászárókNÉLKÜLELŐLEGminőségűBudaörsredőnytkiválóZoltánminőségbenkivitelbenMártonlégkamrásegyüttáronszinténmunkálatokkalkedvezőmégEzen

Forrás: pepitahirdeto.multiapro.com

Kitartó, lelkes embereket keresek Bio termékek katalógusból történő árusításához. A munka teljes mértékben otthon végezhető, és nagyon egyszerű, mivel AUTOMATIZÁLT WEBOLDAL segítségével történik, költség és kötelezettségmentesen. Gyes mellett, nyugdíj mellett, de akár munka mellett is, minimális időráfordítással növelheted a bevételed. MUNKATÁRSKÉNT stabil jövedelem lehetősége egy nemzetközi üzlet partnereként - Nincs felső korlát. Annyit kereshetsz, amennyit csak szeretnél. - Az EU ... további részletek >>

országaiban is nyitott a lehetőség! Válassz most BIO készítményeket a mesterséges szemét helyett! Nézd meg a KÍNÁLATOT: www.egeszsegbomba.mylifecare.hu 100% elégedettségi garancia! Regisztrációs és tagsági díj helyett ajándékokkal és folyamatos akciókkal várunk Téged: + AJÁNDÉK utalvány + AJÁNDÉK VIP hűségkártya + AJÁNDÉK katalógus + AJÁNDÉK magazin + AJÁNDÉK termék Hozd létre ingyenesen felhasználói Partner fiókodat és rakd kosárba meglepetéseinket! Ha kedvet érzel hozzá, és szívesen keresnél pénzt ilyen formában, akkor részletesen tájékozódhatsz a weboldalon. Jelentkezzél fel hírleveleinkre is! www.egeszsegbomba.mylifecare.hu A felmerülő kérdéseidre szívesen válaszolok az alábbi e-mail címen: szerencseneked@gmail.com


Feladva: 2016-11-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AJÁNDÉKmellettmunkahelyettszívesenBIOmylifecareegeszsegbombahttphírleveleinkreakciókkalnemzetközikeresekhozzámegcímenHozdszeretnélegyszerűfel

Forrás: pepitahirdeto.multiapro.com

Ásvány ékszerek hihetetlen árakon nagyszerű kedvezményekkel akár 60% kedvezménnyel a Lili Bizsu webáruházban www.lilibizsu.hu Házhoz szállítás már 650 Ft-tól akár ingyenesen is


Feladva: 2017-10-29    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÁsványBizsuLiliakárnagyszerűmárárakonszállításhihetetlenHázhozékszereklilibizsuwwwWEBÁRUHÁZwebáruházbanolcsóniyeningyenesenékszertkedvezménnyel

Forrás: pepitahirdeto.multiapro.com

Tavasszal és nyáron szeretnénk a kertet is élettelivé varázsolni, melyhez jól jön néhány virágos növény! A gyönyörű kékeslilás színben tündöklő törpe levendula sokak kedvence, hiszen kis méretével és illatos virágzatával a kis kertekben is mutatós! A 15-20 cm-re növő példányt nemcsak szabadföldbe, hanem akár cserépbe teraszra vagy erkélyre is ültethetjük, ezzel a panellakás is szebb lesz! Megrendelhető az Üdekert Cserje Webáruházban! www.udekert.hu/product_info.php/pr oducts_id/11914


Feladva: 2016-04-28    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: levendulatörpevagykisCserjeÜdekerthanemWebáruházhiszenlesznéhányszabadföldbekertbenkedvenceszebbjönnemcsakkintsokakpanellakásjólpéldányt

Forrás: pepitahirdeto.multiapro.com

Az argán fa csonthéjas termésének magjaiból, hidegen sajtolással kinyert olaj az argánolaj. Az argan fa a föld egyik legidősebb fafajtája. A világon egyedül Marokkó délnyugati részén él, ellentmondva a sivatag törvényeinek. Illatos olaja Marokkó folyékony aranyának számít, mivel a betegségek megelőzésére és kezelésére szolgál, valóságos élet elixírként. Az argan olaj 80%-ban esszenciális zsírsavakból épül fel, rendkívül magas az alfa-tokoferol (természetes E-vitamin) tartalma, ezen kívül ... további részletek >>

gazdag A- és D-vitaminbanban, így az összetevők magas szabadgyök megkötő tulajdonsága révén megóvja a bőrt a külső és belső károsító anyagok okozta idő előtti elváltozásoktól. Az Argán olaj általános hatásai: gyulladáscsökkentő, fertőtlenítő, nedvesség megkötő, revitalizáló, gombaölő, baktériumölő, vérellátást javító, sejtfalvédő, immunrendszer erősítő, intenzív zsírégető. Felhasználási területe: Fürdés, vagy tusolás után a bőrön vékony, jól befogadható réteget képez. Pattanásokra, ekcémára, neurodermitisre, leégésre fényvédő hatású, védelmet nyújt az UV- sugarak ellen ( 5-ös faktorú), érzékeny- száraz bőrre, hajhullásra, száraz, törékeny hajra (pakolásként csodákat tesz a hajjal), narancsbőr ellen, reumatikus megbetegedések ellen, antioxidáns volta miatt bizonyos daganatos megbetegedések esetén jótékony hatású, érelmeszesedésre, magas vérnyomásra, keringési zavarok esetén, szívkoszorú-ér betegség ellen, a szívinfarktus rizikójának csökkentésére. Ajánlott mennyiség: 3 teáskanál naponta, a kész ételhez fogyasztva. www.solioetolaj.hu/olaj-reszletes/32


Feladva: 2017-07-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: olajellenmagasArgánmegkötőhatásúmegbetegedésekarganMarokkóeseténszárazAjánlottérzékenyfelkinyertrétegetanyagokmegelőzésérereszletesnarancsbőr

Forrás: pepitahirdeto.multiapro.com

Arany, ezüst felvásárlás! Vásárolunk: Aranyat, ezüstöt, arany érméket, ezüst érméket, ezüst étkészleteket, ezüst tárgyakat, kitüntetéseket, mindent, ami aranyból, vagy ezüstből van!


Feladva: 2016-05-02    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ezüstaranyérméketfelvásárlásétkészleteketvanezüstötezüstbőlAranyatvagyVásárolunkaranybólmindentNyíregyházakitüntetéseketAranybazarkfttárgyakat

Forrás: pepitahirdeto.multiapro.com

Ismerkedj biztonságosan személyiség központú társkeresőnkön rejtett költségek nélkül. Miért biztonságos a LoveBuzzler? Beépített funkcióinkkal lehetőséged van tiltani, jelenteni a zaklatókat, továbbá beállításainkban egyéb eszközök is rendelkezésedre állnak, hogy távol tartsd magadtól őket. Személyiség központú, ez mit jelent? Szakértőnkkel - Habis Melinda, klinikai szakpszichológus, pár-és családterapeuta jelölt, személyközpontú terapeuta- segítségével létrehoztunk egy speciális kérdőívet, ... további részletek >>

amely kitöltése során személyiségi diagramot rajzol programunk a legfontosabb emberi személyiségjegyekről pl. megbízhatóság. A kérdésekre adott válaszokat kiszemelted adatlapján megnézheted egyesével. Minden kérdésünk párkapcsolat alapjául szolgáló konfliktushelyzeteket térképezi fel. Ennek köszönhetően már az előtt tudod, miben különböztök, hasonlítotok, mielőtt még elmélyülne a kapcsolatotok. Valamint, azt is, hogy mint veszekednétek már a kezdetektől fogva, amik valószínűleg csak később derülne ki, így megóvhatod magad a csalódásoktól is. Továbbá önmagadat is jobban megismerheted! Szakértői segítség révén online felteheted kérdéseidet, amelyekre kiváló szakemberünk Habis Melinda és kollégái válaszolnak. Nem hagyunk magadra! Megéri kipróbálni! 3 napig minden új regisztrálónk használhatja a LoveBuzzler társkereső minden funkcióját, úgy mintha fizetős tagja lenne oldalunknak. Ha lejár a három nap akkor ugyanúgy ingyen használhatod tovább, csak korlátozottan, amelyet feloldhatsz havi fix. egyszeri tagsági díj megfizetése után. Nincsenek csomagjaink csak egyszeri díj, így mindenki egyenlő esélyek mellett ismerkedhet!


Feladva: 2017-06-24    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: lovebuzzlerközpontúSzemélyiségmindencsakhogytárskeresőMelindaHabisígydíjmárbiztonságosTovábbáegyszeribeállításainkbancsomagjainkmagadraprogramunk

Forrás: pepitahirdeto.multiapro.com

Befektetőt, társat keresünk, 50-100 Mft-tal, azonnal kezdhető társasházak építéséhez, közre működéssel vagy a nélkül. Biztos megtérülést, garanciát, biztonságot ajánlunk. Biztosan Ön is tudja, hogy most lakásokba megéri befektetni. Jelentkezni a haza i@upcmail.hu e-mail címen.


Feladva: 2017-10-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: építéséhezkeresünkBefektetőthogyközrepesttudjaKftBiztosantársasházakcímenFinancialajánlunkkezdhetőmailEurópabiztonságotazonnalhazai@upcmailtal

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! A Szuvorov Kft. édesipari termékek importálásával és forgalmazásával foglalkozik. Szeretnénk, hogy minél több helyen jelenjenek meg termékeink, ezért várjuk viszonteladók jelentkezését! Szerződött partnereinknek akár kizárólagos forgalmazási jogot tudunk biztosítani, terület megjelöléssel! Az ország távolabbi pontjain található kiskereskedelmi egységek számára, (megrendelt mennyiségtől függően) ingyenesen szállíttatjuk ki megrendeléseiket. Termékeink ... további részletek >>

megtekinthetőek a honlapunkon.


Feladva: 2016-10-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TermékeinkSzuvorovtalálhatóUramakárminélpontjainHölgyempartnereinknekhogymegrendeléseikettávolabbiTiszteltSzerződöttSzeretnénkszállíttatjukország

Forrás: pepitahirdeto.multiapro.com

Kínálatunkban több mint 1000 féle fa bútor. Prémium minőségű tömörfa bútorok, szállítás Magyarország teljes területére.


Feladva: 2017-10-04    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: bútortömörfaPepitaminőségűMirekPrémiumféle1000területéremintteljestöbbMagyarországKínálatunkbanszállításajánlásbútorokHirdető

Forrás: pepitahirdeto.multiapro.com

ÜZLET AHOL SENKI NEM VESZÍTHET! SunMoney az első világot behálózó KÖZÖSSÉGI NAPERŐMŰ PROGRAM - Az üzletet építheted online is - Itt nincs havi kötelező befizetés - Itt nem terméket kell venni, hanem egy termelő eszközt vásárolunk


Feladva: 2016-09-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemIttsunmoneywebofficeSENKIegyonlinehttpsAHOLhanemépíthetedRegisztrációÜZLETvenniüzletetcomTiborkellPROGRAMsunmoneyonlineNaperőművedbotibi

Forrás: pepitahirdeto.multiapro.com

Gyerekeknek, fiataloknak kreatív díszpárnák. Csiga díszpárna, teknős díszpárna, katica díszpárna, pillangó díszpárna, egér díszpárna, kutya díszpárna és még sok más... www.atalakulok.hu/termekkategoria/ diszparnak


Feladva: 2016-11-12    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: díszpárnadíszpárnákmásokkreatívsokanfiataloknakmégGyerekekneksepalakutyaállatosegérpillangókaticateknőscsiga

Forrás: pepitahirdeto.multiapro.com

Túl lassú, vagy költséges szállítási megoldást javasoltak mások? Kérje ajánlatunkat és legközelebb is hozzánk fog fordulni! Európán belül széles kapcsolati rendszerrel dolgozunk, egy feladatra több alternatíva közül tudjuk kiválasztani az Önnek legideálisabb megoldást.


Feladva: 2017-07-11    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: SzállítmányozásmegoldástbelülEurópánTúltöbbhozzánkajánlófeladatralegközelebbHirdetőegyajánlatunkatPepitadolgozunkKérjerendszerrelmásokszállítás

Forrás: pepitahirdeto.multiapro.com

Hozzávalók a tésztához: 2 tojás 1 bögre cukor 200 g tehéntúró 1 kiskanál szódabikarbóna 1/2 kiskanál só 2 bögre liszt kókuszreszelék (a díszítéshez) Hozzávalók a krémhez: 3 tojássárgája 6 evőkanál cukor 5 evőkanál liszt 7 dl tej vaníliaaroma 200 g vaj Verjük fel a tojást a cukorral, majd adjuk hozzá a tehéntúrót, a szódabikarbónát, a sót és egy bögre lisztet, keverjük össze habverővel vagy kézi robotgéppel. Adjunk hozzá még egy bögre lisztet és keverjük össze. Tegyük ... további részletek >>

hűtőszekrénybe 60 percre a tésztát. Készítsük el a krémet: Keverjük ki a tojássárgáját a cukorral majd tegyük bele a lisztet és a tejet, kavarjuk össze habverővel vagy robotgéppel, lassú tűzön kezdjük főzni. Közben folyamatosan kavargassuk, amikor elkezd főni vegyük le a tűzhelyről és ízesítsük vaníliaaromával, hagyjuk hűlni. A vajat alaposan habosítsuk fel és keverjük hozzá a krémet. Vegyük ki a hűtőből a tésztát és osszuk 6 egyenlő részre, nyújtsunk belőle 6 lapot. Előmelegített sütőben, vajjal kikent tepsi hátulján süssük mindegyik lapot pár percig, amíg egy kis színt kapnak. A tortalapokat kenjük meg a krémmel és tegyük őket egymásra, szórjuk meg kókuszreszelékkel. Hagyjuk állni pár órát, majd szeleteljük. Jó étvágyat! www.webcukraszda.hu/bogres-raffaello-torta/


Feladva: 2017-04-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: keverjükbögrelisztettegyükmajdegyhozzáösszemegliszttésztáthagyjukevőkanálcukorVegyükkrémetcukorralrobotgéppelHozzávalókvagytortahabverővel

Forrás: pepitahirdeto.multiapro.com

Rozsdamentes fazék 40 liter, Perfect Home 12740 Anyaga: rozsdamentes acél Mérete: átmérő 42 cm; szélessége füllel: 49 cm; magassága: 40 cm Űrtartalma: kb. 40 liter Súlya: 2,73 kg Használható: gáz-, elektromos-, kerámialapos tűzhelyen Tisztítása: Semleges folyékony mosogatószerrel mossa el. Kerülje a karcosodást okozó szerek és eszközök használatát! www.fullmarkt.hu/Rozsdamentes-faze k-40-liter-Perfect-Home-12740


Feladva: 2017-09-21    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: Rozsdamentesliterfazek12740HomePerfecthasználatáttűzhelyenMéreteeszközökkerámialaposacélszerekelektromosAnyagaokozógázajánlókarcosodástHirdető

Forrás: pepitahirdeto.multiapro.com

Ez a vergődés ismétlődik már több éve hónapról hónapra? Változtasson rajta! Változtatás nélkül nincs változás! Ha nem változtat az életén, akkor mitől vár változást? Élni akarja az álmait vagy álmodni a céljait? Ugye nagyszerűnek tűnik, hogy hetente akár több ezer Dollárt is kereshet játszi könnyedséggel? Minden internetes munkával foglalkozó ember álma egy ilyen lehetőség, de a helyzet az, hogy az álom ez esetben mindenképpen csak álom marad. Több átveréssel is lehet találkozni az internetes ... további részletek >>

munka lehetőségek közt. Ha ilyen kétes kimenetelű ajánlatot keres, akkor csalódni fog. mert nem Önn ek szól. Munkát ajánlunk kiemelten magas fizetésért. Az okos ember előre gondolkodik, a buta a múltban él, és a még butább azt gondolja, hogy ha nem tesz semmit sem, akkor sokkal jobb lesz Neki! Sajnos ezért is sok család fog úgy élni, mint most, sok év múlva is, sőt sokkal rosszabbul! Ajánlat azoknak, akiknek komoly céljai vannak és olyan havi jövedelemre van szükségük, amelyből kényelmesen biztosíthatják családjuk megélhetését: / kb. 500.000,- / hónap / Pl: Első sorban több szabadidővel rendelkezők, kiskeresetűek széles kapcsolatokkal rendelkezők vagy több gyermekes családok, stb. Munkaidő: Heti 30 – 40 óra Egyedülálló, rendkívülien magas jutalékkal keresek olyan embereket, akik széleskörű ismeretséggel és kapcsolatokkal rendelkeznek! Jelentkezzen ha konkrét céljai vannak, mindenben segítek. Kérem, hogy az email címemen jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-05-08    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogytöbbnemakkorolyanélnivannakembercéljaimagasspórolvagyfogálombárrendelkezőkfizetésébőljelentkezzenilyenkapcsolatokkalsokkalvégéigjön

Forrás: pepitahirdeto.multiapro.com

Ha Ön is szereti az izgalmas mozgalmas filmeket, megdöbbentő videókat, retró, vagy mai zenét halgat szívesen, akkor ezzel a YouTube válogatással további keresés nélkül ingyen megteheti.


Feladva: 2014-12-01    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: hathazizenétzenékmegtehetimaivideókingyenvagyFilmeknélkülretrókeresésvideókattovábbimegdöbbentőyoutubeválogatássalfilmeketezzelmozgalmasakkor

Forrás: pepitahirdeto.multiapro.com

Az MSZP elnökségében úgy döntöttek, egyeztetnek a volt külügyminiszterrel. Felmerült Balázs Péter volt külügyminiszter neve mint ellenzéki közös miniszterelnök-jelölt, ám erről egyelőre nincs megállapodás. A teljes cikk: www.hvg.hu/itthon/20171031_Leulne_ az_MSZP_Balazs_Peterrel


Feladva: 2017-10-31    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: MSZPvoltPeterrelBalázsLeulnemegállapodásPepitanincsPéterBalazskeresikegyelőreSokanerrőlFelmerültjelöltkülügyminiszterrel20171031miniszterelnök

Forrás: pepitahirdeto.multiapro.com

Szálláshelyek és szállásfoglalás Erdélyben. Foglalja le már most erdélyi szálláshelyét, nyaralásához. Erdelybe.hu és szallas-erdely.hu oldalainkon válogatott erdélyi szálláshelyeket találhat. Szálláshelyeinknen már többezer elégedett vendégünk megfordult. Az erdélyi szálláshelyek közül csak a legjobbakat válogattuk ki Önnek, hogy egyszerű legyen a választás.


Feladva: 2017-02-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekerdélyimárErdélybentöbbezerszálláshelyétÖnnekmostválogattukSzálláshelyeinknenFoglaljalegjobbakattalálhatcsakszálláshelyeketszállásfoglalás

Forrás: pepitahirdeto.multiapro.com

Label automata ajtó, tolóajtók, nyílóajtó automatikák, kapu automatikák, üvegvasalatok, mobil üvegfalak A LABEL automata ajtókban és nyílóajtó automatikákban a LABEL spa. cég évtizedek óta felhalmozódó technikai fejlesztésének eredménye mutatkozik meg. Az olasz design és a német precizitás ötvöződik a meghajtásokban. Típusválasztékunk lehetővé teszi, hogy minden helyre a leghatékonyabb megoldást ajánljuk. Az új szabályozások, az akadálymentesítés szükségessége, a jobb ... további részletek >>

megközelíthetoség következtében a nagyobb forgalmú, vagy egyéb hivatali helyiségek bejáratát célszerű automatizálni. Ezekre a feladatokra kínálunk költségtakarékos, energiahatékony megoldásokat. Igény szerint partnereinkkel együtt, akár a teljes akadálymentesítési feladatot megoldjuk a meghajtásokban. Cégünk munkatársai díjmentes szaktanácsadással segítenek a legoptimálisabb megoldás kialakításában.


Feladva: 2016-08-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: LABELautomataautomatikákmeghajtásokbannyílóajtóüvegfalakmobilszerintötvöződikhelyiségekótamunkatársaiszabályozásoküvegvasalatokIgényprecizitásCégünk

Forrás: pepitahirdeto.multiapro.com

A mosott kavics 16-32 ára bruttó 4200 Ft/m3. A folyami kavics 16-32 ára bruttó 4200 Ft/m3. A dunai kavics 16-32 ára bruttó 4200 Ft/m3. A dísz kavics ára bruttó 5842 Ft/m3. A gyöngy kavics ára bruttó 5842 Ft/m3. Az osztályozott kavics ára bruttó 5842 Ft/m3. A rostált kavics ára bruttó 5842 Ft/m3. A bánya kavics ára bruttó 3500 Ft/m3. A töltő kavics ára bruttó 3000 Ft/m3. A mosott dunai folyami kavics 24-40 kerti utak, parkok lefedésére, a rostált osztályozott dísz kavics 16-32 ... további részletek >>

lábazatok díszítéséhez, szikkasztóhoz, a gyöngy kavics 4-8 és a gyöngy kavics 8-16 parkok, játszóterek lefedésére, a bánya és a töltő kavics terület feltöltésre, szerelő beton alá használható. A mosott kavics, osztályozott kavics, dísz kavics, gyöngy kavics, kulé kavics, rostált kavics, töltő kavics kapcsán felmerülő kérdéseikre szívesen válaszolunk, e-mail címünk és telefonszámaink honlapunkon megtalálhatóak.


Feladva: 2016-10-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kavicsbruttóáragyöngydíszosztályozottmosott5842rostált4200töltőfolyamidunaikulébányalefedéséreparkokfeltöltésrehonlapunkonszállításterület

Forrás: pepitahirdeto.multiapro.com

Olcsó, gyors személyszállítást végzünk Ausztriába, Németországba


Feladva: 2017-03-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: NémetországbavégzünkszemélyszállítástgyorsOlcsóBudapestEutaxiKisbusszalAusztriába

Forrás: pepitahirdeto.multiapro.com

Biokandalló gyártás, BIOKANDALLÓ forgalmazás. BIO KANDALLÓ AKCIÓ! BIOKANDALLÓ VÁSÁR! Falra szerelhető BIOKANDALLÓ, Falba építhető BIOKANDALLÓ, Körbeépíthető BIOKANDALLÓ. Sarokba szerelhető BIO KANDALLÓ Asztali BIOKANDALLÓ. BIO ETANOL, BIOETANOL forgalmazás. A BIOKANDALLÓK bio ETANOLLAL üzemeltethetőek. A rozsdamentes anyagból készült BIOKANDALLÓ égők hosszú élettartamot biztosítanak BIO KANDALLÓINKNAK. Minden biokandalló égő szabályozható teljesítményű, így az égési idő széles ... további részletek >>

tartományban változtatható. A biokandallók az égés folyamán csak vízpárát és egy nagyon kevés szén dioxidot termelnek, ami teljesen veszélytelen a szervezetre. A BIOKANDALLÓNAK NEM KELL kéményt építeni! Nincs CO MÉRGEZÉS VESZÉLY! A biokandalló használatánál csak szellőztetni kell, így pótolva a friss levegő utánpótlást. www.biokandalló.com


Feladva: 2016-11-11    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: biokandallóBIObiokandallókAKCIÓgyártásKANDALLÓszerelhetőígykellcsakforgalmazásVÁSÁRcomhasználatánálamiBIOETANOLváltoztathatóVESZÉLYbiztosítanak

Forrás: pepitahirdeto.multiapro.com

AZOKNAK AKIK NEM AKARNAK ELŐRE BEFEKTETNI!!!! Csatlakozz hozzánk. Teendőd ingyenesen beregisztrálni és saját linkeden ingyenes tagokat gyűjteni. Miből lesz a pénzed?? Ha ügyesen dolgozol, gyűjtöd az ingyenes tagjaid, valaki a felső vonalból be fogja aktiválni az irodád, magyarul elindítja a te üzleti vállalkozásod. Ahogy érkezik irodádba a jutalékod, eldöntheted, fejleszted tovább, vagy megelégszel azzal a plusz jövedelemmel amit így fogsz elérni. A felső vonal nem csak téged fog ... további részletek >>

aktiválni, hanem azokat az ingyenes tagjaid is, akik szintén gyűjtik saját tagjaikat. Itt nem kell kattintgatni, videót nézni!! Semmi más dolgod nincs, mint ingyenes tagokat csatlakoztass. A regisztrációhoz szükséges adatokat emailben küldjed meg nekem! Teljes név, az üzletben használni kívánt felhasználó név, email cím, jelszó, Facebookos elérhetőséged.


Feladva: 2017-09-29    [Pénzkeresés - MLM]

Címkék, kulcsszavak: ingyenesnemaktiválnitagokatüzletinévsajátFelsőakiktagjaidkattintgatniérkezikKálváriaFacebookoshanemdolgozolRegisztráciohózjövedelemmelCsatlakozz

Forrás: pepitahirdeto.multiapro.com

Alumínium zsalugáterek készítését vállaljuk — A FEMARKZSALU Kft új szolgáltatása: ajtó- és ablakzsaluk készítése alumíniumból. A számos variáció közül ajánljuk a védő zsalugátereket (biztonsági és nem biztonsági) típusban. Kérje ajánlatunkat méret szerint! www.femarkzsalu.hupont.hu/9/alumin ium-zsaluk-keszitese


Feladva: 2017-04-04    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: biztonságiKftFEMARKZSALU8212közülvállaljukszerintvariációkészítésétméretszámoszsalugáterekajánlatunkatalumíniumbólAlumíniumKérjekészítésetípusban

Forrás: pepitahirdeto.multiapro.com

Az álmok jelentése a legtöbb embert érdekli. A tudomány sem cáfolja azt a nézőpontot, miszerint álmunkban legbensőbb világunk jelenik meg, félelmeink, vágyaink, reményeink vetülnek ki különböző fantáziákba szőve. Az álom működése azonban még ma sincs teljesen megfejtve. Hogy mit üzennek, gyakran csak találgatni tudjuk, máskor pedig egészen egyértelmű, hogy a napközben átélt helyzeteket dolgozzuk fel általuk. Az álmok megfejtése napjainkra egyfajta “tudományággá” vált, sokszor ... további részletek >>

segítségül hívhatjuk a különböző lelki problémák, konfliktus- és stresszhelyzetek feldolgozásához.


Feladva: 2016-11-08    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: jelentéseálomhogykülönbözőmégálmoktudjuksegítségülműködésefelálmunkbantalálgatniKittisokszordolgozzukmiszerintcsakKellérváltszővehelyzeteket

Forrás: pepitahirdeto.multiapro.com

Egy gyulladáscsökkentő gyógyszer sokat segíthet, ám ártalmaitól, káros mellékhatásairól sem szabad megfeledkezni! Sokan már csak akkor foglalkoznak ezekkel, amikor túl késő. Legyünk előrelátóak, hiszen van megoldás gyógyszerek nélkül élni! A természetes gyulladáscsökkentők közül mind több szakember ajánlja figyelmünkbe a fekete berkenye előnyeit. Ez az eredetileg Észak-Amerikában honos gyógynövény étrendkiegészítőként ma már az egyik legnépszerűbb erre a célra. Mint vény nélkül kapható ... további részletek >>

gyulladáscsökkentő, csupa természetes hatóanyaggal segít legyőzni a gyulladásos folyamatokat, melyek megelőzésében is hatásos. www.aronia.berkenye.com/gyulladascsokkento/


Feladva: 2017-06-20    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: gyulladáscsökkentőnélkülgyógyszerektermészetesmárétrendkiegészítőkéntszabadtöbbKittielőrelátóakgyógynövénysemhatásosszakemberberkenyébőlkaphatókéső

Forrás: pepitahirdeto.multiapro.com

2 szoba, 4+3 fő (ágyneműt biztosítunk), nappali+étkező, felszerelt konyha, hűtőszekrény, gáztűzhely, mikrohullámú sütő, kávéfőző, tusolós fürdőszoba, WC, klíma (hűtés-, fűtés), TV, jakuzzi, kandalló (fa díj ellenében biztosítva), füvesített kert, parkoló, 12 nm-es móló+csónak, horgászatra, fürdésre, fedett terasz, hintaágy, kerti bútorok, bográcsozás, grillezés (tűzifát igény esetén biztosítok!), gyerekeknek homokozó, lengőteke, fürdőmedence bérlési lehetőség, 3db kerékpár is biztosított!


Feladva: 2016-07-20    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kandallóbiztosítokhűtőszekrényfürdésreKöröspartihorgászlakjakuzzieseténkonyhahorgászatrabiztosítottfűtésigényfelszereltcsónakkerékpárhűtéstűzifát

Forrás: pepitahirdeto.multiapro.com

Megújult műsorral, új felállásban vállalunk fellépéseket: - falunapokon - céges rendezvényeken, bálokon. Hívjanak bizalommal. Élőzenés előadás, nem playback! Elérhetőségek és ízelítő a műsorokból a honlapon hallgatható formában. CD rendelést felveszünk Ének: Lehoczky Judit - retró - örökzöldek (angol, német, olasz nyelven) - magyar nóta - csárdások - cigány dalok - mulatós - operett német nyelven - német slágerek (német nyelven)


Feladva: 2017-04-04    [Zene - Hangszer]

Címkék, kulcsszavak: németnyelvenhonlaponJuditLehoczkyÉneklehoczkyjuditBennünketolaszkezdjükhttpBizalommalangolfelállásbanhallgathatóhívjanakörökzöldekműsorralbálokon

Forrás: pepitahirdeto.multiapro.com

A gránátalma ital hatásai legintenzívebben kúraszerű fogyasztás mellett érezhetők. A természet egyik legerőteljesebb gyümölcsének kivonata számos gyógyhatással rendelkezik, melyet az emberiség évezredek óta ismer és alkalmaz. Hogy mégis mire jó a gránátalma? Legtöbben magas antioxidáns tartalma miatt fordulnak hozzá, melynek révén lassítja az öregedés folyamatát és enyhíti annak látható jeleit. Bőrfeszesítő és hajszépítő hatása legendás. www.granatalma.bolt.hu/granatalma- hatasa


Feladva: 2016-08-31    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: granatalmagránátalmabolthatásaialkalmazBőrfeszesítőlegerőteljesebbfordulnakélettaniismerjeleitegyikmiattótaláthatótermészettartalmaévezredekannak

Forrás: pepitahirdeto.multiapro.com

LEGYEN A TE TORTÁD IS EGYEDI! TortaFoto.eu - A weboldal ostya és cukorlap nyomtatással foglalkozik! Tortadíszítés, szülinapi torta, fényképes torták a saját fotóddal! Szállítás országosan!


Feladva: 2017-02-14    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TortaFotoSzállításostyafotóddalweboldalsajáttortákEGYEDIfényképesTORTÁDtortaLEGYENszülinapiOrszágosTortadíszítésfoglalkoziknyomtatássalországosan

Forrás: pepitahirdeto.multiapro.com

Tartsd hűvösen! Esemény és fesztivál parkolás a Blaha Lujza tér, Akácfa utcában, az EZ Parkolóban! Rendezvény, fesztivál, szezonális, 30 napra érvényes, fedett, biztonságos parkolás, főként a fővárosban nyaralók, fesztiválozók, turisták, eseményeken részvevők részére! A több előnyt nyújtó szezonális parkolóházi ajánlat, EZ Akácfa Parkolóház, www.ezpark.hu/fesztival-parkolas online felületről érhető el, és a befejezett rendelést követően azonnal igénybe vehető.


Feladva: 2017-06-12    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: parkolásfesztiválAkácfaszezonálisnyújtóonlineBlahaelőnytbiztonságosparkolasEseménytöbbfedettfesztivalhűvösenrészérevehetőérvényesezparkTartsd

Forrás: pepitahirdeto.multiapro.com

Szeretne gyorsan weblapot? Kínálatunkban előzetesen megtekinthető, kattintható kész weblapok közül válogathat. Jelenleg 50 különböző kész weblap közül tud választani. De van itt még valami ... Bevezető akciónk keretében most reklám és látogató növelő szolgáltatást is biztosítunk minden olyan weblap megrendelőnknek, aki lakosságnak szolgáltat, vagy értékesít és a rendelésével eléri a 20.000 Ft-ot akár egy összegben, akár a második negyedéves díj befizetése után.


Feladva: 2017-10-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: mégakárweboldalaweblapnincsÖnnekközülkészakiSzeretnekeretébenkülönbözőmegrendelőnknekakciónkösszegbenJelenlegBevezetőegyválogathatolyanvalami

Forrás: pepitahirdeto.multiapro.com

Exkluzív olasz italtartó földgömbök, sakkasztalok széles választékban. Rövid szállítási határidővel.Megrendelheti honlapunkon, vagy személyesen üzletünkben. 1093 Budapest közraktár utca 20./a www.matracfutar.hu www.lineaflex-butor.hu


Feladva: 2017-02-15    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: BudapestsakkasztalokolaszlineaflexwwwItaltartókmatracfutarszállításiutcaRövidközraktárválasztékbanszéles1093üzletünkbenföldgömbökszemélyesenvagy

Forrás: pepitahirdeto.multiapro.com

Rejtett Kamerák raktárról otthoni és ipari használatra is! www.kameradepo.hu/komplett-rejtett -kamera-rendszer


Feladva: 2017-06-14    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: RejtettBudapestKameradepokészletünketóriásimeghasználatraNézzeipari8211otthoniKamerarendszerekraktárrólKamerák

Forrás: pepitahirdeto.multiapro.com

Bádogosbolt! A következő termékeket lehet kapni: Csatorna és hozzátartózó termékek. Alumínium, színesalu, horganyzott, horgany, vörösréz egyedi termékek. Kéményszegély, szegélylemezek, csúcsdíszek, hófogók, szerszámok, szegecsek. Nyitva: H-P. 7:30-17 h-ig, Szomb. 8-13 h-ig (Páros héten)


Feladva: 2016-10-16    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: termékekPomáz2013SzinesaluKftszerszámokAluminiumkerhofogokhozzátartózóTomcsúcsdiszekCsatornaNovaszegélylemezekkapniu23KéményszegélylehetOrgona

Forrás: pepitahirdeto.multiapro.com

A Kingtel egy eddig még sohasem látott távlatot kíván megismertetni önökkel a Mobiltelefonok rohamosan fejlődő világában. Főbb szolgáltatásaink: Mobiltelefon Táblagép Telefonok a Boltunkban Gyári Tartozékok Kiegészítők iPhone Szerviz Android Szerviz Kijelző Felújítás Minden használt Mobiltelefont és Táblagépet készpénzért azonnal megvásárolunk vagy beszámolunk a legmagasabb piaci áron!


Feladva: 2017-09-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: MobiltelefonTáblagépKingtelSzervizszolgáltatásainkMindenlátottáronTelefonokhasználttávlatotBoltunkbanMobiltelefontkívánGyáriTáblagépetmegismertetni

Forrás: pepitahirdeto.multiapro.com

Szakkísérői vizsga túlméretes szállítmányokhoz! 138.000 Ft/fő teljes áron, részletfizetési lehetőséggel! Jelentkezési feltételek: ”C” kategóriára érvényes vezetői engedély valamint legalább 5 év gépjármű vezetési gyakorlat, bármely nemzetközi kategóriában. Várjuk jelentkezését! Tel: 0620-248-4700; 0620-248-68-18; www.fuvinfoiroda.hu/tanfolyamok/eg yeb-kepzesek/szakkiseroi-tulmeretes -szallitmanyokhoz


Feladva: 2017-04-03    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: május8221túlméretesvizsgaJelentkezésiSzakkísérői2480000620jelentkezésétextranemzetköziVárjukmostbármelyfeltételekhétfőszállítmányokhozgyakorlat

Forrás: pepitahirdeto.multiapro.com

Tudtad, hogy 2016-tól a Gördeszka Olimpiai sportág? Végre :) Most meg tudod mutatni, ki vagy. Tanulj a Legmagasabb szintű módszerrel. Kerüld az ”utcán haveroktól v. önállóan megtanulom” elvet. Hacsak nem akarod, hogy 30 éves korodra széthulljanak az ízületeid, ínszalagjaid, csontjaid. A sikered 100%-ig attól függ: - ki az oktatód - milyen a technikai-módszer Őrizd meg az egészséged. Legyél Pro deszkás. Tanulj a Legjobb módszerrel. Juss ki akár a 2020-as Olimpiára. ... további részletek >>

Teljesen kezdő vagy? Rémület fog el, ha az esésekre gondolsz? 1) 90 perc alatt 2) Teljesen a Nulláról 3) Alap szinten 4) Stabilan 5) Baleset nélkül, esés-mentesen megtanítunk gördeszkázni.


Feladva: 2017-07-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: 8221meg2020TeljesenakárJussGördeszkamódszerrelhogyTanuljvagyLegyéltudodsikeredPepitaszintenkezdőelvetegészségedMostcsontjaidOlimpiaAlap

Forrás: pepitahirdeto.multiapro.com

Rendelj az USA-ból, vagy Angliából, mi elhozzuk! Ruhaneműtől az autóig.


Feladva: 2014-09-18    [Vegyes hirdetések]

Címkék, kulcsszavak: USARendeljidealerAngliábólvagybólwwwautóigRuhaneműtőlelhozzuk

Forrás: pepitahirdeto.multiapro.com

Weboldalak üzemeltetőjeként és keresőmarketingesként biztosan kijelenthetem, hogy az internetre tartalmakat elhelyezők döntő többsége egyáltalán nem foglalkozik azzal, hogy amit készít, az megjelenjen - például a Google - keresésekben! Végeztem egy saját felmérést, ami alapján úgy tűnik, van egy általános elképzelés arról, hogy ez a kereshetőség vagy: - magától megtörténik - nem a tartalom készítőjének a feladata - a szolgáltató dolga a kereshetőség biztosítása A válaszok alapján ... további részletek >>

megdöbbentem, de ezek után egyáltalán nem csodálkozom sokak internetes eredménytelenségén... Nem szeretnék játékrontó lenni, tehát a Pepita Hirdető szabad felületei változatlanul elérhetőek lesznek még a játszadozóknak is. Azoknak azonban, akik már a játszadozáson túl vannak, jó pár lehetőséget kínálhatok ingyenesen is és több-kevesebb befektetéssel egyaránt. A legkomolyabbaknak maximum 30.000 Ft éves költséggel! Automatákkal nem, automataként viselkedőkkel szintén nem, viszont azokkal, akik jó kereshetőséget szeretnének webtartalmaiknak szívesen beszélgetek, levelezek! Fentiek alapján ez NEM FELHÍVÁS hirdetés feladására, az legyen tudatos és tervezett inkább...


Feladva: 2017-05-30    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: NEMalapjánhogyegyakikegyáltalánHirdetőPepitavagykereshetőségtudatospárdolgainternetrewebtartalmaiknakelérhetőekáltalánosbetűkkelévesinternetes

Forrás: pepitahirdeto.multiapro.com

Varázslatos gyermek ruhák – Vásárolj olcsón otthonról! Új tavaszi,nyári kollekció amivel kislány álmok válhatnak valóra! Gyors szállítás! Új és használt kislány alkalmi és ünneplő ruhák elérhető áron.


Feladva: 2017-04-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: ruhákkislányáronelérhetőhasználtolcsónszállításVásároljGyors8211valóragyermekválhatnakVarázslatosálmokBudapestamivelButikkollekcióManóruha

Forrás: pepitahirdeto.multiapro.com

A szálláshely szobái légkondicionáltak (csak a tetőtéri szobák) , TV-vel, hűtővel felszereltek. Minden szobához zuhanyfülkés fürdőszoba tartozik. Lehetőség van számítógépes csatlakozásra, internet használatra. Vendégeink még teljesebb kikapcsolódását medencével és hozzá kapcsolódó szaunával szolgáljuk.


Feladva: 2017-03-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: medencéveltartoziklégkondicionáltakkikapcsolódásátfürdőszobaszobáiteljesebbzuhanyfülkésszálláshelymégszobáhozSzékesfehérvárVendégeinkMindenIgnácPap

Forrás: pepitahirdeto.multiapro.com

D-vitamin az egyik legalapvetőbb, legtöbb szervre ható építőeleme az emberi szervezetnek, amely hatással van nemcsak a csontok és az idegrendszer fejlődésére, de az immunrendszer működésére is. A magyar lakosság 95 százaléka D-vitamin hiányos. Ajánlott, októbertől - márciusig a D-vitamin kapszula formában történő bevitele!


Feladva: 2016-12-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vitaminvanFerencnéhiányoshatássalKerepesiszázalékaamelyalapfeltételelakosságszervezetnekbeviteleéletmagyaremberitörténőnapfényműködéséreformában

Forrás: pepitahirdeto.multiapro.com

A bélflóra egészségünk szempontjából hasznos és káros baktériumokat is tartalmaz. Több száz mikroorganizmus él itt, alapvetően egyensúlyban. Ám számos tényező van, ami ezt az egészséges egyensúlyt felboríthatja, pl. a stressz, a dohányzás, az alkoholfogyasztás és az antibiotikumok. Miért fontos a bélflóra helyreállítása? A károsodott bélflóra nem tud kellő támogatást nyújtani az immunrendszernek, így ha nem gondoskodunk a regenerálásáról, hosszútávon egészségünk romlani kezd, akárcsak a ... további részletek >>

közérzetünk, vitalitásunk. Ha gyakran kapunk el fertőzéseket, gyanakodhatunk! A bélflóra helyreállítása probiotikummal 100%-ban természetes módon történhet.


Feladva: 2017-04-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: bélflórahelyreállításaegészségünkfontosMiértnemkellőprobiotikummalegészségesTöbbromlanitudezttartalmazkárosodottamibaktériumokathosszútávonvan

Forrás: pepitahirdeto.multiapro.com

Márványcsiszolás, mészkőcsiszolás, gránitcsiszolás, terrazzocsiszolás, grescsiszolás, betoncsiszolás, műkőcsiszolás, cement anyagok csiszolása Magyarországon, Romániában, Szlovákiában, Horvátországban, Németországban, és Ausztriában. www.everfloor.hu +3630/298-4353


Feladva: 2017-04-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: mészkőcsiszolásRomániábanMárványcsiszolás4353MagyarországonKatalin298csiszolásaNagy3630anyagokPadlócsiszoláseverfloorcementwwwműkőcsiszoláshttp

Forrás: pepitahirdeto.multiapro.com

Nem érted a spanyol múlt időket? Magas a subjuntivo? Kevered a spanyol névmásokat? Akkor neked is segítenek spanyol videós minitanfolyamaim! A 3-6 videóból álló minitanfolyamok 1-1 nehezebb nyelvtani vagy szókincs témát dolgoznak fel. Minden tanfolyam első videója ingyenesen megnézhető!


Feladva: 2016-10-27    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: spanyolminitanfolyamoknévmásokatingyenesenJusztinnehezebbKeveredvideójavideókkalsubjuntivoelsőtanáriállóMagastanfolyamvideóbólidőketMindenmúlt

Forrás: pepitahirdeto.multiapro.com

Modern és klasszikus olasz gyerekbútorok prémium kivitelben. Számtalan színből és elemből válogathat. Látogasson el üzletünkbe. 1093 Budapest Közraktár utca 20./a Telefon: 061-215-33-74


Feladva: 2017-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: olaszwwwBudapest1093klasszikusmatracfutarüzletünkbeModernLátogassonBútoráruházlineaflexbutorválogathatLineaflexwebelembőlgyerekbútor215színből061

Forrás: pepitahirdeto.multiapro.com

Az elhunyt hamvasztásának és hamvainak hozzátartozó részére történő átadásának lehetőségeiről, körülményeiről és a szolgáltatás díjáról kaphat részletes információt. A Gyászhuszár Temetkezés munkatársai elintézik Ön helyett a bürokratikus tennivalókat, melyek az elhunyt hamvasztásának megszervezése során felmerülhetnek. HamvasztásTemetkezési szolgáltatás kedvező áron Budán a Móricz Zsigmond körtérnél és Pesten az Igazságügyi Intézetnél!


Feladva: 2017-09-30    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: TemetkezésGyászhuszárhamvasztásánakelhunytszolgáltatásmelyekkörülményeirőlHamvasztásTemetkezésitennivalókatIntézetnéllehetőségeirőlbürokratikusIgazságügyi

Forrás: pepitahirdeto.multiapro.com

Cégünk a nagy múltú olasz Eva Calor termékeit forgalmazza,melyek közt találhatók légbefúvásos és csatornázható pellet kályhák, kandalló betétek, vízteres pellet kályhák. Működésük korszerű elektronikának köszönhetően teljes biztonság mellett automatikusan történik. Pellet kályháink mellett szóló érvek: automatikus gyújtás, működése előre beprogramozható akár a hét mindennapjára, a leggazdaságosabb modern fűtési technológia, a gyorsan elért beállított hőmérséklet után EKO üzemmód vagy STAND BY ... további részletek >>

állapot, rendkívül magas hatásfokú és környezetbarát megújuló tüzelőanyaggal működő készülékek. A ma elérhető automata fűtési rendszerek közül a legolcsóbb a pellettel való fűtés!


Feladva: 2017-09-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: pelletkályháknagyfűtésimellettautomatikusantüzelőanyaggalhétmúltúEKOkandallótörténikműködőmindennapjáraolaszüzemmódbetétekkályháinkkészülékek

Forrás: pepitahirdeto.multiapro.com

Kézzel készített férfi és gyermek csokornyakkendők nagy választékban. Fényes, matt, virágos, kockás, pöttyös, vintázs kivitelben.


Feladva: 2017-08-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: kivitelbenférfivintázskészítettpöttyösKézzelkockásajánlóvirágosHirdetőmattPepitaFényesCsokornyakkendőboltválasztékbannagycsokornyakkendőkgyermek

Forrás: pepitahirdeto.multiapro.com

Exkluzív névre szóló étkészletek, evőeszközök kiegészítőkkel! Ha egyedi ajándékkal szeretnéd meglepni az ifjú párt, vagy ha a saját esküvőd szeretnéd egyedibbé és meghittebbé tenni, nézz körül nálunk! Webáruházunk rendeléseit országosan kiszállítjuk.


Feladva: 2015-04-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szeretnédétkészletekesküvődszólósajátnévrevagyExkluzívpártÁcsnálunkifjúBoglárkakörülmeglepniPappnénézzajándékkalajándékoktenniegyediEsküvői

Forrás: pepitahirdeto.multiapro.com

Fürdőszoba átalakítás, felújítás, tetőtér beépítés, laminált padlóburkolás rövid határidővel. Kisebb munkák, tetőpárkány, homlokzatfestés, javítás.


Feladva: 2017-09-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: homlokzatfestésátalakítástetőpárkányFürdőszobamunkákCsornaKisebbFerenchatáridővelErdészrövidparkettázáspadlóburkolásfestéslamináltBurkolásbeépítés

Forrás: pepitahirdeto.multiapro.com

Amire az Iparban szükség lehet. Szerszám Kötőelem- Rögzítéstecnika- Szerszámgép - Hegesztéstechnika - Forrasztástechnika - Munkavédelem - Zár-lakat-vasalás.


Feladva: 2017-08-07    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: SzerszámvasalásszükséglakatIparbanZárAmireMunkavédelemBudapestForrasztástechnikaKftHegesztéstechnikaBauSzerszámgépBarkerRögzítéstecnikaszakáruház

Forrás: pepitahirdeto.multiapro.com

A Piccolo Café Itália kávézóinak hangulatát hozza el Budapestre. Espresso alapú kávéinkhoz Caffé Danesit, egy méltán híres római kávé különlegességet használunk. Konyhánkat az egyszerűség, az egészséges táplálkozás és az olaszos ízek jellemzik. Paninit, szendvicseket szolgálunk fel kedves vendégeinknek, illetve igen népszerű nálunk az igazi olasz street food, az Emilia-Romagna tartományból származó Piadina (olasz lepénykenyér) is. Kávézónkban a hagyományos és paleo sütemények is kaphatók.


Feladva: 2016-01-02    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: olaszCaféPiccoloBudapestPaninithagyományosrómaiigazihangulatátjellemzikKávézónkbanhíresnálunkkávézóinakízeklepénykenyérméltánnépszerűItáliaegy

Forrás: pepitahirdeto.multiapro.com

Masszázs tanfolyam svéd, talp, cellulit, olajos lazító testmasszázs alaptanfolyam (munkavállaláshoz alkalmas igazolással), arcreflexológia és kínai arcdiagnosztika, arcmasszázs (nem pénztárgép köteles vállalkozás!) és egyéb továbbképző tanfolyamok online!! Irodai menedzser masszázs: kiváló munkalehetőség cégeknél! Pénzt és időt takarítasz meg, nem kell utazni, csoportra várni. Az elméleti anyag és a gyakorlati videó is saját számítógépedre tölthető, akárhányszor visszanézhető. Számos ... további részletek >>

külföldön élő és dolgozó masszőr ajánlásával és 25 év oktatói tapasztalatával garanciát vállalok tudásodért!


Feladva: 2016-11-30    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: masszázsnemtanfolyamonlinecégeknéldolgozóvállalkozásanyagtestmasszázsPénztélőköteleselméletilazítómunkalehetőségkülföldönpénztárgépvárniolajos

Forrás: pepitahirdeto.multiapro.com

10 éves ingatlanközvetítői tapasztalattal szeretném figyelmébe ajánlani az INGATLANÁRUHÁZ szolgáltatásait. A Megbízási szerződés megkötése után az eladóknak díjmentes: • az ingatlan felmérése • az eladási ár megállapítása • az ingatlan hirdetése • érdeklődők tájékoztatása • az ingatlan bemutatása • segítség az ártárgyalás lebonyolításában • kedvező díjadású ügyvéd ajánlása • tanácsadás bedőlt hitellel kapcsolatban • tanácsadás ... további részletek >>

hitel felvételével kapcsolatban Megbízási díj csak az általunk hozott vevővel kötött adásvételi szerződés megkötése után jár, rejtett költségek nélkül! Megbízási díjak: • 7 MFt alatt 90.000 forinttól – 120.000 forintig • Nem kizárólagos szerződés esetén: 3%+ÁFA • Fél kizárólagos szerződés esetén: 2,5%+ÁFA • Kizárólagos szerződés esetén: 2%+ÁFA • Bérbeadás esetén: 1 havi bérleti díj Ingatlan keresése a vevők/bérlők számára ingyenes! • ingatlan keresése, megadott paraméterek alapján • a reális eladási ár megállapítása • a kiválasztott ingatlan megtekintésének megszervezése, bemutatása • szükség esetén szakember ajánlása (statikus, építész, generál kivitelező) • szükség esetén ügyvéd ajánlása • tanácsadás bedőlt hitellel kapcsolatban • tanácsadás hitel felvételével kapcsolatban Várom válaszát, hogy mielőbb vevőt találjunk ingatlanára Üdvözlettel Koma László 06 30/690-82-80 honlap: www.ingatlanaruhaz.com email: ingatlanaruhaz@gmail.com


Feladva: 2017-02-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 8226ingatlaneseténszerződéskapcsolatbantanácsadás000ÁFAKizárólagosMegbízásiajánlásaszükségINGATLANÁRUHÁZmegállapításadíjeladásiutánfelvételével

Forrás: pepitahirdeto.multiapro.com

Országosan olyan üzletkötőket keresünk csapatunkba, akik nem kezdők már az értékesítésben, de kimagasló teljesítményükért elvárják a megbecsülést is cserébe. Talán pont Téged keresünk? Magas kereseti lehetőség, NEM MLM! Ha ilyen üzletkötőnek tartod magad, küldj önéletrajzot az alábbi email címre andras.bogar@athletastic.co m! Vagy ismersz valakit, aki ilyen üzletkötői munkát keres, kérlek, vedd fel vele a kapcsolatot.


Feladva: 2017-10-02    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünküzletkötőketNEMilyenvalakitcsapatunkbamagadkapcsolatotTalánismersztartodvelecserébeVagyolyanüzletkötőnekfelmegbecsüléstcomOrszágosan

Forrás: pepitahirdeto.multiapro.com

GALÉRIAÁGYAK, EMELETESÁGYAK masszív tömörfából. Gyerekágy, ágyrács, matrac - EGYEDI méretek és igények alapján is gyártunk. Országos kiszállítással, kedvező árú összeszereléssel. Webáruházunk: galeriaagyak.hu GALÉRIAÉPÍTÉS fából, országosan (Budapestre kiszállási díj nélkül), 10+ év tapasztalattal. Szerződéssel, garanciával, referenciákkal gyártunk és építünk galériákat (egyedi fa szerkezeteket, beépített bútorokat). További információkért látogasson el honlapunkra!


Feladva: 2017-04-24    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: masszívGALÉRIAÁGYAKegyediországosangyártunkGALÉRIAÉPÍTÉSösszeszerelésselTovábbitömörfábóltapasztalattalárúbútorokatnélkülkedvezőbeépítettEMELETESÁGYAK

Forrás: pepitahirdeto.multiapro.com

Igényesen kivitelezett vízteres kandallóbetét beszerezhető közvetlenül a gyártótól különböző (10-19kW-os) vízoldali teljesítménnyel. Ráköthető új és meglévő központi fűtésekre is. A kedvező áron túl, adódik egy olcsó beépítési, és egy igen olcsó fűtési lehetőség. Igényre olcsó házhoz szállítás. Honlapunkon 163.830 Ft-tól válogathat kazánlemezből készült, kovácsoltvas díszítésű gyártmányainkból!


Feladva: 2016-04-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: olcsóegyvízteresRáköthetőválogathatIgényesenigenteljesítménnyeltólGyomaendrődvízoldali000Vendelbeépítési19kW159KatonaadódikkülönbözőHonlapunkon

Forrás: pepitahirdeto.multiapro.com

Miért ajánljuk Agrimotor 3WF-3S permetezőt? Bevált magyar termék 12 hónap Agrimotor gyártói garancia Agrimotor gyár forgalmazza Országos szervízhálózat Teljes alkatrészellátás Egyszerű kezelés Kedvező ár Motor tipus: benzinmotoros, 2 ütemű, 42 ccm Teljesítmény: 1,2 kW Max. folyadék szállítás: 4 liter /perc vagy 6 kg/perc (POR esetén) www.bmann.hu/Agrimotor-3WF-3S


Feladva: 2017-04-15    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: Agrimotor3WFperceseténXIVbenzinmotorosgyárPORBudapesttipusgaranciaajánlóMotorgyártóivagyHirdetőKedvezőhónapliterPepitakezeléstermékfákhoz

Forrás: pepitahirdeto.multiapro.com

Faipari, CNC és egyéb gépek por vagy forgácselszívásához ajánlott. Antisztatikus, portaszító hatású, belül sima, kívül bordázott kivitel, ezáltal a hulladék nem akad el, nem tömődik el. Merev, hajlékony és extra hajlékony, átlátszó vagy szürke kivitelben 20 mm-es átmérőtől egészen 550 mm átmérőig kapható PVC vagy poliuretán anyagból, műanyag vagy fémszálas merevítéssel. Postai utánvétellel is megrendelhető bármekkora méretben max. 30 méteres egybefüggő szálig, szállítás akár másnap! ... további részletek >>


Feladva: 2016-03-16    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: vagynemhajlékonyextraméretbenbelülPVCVeszprémMerevbármekkorahatásúkaphatófaipartömődikmegrendelhetőportaszítóátmérőigcsövekutánvétellel550por

Forrás: pepitahirdeto.multiapro.com

Idős személy ápolását gondozását vállalom, egészségügyi tapasztalattal.


Feladva: 2017-10-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vállalomgondozásátápolásátszemélyIdősDebrecen06309074786tvállalokgondozástapasztalattalÁpolástegészségügyi

Forrás: pepitahirdeto.multiapro.com

Flóra Garden kertészeti Bolt és Webáruház! Szobraink garantáltan fel fogják dobni környezetét! Viszonteladók jelentkezését is várjuk! (06 70/299-2066)


Feladva: 2017-01-12    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: kertimostmárdíszeinkettipegőthttpgarantáltanvagykészletkisöprésSzobrainkárongrillezőtTéliirodájátlegalacsonyabbszökőkutat2066Halásztelekpiacon

Forrás: pepitahirdeto.multiapro.com

Póló szitanyomás, póló nyomtatás cégeknek, iskoláknak. Egyedi póló kiváló minőségben! Tervezze meg kedvenc pólóját, küldje el nekünk mit szeretne és mi megszitázzuk az ön által kiválasztott színű méretű pólójára. Megrendelését akár személyes, akár postai utánvéttel veheti át. A megrendelt termékeket 5-10 munkanap alatt juttatjuk el önhöz. Nagyobb mennyiségű megrendelések esetében ez az idő akár 10-15 nap is lehet megegyezés szerint. További kérdésére szívesen válaszolunk ... további részletek >>

keressen minket élérhetőségeink egyikén. A Facebook-on is megtalál: www.facebook.com/poloranyomas.hu


Feladva: 2017-02-16    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: pólószitanyomásakárnyomtatáspoloranyomasNagyobbiskoláknakakkorutánvéttelTovábbimitönhözcégeknekpostaiszerintnekünkjuttatjukszemélyesmegegyezés

Forrás: pepitahirdeto.multiapro.com

Igényes megjelenésű klímás autók sofőrrel kérhetőek. Kiállás Budapesten díjtalan. Autóink rendelhetők már 6.000.-/óra díjtól. Számoljon velünk, részletekért klikkeljen a www.szepauto.5mp.eu oldalra.


Feladva: 2017-03-20    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: KiállásCsaládivelünkkérhetőekpartiSzámoljonsofőrrelCégesdíjtólautókRendezvényóraklímásAutó000megjelenésűoldalraEsküvőmárIgényes5mpRichárd

Forrás: pepitahirdeto.multiapro.com

-550L-es alsó kifolyású, raklapra szerelhető rozsdamentes tartály -kb 400 db/perc teljesítményű gravitációs levező -4,5m3-es rozsdamentes tartályok -2 m3-es rozsdamentes tartály -rozsdamentes konténerek -pedálos zacskó záró gép -vibrációs rázók - 2 db 3m-es csigás felhordó -rozsdamentes szállítószalagok talpaslánccal: -2,5m-es -7,5m-es -3m-es -3,8m-es -3,5m-es


Feladva: 2013-09-02    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: rozsdamentesszállítószalagoktartálytartályokgépektalpaslánccalkonténerekkifolyásúalsó550Lfelhordó5m3Kongépcsigáslevezősavállórázókgravitációsgép

Forrás: pepitahirdeto.multiapro.com

Ön hagyományos szakácskabátban szeret dolgozni? Vagy kedveli a modern divatos munkaruhát? Mi mind kettőben tudunk Önnek segíteni. Már közel száz féle kész fazonból választhat, rendelhet akár egyéni kívánság szerint is. 100% pamut, vagy kevert szálú alapanyagból, vékony vagy vastagabb kivitelben, tetszésének megfelelő színben a hozzá harmonizáló kivehető gombokkal is elkészítjük szakácskabátját. Kívánságra céglógót, nevet, beosztást tudunk a kabátba hímezni.


Feladva: 2016-10-11    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: vagytudunkkészhímeznimodernharmonizálókevertfélekabátbakedvelihozzápamutszázdolgozniszínben100közelbeosztástszeretmegfelelőszerintMárakár

Forrás: pepitahirdeto.multiapro.com

Szeretettel várom minden lazítani vágyó vendégemet egy kellemes kikapcsolódásra Gyenesdiáson, a Balaton északi partján. Nálam hangulatos szobában, egyedi 1 órás teljes testes, meleg olajos lágy relax masszázsra van lehetőség. Amit lágy keleti zene kíséretében kényelmes matracon végzek el minden hozzám betérő személyen. Engedje meg magának ezt a lehetőséget, mert egy kis kényeztetés mindenkinek jár! Elérhető vagyok a hét minden napján reggel 8:00-22:00 0620/978/9568 Alex


Feladva: 2017-07-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: mindenlágyAlexrelaxegyGyenesdiásonElérhetőegyediEngedjevágyóAmitjárszobábanszemélyenlazítanilehetőségmindenkinekhangulatosbetérővárom9568

Forrás: pepitahirdeto.multiapro.com

Energetikai tanúsítvány készítése Kecskeméten és Bács-Kiskun megyében ingatlanok adásvételéhez, illetve bérbeadásához, pályázatokhoz! Rövid határidővel, olcsón!


Feladva: 2015-06-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: tanúsítványEnergetikaikecskemetKiskunBácsKecskemétenolcsónhatáridővelrövidkészítésepályázatokhozbérbeadásáhozilletvevételéheztanusitvanyadáswww

Forrás: pepitahirdeto.multiapro.com

Szalonunkban a hajhosszabbítás, hajdúsítás gyakorlattal (1997), egyedi hajfelvarrással illetve csomózással, európai póthajjal készül. Hozott hajjal is pótolunk! Látogass el honlapunkra, Facebook-ra: facebook.com/hajhosszabbitas.hajdus itas


Feladva: 2017-01-02    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: facebookhajdúsításhajhosszabbításCsepelcomilletveSzépségszalonhajfelvarrássalCityhonlapunkraegyediLátogass1997pótolunkgyakorlattalhajjalHozottXXI

Forrás: pepitahirdeto.multiapro.com

Családi ünneped tennéd színesebbé, emelnéd a fényét, díszítenéd szebbé? Szeretnéd, ha méltó, örök emlék lenne, hogy az érzéseid ragyogjanak benne? Írasd hát meg versben, legyen méltó hozzád, mintha az ünnepet be is aranyoznád! Fejezd ki az érzést, emeld tiszta fényét, tedd szebbé szeretted fontos eseményét. Rendelj verset Aranyosi Ervintől! Ára versszakonként (8 sor): 2.000 Ft


Feladva: 2015-09-08    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szebbéméltófényétAranyosiversetszínesebbéFejezdcombenneRendeljtennédaranyoznádaranyosiervinragyogjanakeseményétünnepedünnepetversekérzéseidhttp

Forrás: pepitahirdeto.multiapro.com

Alig használt sodastream gép eladó


Feladva: 2017-11-10    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: gépeladósodastreamhasználtAligZamárdiPéterBuzásEndrédi

Forrás: pepitahirdeto.multiapro.com

Sárosd centrumában eladó egy 72 m2-es családi ház garázzsal, melléképületekkel, hozzá tartozó rendezett, két utcára nyíló 1200 m2-es jó fekvésű, körbe kerített telekkel (telek megosztható). Közművek: víz, villany, telefonvonal bevezetve,, gáz, csatorna telekhatáron ráköthető.


Feladva: 2017-11-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: SárosdvillanyutcáracentrumábanvízkétKözművekrendezettZsuzsannamegoszthatótartozóPálkovácstelekhozzáutcaráköthetőtelekkelmelléképületekkelJókai

Forrás: pepitahirdeto.multiapro.com

Horvátországi ingatlanok. REN Ingatlanközvetítő (15 éve partnerünk) ajánlatából helyeztük el az oldalon. A linkeken, az oldalukra jutva sok ház, villa, lakás, és isztriai ház közt válogathat… www.kekadria.hu/ingatlan/hingatlan 1.html


Feladva: 2017-10-05    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: ingatlanokHorvátországiKékAdriaházpartnerünkisztriaiévelakásIngatlanközvetítővillaRENsokjutvaoldalukralinkekenoldalakon8230oldaloneladókiadó

Forrás: pepitahirdeto.multiapro.com

Elege van a magas közös költségből? Szeretné csökkenteni kiadásait? Válassza az AXA Trend Kft. szolgáltatását! Professzionális társasházkezelés; közös képviselet; társasházak és lakásszövetkezetek jogi képviselete; könyvelés; könyvvizsgálat! Amennyiben az Ön társasháza – közgyűlési határozat alapján – szerződést köt az AXA Trend Kft. társasházkezelővel, a társasház közös képviseletére, akár 10%-al csökkenthetjük a közös költséget.


Feladva: 2015-10-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: közösKftTrendAXA8211társasházkezelésProfesszionálistársasháztársasházaszolgáltatásáttársasházkezelővelAmennyibenVálasszakönyvvizsgálatkiadásaitSzeretné

Forrás: pepitahirdeto.multiapro.com

Porcerősítés céljából és ízületi gyulladás ellen kurkuma fogyasztása jól bevált módszer világszerte. Ezt az ősi fűszert gyulladás- és fájdalomcsökkentő hatása miatt alkalmazzák a mozgásszervek gyakori problémáira. A kurkuma hatékony ízület erősítő és porcerősítő gyógynövény, mely néhány héten belül képes jelentős javulást előidézni a mozgásban. A fájdalom, a duzzanat, a gyulladás fokozatosan mérséklődik, majd megszűnik. Mellékhatásokat okozó gyógyszerek nélkül is lehetséges újra fájdalom nélkül ... további részletek >>

járni vagy lépcsőzni! A porcerősítők kurkumából alternatív gyógymódot jelentenek a gyulladás és porckopás ellen.


Feladva: 2017-08-29    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: gyulladáskurkumaellennélkülporcerősítőfájdalomfogyasztásamérséklődikmelyjárnimiattízületifokozatosangyógynövényhatásacéljábólduzzanatporckopásősi

Forrás: pepitahirdeto.multiapro.com

Statikus szakértői vélemény CSOK igényléséhez. (családi otthonteremtési kedvezmény) Díja: 40.000 Ft.


Feladva: 2016-11-28    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: StatikusotthonteremtésicsaládiigényléséhezCSOKvéleményszakértőiZsuzsanna000JózsaDíjaSZAKVÉLEMÉNYkedvezmény

Forrás: pepitahirdeto.multiapro.com

Régi és új ARANY-, EZÜST- és egyéb FÉMPÉNZEK, PAPÍRPÉNZEK, kitüntetések, jelvények, emlékérmek, plakettek, régi képeslapok, numizmatikai gyűjtemények VÉTELE – ELADÁSA! Az antik világtól napjainkig terjedő, több ezer darabos kínálatunk a “Termékek” menüpontra kattintva témakörönként tekinthető meg. Üzletünk 1999. óta áll a gyűjtők és eladni szándékozók szolgálatában. Vásároljanak tőlünk személyesen, vagy online, termékeinkért felelősséget vállalunk! A minőség ... további részletek >>

magáért beszél!


Feladva: 2017-04-11    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: régitekinthetőajánlóterjedőplakettekVásároljanaktémakörönkéntHirdetőnapjainkigbeszélemlékérmekszolgálatábankattintvaPepitavilágtólmagáértjelvények

Forrás: pepitahirdeto.multiapro.com

Most akciósan eladó! Ha egy igazi terepjárót szeretne, elfogadható áron! Garázsban tartott, márkaszervizben szervizelt, szerviz által igazolhatóan rendszeresen szervizelve. Ára:3.000.000.-Ft Jelentkezni: 06202632620


Feladva: 2017-10-02    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 000általegyszervizeladószervizeltakciósanmárkaszervizbenMost06202632620tartottGyömrőJelentkezniGarázsbanZsuzsannaáronHazaiÁraelfogadhatócruiser

Forrás: pepitahirdeto.multiapro.com

Hajsütővas, gőzállomás, waffelsütő, gofrisütő, melegszendvicssütő, porszívó, páraelszívó, fagyasztó, hűtő, szárítógép, mosógép, hősugárzó, olajradiátor, olajsütő, kenyérpirító. A tökéletes nászajándékok, karácsonyi ajándékok széles választéka! Személyes átvétel Budapesten. Link: www.stacioshop.hu Facebook: www.facebook.com/stacioshop Tel: 36704551969 E-mail: in fo@stacioshop.hu


Feladva: 2017-05-16    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: stacioshopfacebookwwwátvételhősugárzóinfo@stacioshopHajsütővasSzemélyesmosógépmailajánlóválasztékaszárítógép36704551969HirdetőszéleshűtőTelPepita

Forrás: pepitahirdeto.multiapro.com

Sírkő és sírkő kellék webáruház. Kizárólag hazai gyártású sírkövek az ország első webáruházában.


Feladva: 2017-07-14    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: sírkőwebáruházwebáruházábanHirdetőelsőPepitaországsírkövekgyártásúhazaiKizárólagkellékajánló

Forrás: pepitahirdeto.multiapro.com

Sziasztok vonósok! BEIRATKOZÁS MOST!!! Egyéni módszeremmel, könnyedén, jó hangulatú hegedű órákkal várom a tanulni vágyókat Budapesten!!! Nálam nincs botkezű, botfülű ember, csak hegedülni szerető és tanulni vágyó emberkék vannak, akik szeretnek nálam tanulni és örömmel vesznek részt az órákon!!! Nincs korhatár, lehetsz 5, vagy 60 éves, egy a fő! Akarj és szeress hegedülni tanulni, mert az csodálatos! MINDEN HEGEDÜLNI VÁGYÓT SZERETETTEL VÁROK!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: tanulniHEGEDÜLNINincsnálamBudapestvagyvannakórákkalVÁGYÓTOroszlánlehetszemberkékhegedűÁRONkorhatárvágyóhangulatúMINDENAKCIÓSszeretőkönnyedén

Forrás: pepitahirdeto.multiapro.com

Professzionális airbrush munkák, képek, grafikák laptopra, bukósisakra, gépkocsira, motorkerékpárra, falra, stb... akár hozott fotóról, vagy egyedi elképzelés alapján. Portré vagy házi kedvenc, esetleg fantáziaképről legyen szó, egyaránt megvalósítom.


Feladva: 2015-01-19    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: képekairbrushvagygrafikákszófotórólmunkáklegyenhozotthupontfantáziaképrőlakárgrafikakProfesszionálisesetlegstbairbrushkepekZoltánkedvencfalra

Forrás: pepitahirdeto.multiapro.com

Aprósütemények, teasütemények, linzersütemények rendelhetők, közvetlenül a gyártótól! Házias jellegű, kézzel gyártott, minőségi édesipari termékek, nagy választékban! Bővebb tájékoztatás, termékbemutatás, rendelés felvétel a honlapunkon elérhetők!


Feladva: 2015-11-09    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: rendelésHáziaswwwtermékekteasüteményekhttpédesipariAprósüteményekelérhetőkminőségiSütihonlapunkongyártottPatakifelvételkézzelAprósüteményjellegű

Forrás: pepitahirdeto.multiapro.com

Bízza profikra a munkát! Hivatalos okiratok, szerződések cégpapírok hitelesített fordítása. Jogi fordítás · Keresztnyelves fordítás · Szakfordítás · Fordítás Kérjen árajánlatot!


Feladva: 2017-07-13    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: Fordítás183szerződésekárajánlatotokiratokKérjenHivatalosmunkátprofikraSzakfordításBízzaKeresztnyelvesajánlóJogiHirdetőfordításaPepitahitelesített

Forrás: pepitahirdeto.multiapro.com

Mobil- és infocuccok akár ingyenes szállítással, garanciával. www.techdiszkont.superwebaruhaz.hu /mobiltelefon-k79599 HP, Acer, ASUS, Samsung, LG, Nokia, Alcatel, Genius, Canyon és egyéb márkák választéka.


Feladva: 2017-03-31    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: techdiszkontMobilASUSMobilboltAcersuperwebaruhazválasztékamárkákwwwegyébgaranciávalCanyonszállítássalGeniusingyenesAlcatelakárNokiainfocuccok

Forrás: pepitahirdeto.multiapro.com

Quartz Wrist Watch női karóra, fém szíjjal, 2999 ,- Ft Ezüst színű, téglalap, fém óraházzal, 4 db kristállyal, fekete számlappal, elegáns divatos kivitelben. Rozsdamentes acél, fém szíjjal. Quartz szerkezettel, elemmel. Rose gold színű pontjelzéssel és mutatókkal. Méretek : Téglalap számlap 40 x 28 mm, teljes hossz 22.5 cm Érd: 001 6ado@gmail.com Tel.: 70/209-4260


Feladva: 2017-11-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: fémszíjjalQuartzTéglalap2999comkaróra0016ado@gmailnőiÉrdWatchszínűWristEzüstMéretekacélmutatókkalRozsdamentespontjelzésselkivitelben4260209

Forrás: pepitahirdeto.multiapro.com

Hölgyeim, Uraim! Engedjék meg, hogy fegyelmükbe ajánljam ezt az új építésű lakást, melynek LEGYEN Ön az első új tulajdonosa. Először is hadd vezessem körbe leendő otthonában. Kezdjük hát körutazásunkat. Miután be jöttünk a kapun és kényelmesen le parkoltunk a házunk előtt a saját parkolónkba már csak néhány lépést s bent is vagyunk a lakásunkban. Itt egy kényelmes elő térben találjuk magunkat, ahol kényelmesen le vehetjük a cipőket és kabátokat. Balra fordulva találjuk a lépcsőt, amin kicsit ... további részletek >>

később a felső szintre fogunk fel menni. A lépcső mellett találunk egy kicsi tárolót ahol akár a kabátokat tárolhatjuk. Forduljunk jobbra ahol egy másik ajtó található ahol is a háztartási gépeknek adhatunk otthont. Majd tovább haladva egyenesen egy tágas Amerikai konyhás nappaliban találhatjuk magunkat. Itt van elég hely, hogy kényelmesen tudjunk sütni, főzni, sőt egy étkező asztal is kényelmesen elfér. Innen nyílik továbbá egy kisebb terasz is ahol igazán remekül élvezhetjük a reggeli adta ébredés idejét. Hiszen fontos, hogy jól induljon a napunk. De nézzük meg a felső szintet is ahol az éjszakánkét töltjük. Itt a felső szinten három kényelmes szoba található, amit kényünk kedvünk szerint használunk. Mind A három szoba világos és tágas is. Így kényelmesen tudjuk elhelyezni a bútorainkat. Ami elengedhetetlen a tökéletes pihenéshez. Tetszett? Nézzük meg személyesen is.


Feladva: 2017-09-28    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egyaholkényelmesenhogyfelsőIttmegtalálhatóNézzüktágaskényelmeskabátokatszobahárommagunkattaláljukigazánjobbraparkolónkbaKihagyhatatlanÍgy

Forrás: pepitahirdeto.multiapro.com

Környezetbarát tisztítószer, amely lehetővé teszi a zsíros szennyeződések eltávolítását minden felületről. Különösen alkalmas a tűzhely, a sütő és a főzőlap zsíros lerakódásainak eltávolításához. Bőrgyógyászatilag tesztelt. Ecolabel minősítéssel rendelkezik, amely tanúsítja a környezetkímélő, biológiailag könnyen lebomló összetevőket. - 750 ml-es szórófejes flakon www.vegatar.hu/id/01352_Neutral-Gr een-oko-zsiroldo-750-mL


Feladva: 2017-04-04    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: 750amelyNeutralGreenökozsírostanúsítjatisztítószerzsiroldotűzhelykörnyezetkímélősütőbiológiailaglehetővéfőzőlapkönnyenteszilerakódásainaklebomló

Forrás: pepitahirdeto.multiapro.com

Leszakadt a redőnye? Hívjon! 0670 68 08 268 Szorul? Hívjon! 0670 68 08 268 Akadozik? Hívjon! 0670 68 08 268 Gyors redőnyjavítás akár azonnal egész Győr-Moson-Sopron megye területén, szükség esetén hétvégén is. Új és régi redőnyök szerelését vállaljuk rövid határidővel (egy hét), kedvező áron. Szalag függöny, Zsalúzia, Reluxa, Napellenző, Szúnyogháló +36 70 68 08 268 Új árnyékolástechnikai berendezést szeretne, de nem tudja, kihez forduljon? Hívjon bizalommal: 15 éves tapasztalatommal ... további részletek >>

készséggel állok rendelkezésére.


Feladva: 2017-04-25    [Lakossági szolgáltatás]

Címkék, kulcsszavak: Hívjongurtnicsereredőnyjavítás268redőnyszerelés0670szúnyoghálónapellenzőhupontreluxahttpajtóműanyagGyőrredonyszredőnyökazonnalfüggönyrégiakár

Forrás: pepitahirdeto.multiapro.com

A tragikus 2013-as síbaleset óta nem sokat hallottunk a legendás Forma-1 bajnokról. Most se lehet túl sokat tudni az állapotáról, de legalább a körülményekhez képest jól van... (A kép forrása: nepszava.hu)


Feladva: 2017-11-13    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: sokatkörülményekhezhallottunkhíreklegalábbnemkeresikállapotárólótaSokantudnisíbaleset2013nepszavatúltragikusforrásalehetajánlásképMostvan

Forrás: pepitahirdeto.multiapro.com

Könyv kínálatunkban leginkább gyerek és ifjúsági könyvek szerepelnek, de a felnőttek számára is vannak ajánlataink. Nagy figyelmet fektetünk a tanulást segítő könyvek terjesztésére is, ezért azokat egy külön kategóriába gyűjtöttük össze. A gyermekek számára foglalkoztató könyvek és füzetek is nagy választékban elérhetőek. Minden könyv 20 % kedvezménnyel kapható! A könyveken túl plüssök, fiús és lányos játékok, gyermekruhák, gyermekágyneműk, párnák és sok más ajándékötlet szerepel a ... további részletek >>

palettánkon. Mi abban szeretnénk segítséget nyújtani mindenkinek, hogy a szívéhez közelálló ajándékot megtalálja. Ha ajándékot adsz másnak - azzal magadat is megajándékozod mert, bármi válhat ajándékká - egy ölelés, egy boldog mosoly… Nézz be webáruházunkba és szerezz örömöt szeretteidnek a honlapunk kínálatából!


Feladva: 2016-10-19    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: egykönyveknagyajándékotszámárakönyvazzalválasztékbanszeretnénkazokatmosolylányosifjúságimásnakabbanezértboldogfiúsgyerekadszfüzetekplüssök

Forrás: pepitahirdeto.multiapro.com

Pancreatitis-szel (hasnyálmirigy-gyulladással) élők számára készült diétás szakácskönyv, zsír- és fűszerszegény ételek receptjeivel, vidám grafikákkal. Az emésztőrendszert kímélő ételek fogyókúrás diétákba is jól beépíthetőek. A termék eredeti, nem másolt. Facebook csoport: www.facebook.com/groups/hasnyalmir igy www.mercidesign.hu/shp/6-pancreati tis Rendelhető közvetlen a szerzőtől!


Feladva: 2015-08-19    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: pancreatitisfacebookételekhasnyálmirigymercidesignhttpInternettermékfűszerszegényhasnyalmirigygyulladásbeépíthetőekzsírgroupsjólszakácskönyvcomwww

Forrás: pepitahirdeto.multiapro.com

Nem ígérek milliókat, de egy olyan lehetőséget ajánlok, amivel hozzájárulhatsz a családi kasszához hosszú távon. Vásárold meg most a neked tetszőt! 18 terméket 50%-al olcsóbban! Miért várnál kedvezményeket csak az év egy napján? Teremtsd meg a saját Black Friday napodat! Keress a részletekért!


Feladva: 2017-11-17    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 224232242hozkatkasszmilliolcscsalrekketrulhatszNemtermhozzSiófokmegamivelErzsébetroldnlokHajdugetingyenesenvonlehetősszletek249

Forrás: pepitahirdeto.multiapro.com

Szeretne az elsők közt lenni? Ha igen a válasz most elsők közt lehet egy Magyarországról induló üzleti lehetőséggel. Annak idején akik az induláskor ott voltak a és elkezdték az Amway, Aloe Vera stb termékek népszerűsítését, és a mai napig dolgoznak benne igen jól jártak. Építsen karriert egy kiváló egészség megőrző termékekkel! További infó a lehetőségről: Tel: 06-20/8012282 Email: axxaglobal2017@gmail.com


Feladva: 2017-08-02    [Pénzkeresés - MLM]

Címkék, kulcsszavak: köztelsőkegyigenelkezdtékTovábbilehetbennevoltaktermékekkeldolgoznakottmegőrzőnapiginduláskoregészségmostmaicomakikkiválóválaszidején

Forrás: pepitahirdeto.multiapro.com

Nem elég a keresete? Szeretne jobban élni. Akkor most ön jó helyen jár. Hiszen megfelelő időben jó helyen lenni az ami meghozhassa az ön számára is az üzleti életében a siker lehetőségét. Magyarországról nyitott Európa felé az Axxa So Plus termékével az Axxa Global cég. Terméke kiváló, rendkívül népszerű ázsiai országokban. Világ sikere elkerülhetetlen. Axxa Global termék tanácsadóként akár komolyabb plusz bevételi forrás elérése lehetséges. Ha érdekli a lehetőség, regisztráljon ... további részletek >>

Axxa global céghez, a www.axxasoplus.hu, vagy az axxasoplus.blog.hu segítségével, vagy keressen elérhetőségeimen. Kovács Zoltán www.axxasoplus.blog.hu www.axxasoplus.blog.hu infó: axxaglobal2017@gmal.com Tel:06-20/8012282


Feladva: 2017-10-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AxxaaxxasoplusblogglobalwwwtermékhttpZoltánPlushelyenvagyregisztráljonszámáraélnitermékévellehetőségmeghozhassaelkerülhetetlenjobbanérdekli

Forrás: pepitahirdeto.multiapro.com

Professzionális, személyre szabott doboktatás, egyéni időbeosztásban! Kezdőknek, haladóknak, korosztálytól függetlenül, minden zenei stílusban! Földesi Dobiskola!


Feladva: 2016-01-26    [Zene - Hangszer]

Címkék, kulcsszavak: egyéniDobiskoladoboktatásFöldesiidőbeosztásbanszabottstílusbanszemélyrezeneiProfesszionálismindenfüggetlenülkorosztálytólhaladóknakKezdőknek

Forrás: pepitahirdeto.multiapro.com

Kéményajtó légbevezető, forgalmazása, beépítése és egyéb légtechnikai rendszerek kiépítésével foglalkozunk. Termékeink megvásárolhatók webáruházunkban, a www.kemenyajto.com oldalon


Feladva: 2013-10-25    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kemenyajtoforgalmazásalégbevezetőhttpWebáruházunkbanbeépítésmegvásárolhatókTermékeinkfoglalkozunkkiépítésévelrendszereklégtechnikaioldalonegyébcom

Forrás: pepitahirdeto.multiapro.com

Az MS-METAL KFT. tevékenysége közé tartozik különböző acéltermékek, fémtömegcikkek gyártása, valamint ezen termékek értékesítése. Megrendelőink igényei alapján gyártunk különböző stancolt, hajlított vagy görgőzött, hegesztett lemezalkatrészeket, különböző polcokat, polcszerkezeteket, állványszerkezeteket, fali síneket, fali tartókarokat, valamint raktártechnikai elemeket és egyedi acéltermékeket. A gyártott termékek vasfoszfátos alapozással, elektrosztatikus vagy tribosztatikus porlakk ... további részletek >>

bevonattal készülnek. Termékeink segítségével minden tárolási probléma gyorsan és egyénileg megoldható. Tevékenységünk közé tartozik az álmennyezeti elemek gyártása és értékesítése, mely mind beltéren, mind kültéren használható. A méretválasztékból a kombinációs lehetőségeket kihasználva minden igényt kielégítő polcrendszer állítható össze, legyen az irodában, lakószobában, gyerekszobában, kamrában, garázsban. Ha vásárolni szeretne, válasszon webshopjaink közül!


Feladva: 2016-12-31    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: mindenkülönbözőközévalamintvagymindfaliértékesítésetermékekgyártásatartozikelemeketpolcszerkezetméretválasztékbólhegesztettporlakktevékenységePolc

Forrás: pepitahirdeto.multiapro.com

Befektetési arany termékeinket azonnal, a fizetéssel egyidőben, készpénzért veheti meg Bp. 1085 József krt. 40. alatti központunkban és az oldalunkon felsorolt pénzváltókban. A pénzváltókban a választék és készlet mennyisége is kisebb mint a központban. Fizethet átutalással is, ilyen esetben hívjon minket telefonon! Központunkban és a készlettel rendelkező pénzváltókban (a budapestiek kivételével) el is adhatja aranyát, a központ mellett már Debrecenben is azonnal megkapja az ... további részletek >>

ellenértéket! A feltüntetett árakon kívül nincs semmilyen más költség. A vételi ár csak a fényképen látható és sérülésmentes csomagolású aranytömbökre, illetve a sérülésmentes érmékre vonatkozik. A listában nem szereplő aranytömböket és érméket is megvásároljuk egyedi ár alapján. www.correctgold.hu/befektetesi_arany


Feladva: 2017-07-14    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: pénzváltókbanaranybefektetesisérülésmentesazonnalKözpontunkbansemmilyenválasztékwwwközpontfizetésselhívjonnincsfelsoroltalapjánaranyáttermékeinket

Forrás: pepitahirdeto.multiapro.com

NÉMETORSZÁGI MUNKALEHETŐSÉG BETANÍTOTT MUNKÁSOKAT keresünk, NÉMET NYELVTUDÁS NEM SZÜKSÉGES FELTÉTEL: • Jó fizikai erőnlét, teherbírás, terhelhetőség, pontos munkavégzés, fejlődési igény, jó kézügyesség • 8 általános iskolai végzettség • Orvosi alkalmasság, bejegyzés mentes erkölcsi bizonyítvány • Hajlandóság Németországi tartózkodásra AMIT KÍNÁLUNK: • Kiemelkedő kereseti lehetőség Bruttó bér: 1.800-2.300 € • Biztos munkalehetőség ... további részletek >>

egész évben, határozatlan idejű, magyar nyelvű munkaszerződés • Németországi bejelentés, német nyugdíj, német családi pótlék • Kiutazás saját buszokkal, valamint jól felszerelt szállás a munkahelyek közelében • Munkába lépés az orvosi alkalmassági meglétét követően akár azonnal Jelentkezés önéletrajzzal: husipariceg@gmail.com további információ: +36-30/911-2209


Feladva: 2017-05-22    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 8226NémetországinémetHúsiparimunkalehetőségBETANÍTOTTorvosisajátbejegyzéstovábbiidejűteherbíráslépéslehetőségKiutazásalkalmasságcomhatározatlan

Forrás: pepitahirdeto.multiapro.com

Az utóbbi öt évben, négy kivételével, az összes tanítványom vizsgája sikerült, de korábban se volt rosszabb az arány 98%-nál. Matematika, mechanika, géptan, fizika, anyagtudomány, mechatronika, gazdasági matematika, analízis, sorozatok, differenciál-, integrálszámítás, lineáris programozás, differenciálegyenletek, mátrix, optimumszámítás, operációkutatás, valószínűségszámítás, oktatása korrepetálása 20 éves gyakorlattal egyetemistáknak, és középiskolásoknak.


Feladva: 2017-09-22    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: matematikamechatronikaanyagtudományfizikagéptanmechanikavalószínűségszámításHirdetőkorábbanoperációkutatásPepitagazdaságisikerültoptimumszámításvizsgája

Forrás: pepitahirdeto.multiapro.com

Falpanelt keresel? A legnagyobb választék falpanelekből a KERMA Design webáruházban: gipsz, farost, fa, pvc, cukornád, műbőr, polisztirol, poliuretán, beton falpanelek. Tervezés, gyártás, és kivitelezés! KERMA www.kerma.hu #falpanel #kerma #műbőr #design #burkolat #bőrpanel


Feladva: 2017-09-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kermadesignfalpanelműbőrakkorkereselburkolatpoliuretánFalpaneltpolisztirolDebrecencukornádKftpvcfarostfalwwwgipszkivitelezéswebáruházbanbeton

Forrás: pepitahirdeto.multiapro.com

Szeretné, ha haja egészséges, csillogó és dús lenne? Szeretne kellemes környezetben, igazi szakemberek által gyógyulni, szépülni? Nem elégedett a boltokban kapható hajápoló termékekkel? Szalonunk a következő szolgáltatásokat ajánlja: -Hajgyógyászati kezelések: hajhullás, kopaszodás, korpa, zsírosodás, száraz, vékony, töredezett haj és fejbőr panaszok problémájára. Több mint 20 éves tapasztalattal! Személyre szabott kezelési programok, professzionális gyógyászati anyagok, komfortos érzés ... további részletek >>

kezelés közben! Mikrokamerás hajdiagnosztika, fejbőr és hajvizsgálat -Biofodrászat: Haj-állapotfelmérés speciális kamerával. Az Ön stílusának és hajszerkezetének legmegfelelőbb módszerekkel dolgozunk. Vegyszermentes hajfestés a haj szerkezetét erősítő festékkel, (maximális őszfedéssel) Természetes eredetű styling anyagok (hajhab, zselé, hajlakk), melyek meg is vásárolhatóak! Referenciaszalonunkban speciális, biológiailag aktív növényi hatóanyagokkal dolgozunk! Hajmosás, styling, vágás személyre szabottan, az ön haj-és fejbőrtípusának megfelelően. Ionos hajszárítás, kolloid ásványi anyagokkal történő hajfeltöltés. Vegyszermentes hajfestés, hajszerkezet-visszaépítés, vékonyszálú haj erősítése Egyedülálló, a hajszálak szerkezetébe beépülő biológiailag aktív növényi hatóanyagaink biztosítják, hogy az Ön frizurája nemcsak szép, hanem egészséges is legyen!


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hajBiofodrászatnövényifejbőraktívhajfestésSzeretnebiológiailagVegyszermentesegészségesszemélyrekezelésekstylingHajgyógyászatianyagokdolgozunkNovotni

Forrás: pepitahirdeto.multiapro.com

Budapest első fogyatékossággal élő emberek által alapított kávézója. A kávézóban dolgozó csapat nagyon színes és nagy szeretettel vár minden látogatót. Egy pár szó rólunk: www.nemadomfelkavezo.hu/rolunk.php


Feladva: 2016-10-06    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: nagyfogyatékossággalszíneselsőnagyonBudapestcsapatStevedolgozókávézókávézóbanfelkávézójaadomlátogatótalapítottNemmindenáltalváremberekélő

Forrás: pepitahirdeto.multiapro.com

SZAKMŰHELYBEN SZÜKSÉG SZERINT HELYSZÍNEN IS. GARANCIÁVAL! Kiszállással a következő kerületekben: Budapest, VIII., IX., X., XVII., XVIII., XIX., XX., XXI., XXIII. kerületeiben. Kispest, Kőbánya, Erzsébet, Csepel, Soroksár, Pestimre, Pestszentlőrinc. Pest megyében: Vecsés, Gyál.


Feladva: 2015-09-03    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BudapestSZERINTPestXIXSZÜKSÉGPestszentlőrincXVIIISZAKMŰHELYBENPestimreXVIILÁSZLÓSoroksárVIIIKISSCsepelVÁLLALOMErzsébetkerületekbenJAVÍTÁSÁTGyál

Forrás: pepitahirdeto.multiapro.com

Hölgytársaim! Tudjuk, hogy a férfiak a teremtés koronái. Jól is van ez így! De azért szerencsére ma már mi nők is meg tudjuk valósítani a céljainkat, anyagilag függetlenné tudunk válni megfelelő profi eszközökkel. Hogyan tudod megvalósítani Te is a céljaidat akár több gyermek mellett is? Itt a megoldás: www.nyolcpontnyolc.hu/310012767/da ta


Feladva: 2017-08-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: tudjukmegfelelőszerencséremellettanyukáknakválniazértgyermekGyermekestudunkígytöbbfüggetlennévanakáranyagilagJólcéljaidatcéljainkatdatatudod

Forrás: pepitahirdeto.multiapro.com

A krill omega 3 gélkapszula magas omega-3 zsírsav tartalmával csökkenti a keringési betegségek valószínűségét. Az idősebbeket és az egyre gyakrabban a fiatalabb korosztályt is érintő vérnyomás-, koleszterinproblémák, érrendszeri betegségek ellen sokat tehetünk, ha rendszeresen pótoljuk az omega-3 zsírsavakat A krill omega 3 gélkapszula kellő mennyiségben tartalmazza ezt az esszenciális tápanyagot, mely a legtöbb ember étrendjéből hiányzik - pedig minden életkorban nélkülözhetetlen. Segíti az ... további részletek >>

idegrendszer egészséges működését, növeli a fizikai és a szellemi teljesítményt, csökkenti a gyulladásokat és helyreállítja a hormonháztartás egyensúlyát. Krill omega 3 gélkapszula ára itt!


Feladva: 2016-09-23    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: omegaKrillgélkapszulacsökkentibetegségeknélkülözhetetlenkeringésieztgyulladásokatérrendszeriéletkorbantartalmávaltartalmazzakoleszterinproblémákminden

Forrás: pepitahirdeto.multiapro.com

Turkálósok, piacosok, magánvállalkozók figyelmébe ajánlom cégünket, amely több éves tapasztalattal kínálja Önnek használtruha termékeinket. 20 kg-os kiszereléstől az 500 kg-os kiszerelésig biztosítjuk a szezonális ruházatot. I. osztálytól a cream minőségig megtalál nálunk mindent egy helyen. Minden megrendelést ingyenesen kiszállítunk garancia vállalással. Kínálunk gyerek ruházatot, felnőtt használt ruházatot, bálás ruhákat, válogatott extra használt ruházatot, pólós bálákat, melegítős - ... további részletek >>

jogging használt ruha bálákat, lakástextilt, fajtára válogatott extra minőségű ruházatot. Kérje részletes ajánlatunkat!


Feladva: 2017-08-02    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: 224232236zatotruhextra242kathasznhasználttunkcégünketminőségűcreamOrigin20kgkisznlommelegkeinketingyenesenfigyelmválogatottosztályt

Forrás: pepitahirdeto.multiapro.com

Karácsonyi dekorációs cikkek közül válogasson a Zöldvilág Webáruházban! www.selyemviragok.hu/index.php?id= 2054


Feladva: 2017-10-29    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ZöldvilágcikkekdekorációsKarácsonyiGyőrWebáruházNagykereskedésSelyemvirágWebáruházbanKarácsonyválogassonközül

Forrás: pepitahirdeto.multiapro.com

Oly sokszor üzentem, versbe szedve, szépen. - El is olvashatod, már ezen a héten. Új verseskötetem napvilágot látott, ”MEGSÚGOTT TITKAIM” hiszed, majd, ha látod. Verseim díszíti 69 képem, mit magam festettem, a számítógépen. Valóra válik hát, dédelgetett álmom, s ki előre utal, annak dedikálom.


Feladva: 2015-11-05    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: TITKAIMMEGSÚGOTTverseskötetemErvinAranyosi8221szedveszámítógépenversbefestettemdedikálomüzentemmagamlátottannaksokszormitnapvilágotutalOlymár

Forrás: pepitahirdeto.multiapro.com

Most adunk egy tippet, mivel váltsa ki meglévő halogén izzóját, a kevesebb energiafogyasztás végett! LED spotlámpával csökkentheti a világításra fordított energiát! A 3 wattos LED lámpa bruttó 890 Ft-ba kerül, ennyiért legfeljebb 3 halogén izzót vásárolhatunk, ugyanakkor a fogyasztást negyedére csökkenthetjük, így hamar megtérülés a LEDre fordított csere. Energiatakarékos LED spotlámpa 3 watt fogyasztással a 20W halogén helyére az ANRO Épületdíszítés Webáruházban!


Feladva: 2015-04-09    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: LEDhalogén890fordítottANROkevesebbhamarizzók20WizzójátígyWebáruházbruttófogyasztássalmeglévőcsökkenthetjükdarablámpawattváltsanegyedére230V

Forrás: pepitahirdeto.multiapro.com

Ingyen elvihető, vagy esetleg olcsón eladó kályhát keresek, ami még használható! Ingyen elvihető rossz, megunt, kiöregedett műszaki cikket, háztartási gépet is keresek! Szállítást megoldom! Esetleg érdekel még kandalló kályha is, ha olcsón eladó! Budapesten és környékén. Tel: 0670 650 31 68


Feladva: 2017-11-08    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keresekEsetlegelvihetőIngyenkályháteladóolcsónmégmeguntérdekelrossz6500670megoldomTelSzállításthasználhatókörnyékénamiBudapestengépetvagy

Forrás: pepitahirdeto.multiapro.com

Eladó Suzuki Baleno, Swift I, Swift II (2005-töl), Ignis, Wagon R+, Splash felújított váltók. 3 hónap garancia! Cseredarab szükséges. Szállítás az ország egész területén. Ár: 40.000 Ft + szállítási díj - Budapest területén: 3.000 Ft - Pest megye: 4.000 Ft - a többi megye: 6.000 Ft Beszerelést vállalunk: 15.000 Ft


Feladva: 2015-10-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: SuzukiváltókfelújítottmegyeSwiftterületén15000ftdíjvállalunkszállításiSplashbeszerelést40000ftWagon6000ftegészIgnisországtöltöbbiszállítás

Forrás: pepitahirdeto.multiapro.com

Akrobatikus tűzzsonglőr és tűztánc show, színpadi pirotechnika, tűzijáték, UV & LED show, gólyalábasok, rendezvényszervezés. Acrobatic firejuggler and firedance show, stage pyrotechnics, fireworks, UV & LED show, stilts, event organizing.


Feladva: 2016-05-08    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: showtűzzsonglőrLEDfiredanceAkrobatikusandBudapestfirejugglerBeátaorganizingAcrobaticILLÉSeventrendezvényszervezéscsapatstiltsgólyalábasokprodukció

Forrás: pepitahirdeto.multiapro.com

Egyedi póló nyomtatás: legyen akár születésnap, legény- vagy leánybúcsú, vagy bármilyen más alkalom, egy egyedi póló mintázása, feliratozása nagyszerű ajándék. A Pólósaroknál céges pólót is rendelhet, emblémával láthat el, a pólótervezőben meg is tervezheti. Gyors, országos kiszállítás, pamut termékek. Pólósarok.hu


Feladva: 2017-08-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: egyedipólóvagymegmintázásaakárpólótervezőbenlegyenláthatnyomtatásemblémávalegyBudapestrendelhetalkalomPétertermékekpólótmásKisspamutcéges

Forrás: pepitahirdeto.multiapro.com

Anyaga: rozsdamentes acél, talpa 11 rétegű Tartalma: sütőkosár nyéllel, bakelit alátét, vákuum gomb Szín: piros Nyél: biztonságos, nem forrósodik Súly: 5000 gr Használható: gáz, kerámialapos, halogén, indukciós és elektromos tűzhelyen is Szószos edény mérete: 16 x 8 cm Lábas: 20 x 10 cm Lábas: 24 x 14 cm


Feladva: 2017-07-21    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: LábasSúlynyélleledényEDÉNYKÉSZLETforrósodiksütőkosárSzószosRÉSZESnemTartalmatűzhelyenbiztonságosrétegűelektromosNyéltalpaindukcióspirosacél

Forrás: pepitahirdeto.multiapro.com

Cégünk a szakszerű építési projektek kivitelezésére alakult. Családi házak, lakások, irodaházak, társasházak teljes körű generálkivitelezését, valamint felújítási munkákat vállalunk a Dunántúl szinte bármely pontján. Vállalunk mély és magasépítő munkákat, kézi - gépi földmunkákat, közműépítést, útépítést, tereprendezést, kertépítést, alakító földmunkákat, tereprendezést, ingatlanfelügyeletet, karbantartást, felújítási munkálatokat. Vállalatoknak, önkormányzatoknak, magánszemélyeknek is!


Feladva: 2015-11-06    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: vállalunkfelújításimunkákattereprendezéstföldmunkákatgenerálkivitelezésétmunkálatokatépítésikézikörűszakszerűteljeskarbantartástCégünkmagasépítőmély

Forrás: pepitahirdeto.multiapro.com

IFETCH - az igazi szórakozás Önnek és kutyájának! Újdonság a kutyajátékok piacán!! www.petsafe.hu/hu/ifetch-labdakilo vo/444-ifetch-labdakilovo-kutyaknak .html


Feladva: 2016-01-05    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: ifetchkutyajátékokÚjdonságkutyájánakhtmlÖnnekkutyaknakszórakozáslabdakilovigaziPápa418KftpetsafeTradinghttpWilsonpiacánkutyajáték

Forrás: pepitahirdeto.multiapro.com

Szerezzen izometriás csőszerelő képesítést, mely külföldön (pl. Németországban vagy Hollandiában) is egyre keresettebb fémipari hiányszakma. Tanfolyamunk távoktatásos, tananyagunkat ipari területen dolgozó cégek segítségével alakítottuk. További információk honlapunkon: www.cort-oktatas.hu/izometrias-cso szerelo-tanfolyam Telefon: 70/287-5525 E-mail: info@cort-oktatas.hu Nyilvántartási szám: 01169-2010 Tanfolyam végén akkreditált szakmai tanúsítvány több nyelven!


Feladva: 2017-10-18    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: Tanfolyamcsoszerelocortoktatasizometriásterületen2010Németországbanizometriasipari01169külföldöntananyagunkatszámmelyhttptávoktatásosNyilvántartási

Forrás: pepitahirdeto.multiapro.com

Három és négy napos jobb agyféltekés rajzolás ID módszerrel kurzusok akciósan 17500 Ft-ért eszközökkel együtt. Mindenkinek sikerül!


Feladva: 2017-04-30    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: rajzolásagyféltekésjobbeszközökkelHáromértBudapest17500DezsőakciósanImrekurzusokakciómódszerrelsikerülMindenkineknaposegyüttnégy

Forrás: pepitahirdeto.multiapro.com

Itt az idő, az ablakcsere ideje. Vásárolja Ön is nyílászáróját nagykerből 48% kedvezménnyel! Rendelje meg most ablakait és ajándékba adjuk az egyik ablakra a redőnyt vagy szúnyoghálót! (250000 Ft feletti rendelés esetén) IGLO5, IGLO5 CLASSIC •5 kamrás, •70 mm beépítési mélységű, •2x külső EPDM gumitömítéssel, •alap üvegezése 4/16 Ar/4 Low-e thermofloat üveggel, argon gázzal töltve, •Uw=0.92 W/m2K, •EN-674 szabványnak megfelelően, •MACO MULTI ... további részletek >>

MATIC KS vasalattal, •Lehetőség változó vastagságú üveg beépítésére Redőny, szúnyogháló, reluxa kedvező áron, rövid határidővel! További 5% kedvezmény nyugdíjasoknak és egyedülálló 2 vagy több gyerekes családoknak Látogasson el weboldalunkra, ahol részletes leírást talál termékeinkről. 2017. május 1-31. között regisztráló felhasználóink között ajándékokat sorsolunk ki, amelyet megrendelésével együtt szállítunk! Ajándékok: Hoppe Secustic kilincs 3 megrendelőnk minden ablakára, amelyet tőlünk rendel, Aereco légbevezető 5 lakásba, amelybe tőlünk rendelik a nyílászárókat.


Feladva: 2017-05-02    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 8226vagyRedőnyAblakamelyetközötttőlünkIGLO5MULTIablakaitmájusLowEljöttamelybetöbbeseténHoppeszúnyoghálóMACOmost2017üvegezéseBudapestmeg

Forrás: pepitahirdeto.multiapro.com

Könyvelés és bérszámfejtés kedvező áron Angyalföldön a Full Active Bt. könyvelőirodában. Egyéni vállalkozások és társas vállalkozások könyvelése kedvező áron. SZJA bevallás magánszemélyeknek kedvező áron. Könyvelését bízza hozzáértőkre! Visszamenőleges könyvelést is vállalunk. Ha bármilyen kérdése lenne könyvelés ügyben, keressen minket bizalommal. Tel: 412-08-06, Fax: 412-08-07


Feladva: 2015-01-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: áronkedvezőkönyvelésActiveFullAngyalföldönbérszámfejtés412vállalkozásokhozzáértőkreEgyéniminketbízzakönyvelőirodábankeressenKönyvelésétügybenlenne

Forrás: pepitahirdeto.multiapro.com

Reménytelennek érzed a nyelvtanulást? Nyelvtanárból sok van. Nyelvészből, a nyelvtant matematikai szinten ismerő tanárokból is... De olyan aki ugyan úgy beszéli a németet, mint a Magyart és jól is tud oktatni, abból kevés van. Ezt azok biztosan tudják akik horribilis összegeket költöttek már nyelvtanfolyamokra és magánórákra. Tudjuk, hogy vannak anyanyelvi tanárok, de ők magyarul nem tudnak, ami sokaknak egy leküzdhetetlen akadály. Nekünk két tanár áll rendelkezésre, akik mindkét nyelvet ... további részletek >>

anyanyelvi szinten beszélik. Egyikőjük 20 éves Németországban élés és tanulás után költözött haza és ad órákat Debrecenben, a másik tanárnő pedig még most is kint él és tanít Skype-on keresztül! Más teendőtök sincs, mint foglalni egy ingyenes próbaórát az alábbi weboldalon keresztül: www.nemetulegynemettol.hu


Feladva: 2016-09-28    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: szintenanyanyelviegyvankeresztülakikmintmásikTudjukérzedbeszéliksincsakadályakiDebrecenbenmagánórákraReménytelenneknemetulegynemettolkevésolyan

Forrás: pepitahirdeto.multiapro.com

Röviden és kivonatosan... Ez a piackutató cég időnként küld Neked egy végtelenül egyszerű kérdőívet... 10 perc alatt megválaszolható az összes kérdés! És még arra is fizet, ha frissíted a körülményeidet, alapadataidat! Nekem bevált, az összegyűlt pénzem mindig megérkezett 3 napon belül!


Feladva: 2013-03-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: NekedmégcégbellkérdéspiackutatónaponsszeskivonatosanmegérkezettmegválaszolhatóRvidenmindigalattPénzpénzempercválaszodsszegyűltkérdőívetbevált

Forrás: pepitahirdeto.multiapro.com

Örökre búcsút vehet a súlyos patron és toner kiadásoktól, aki képes újratölteni azokat. Lehet akár tintasugaras, vagy lézernyomtató, esetleg fénymásoló. A módszerben segítünk. Vásároljon egy liter nyomtatótintát, vagy töltse újra drága tonerjét, akár 1.000 Ft alatti palackozott tonerporral!


Feladva: 2015-03-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: vagytoneregyakártintaestonerVásároljonkiadásoktólezerTintapatronsegítünkmódszerbenpatronfénymásolósúlyostonerjétlézernyomtatóvehetdrágabúcsút

Forrás: pepitahirdeto.multiapro.com

Családi ház, építési lehetőséggel Eladó Felsőpakonyon, 900 nm-es telken fekvő, 92 nm-es, 2 szobás, cirkó fűtéses, összkomfortos, nagy fürdőszobás, nagy konyhás, belsőgarázsos hőszigetelt tégla családi ház. A szobák szalagparkettával, a többi helyiség kerámialappal burkolt. Fúrt kút, melléképület, kerti tartózkodó Befektetésnek is! A telken még egy lakás építhető, akár teljesen elkülönítve is. Vasúttal a KöKi és a nyugati pu. közvetlenül elérhető, M0 5km. Iskola, óvoda, ... további részletek >>

élelmiszer bolt van. Nézze meg, ha megtetszett, szeretettel várjuk.


Feladva: 2017-06-29    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: házcsaládilehetőséggelnagyépítésitelkenmegóvodakonyhásépíthetőkerámialappalIskolalakáshelyiség5kmfürdőszobásegyFelsőpakonyvárjuktöbbielérhető

Forrás: pepitahirdeto.multiapro.com

Betonozható nyers kavics, osztályozott kavics értékesítés féláron! Nyers kavics 700 Ft/tonna. Osztályozott kavics: megrendeléstől függően 1650 Ft/tonna nettó áron. Szemcseméretek: 4-8 mm 8-16 mm és 16-24 mm. Nyers kavics esetében, kitermeléstől függően akár évi 1-2 millió tonna eladása is lehetséges jól szervezett logisztika esetén. Azon cégek jelentkezését várjuk akik nagyobb mennyiséget rendelnek.


Feladva: 2017-06-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: NyerskavicstonnafüggőenféláronkavicsOsztályozott700eseténÚtépítőkkitermeléstőllogisztikaesetébenértékesítésszervezettrendelnekBetonozhatójólIlona

Forrás: pepitahirdeto.multiapro.com

Bosch kondenzációs kazán csere! Vállaljuk régi gázkészülékek cseréjét az új jogszabályok szerint Bosch kondenzációs gázkazánra. Ha megbízható, gazdaságos és a lehetőségekhez képest a legolcsóbb cirkót szeretne, akkor a Bosch (Junkers) Condens 2500, vagy a Condens 3000 a legjobb választás! Megbízható, stabil működés, rengeteg kiegészítő lehetőség, pl. szolár bővíthetőség, remek szerviz háttér! Akár 1-2 napon belül meg tudjuk oldani a kazáncserét! Tudunk segíteni a kémény bélelésben is!


Feladva: 2016-05-07    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BoschJunkersMegbízhatószervizcsereCondensBudapestkondenzációsmegszerintrengetegbelüljogszabályokműködésakkornaponcseréjétstabilszeretneAkár

Forrás: pepitahirdeto.multiapro.com

Kizárta magát? Nem nyílik az ajtó? Akad, szorul a zár? Hívjon és megoldjuk! Minden jellegű zár probléma gyors megoldása Budapest és Pest megye területén. Díjtalan kiszállás Budapest területén. www.zarcsere.eu Zárcsere - Zárcsere gyors szerviz éjjel-nappal.


Feladva: 2017-05-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: ZárcsereBudapestzarcserezárterületénnyílikgyorsNemproblémamagátwwwKizártahttpjellegűZárnyitásMindenZárszervizmegoldjukkiszállásHívjonDíjtalan

Forrás: pepitahirdeto.multiapro.com

A fitt emberek webáruháza. Eredeti Body&Fit termékek Magyarországon. Étrend kiegészítő, sporttáplálkozási, diétás termékek. Fehérjék, aminosavak, protein szeletek, diétás édességek. Nézze meg weboldalunkat és adja le megrendelését.


Feladva: 2017-07-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: termékekFitBodydiétáshungaryproteinwebáruházabodyfitaminosavakemberekwwwFehérjékfittmegrendelésétBudapestadjasporttáplálkozásiweboldalunkatmeg

Forrás: pepitahirdeto.multiapro.com

Montenegróban, BAR - SUSANJ - ban szobák, apartmanok kiadók.


Feladva: 2015-11-20    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SUSANJBARMontenegróbanhupontSzentesnyaralasTündemontenegroiKovácswwwnyaraláskiadókMontenegróiapartmanokszobákban

Forrás: pepitahirdeto.multiapro.com

Kiválóan működő sugárfúrógép profilváltás miatt eladó.


Feladva: 2017-07-25    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: eladósugárfúrógépFerencTórhmiattprofilváltásműködőKiválóaninotaVárpalota

Forrás: pepitahirdeto.multiapro.com

Ruhajavító üzletbe képzett varrónőt keresünk, felsőruházat és általános varrási munkák elvégzésére. Érdeklődni a 06 30 222 2912 vagy a 06 30 222 2912 -es telefonon lehet Munkaidő: Kedd - Péntek -ig Web: www.altalanosruhaszerviz.freewb.hu


Feladva: 2017-10-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkvarrónőt2912222üzletbeRuhajavítótelefononképzettfreewbvagyaltalanosruhaszervizÉrdeklődniLaszlohttpelvégzéséreBerkesWebmunkáksürgősen

Forrás: pepitahirdeto.multiapro.com

Gondja van egészségével? Érszűkületes? Csontritkulása van, vagy lúgosítani szeretné szervezetét? Esetleg cukorszintjén szeretne javítani? Látogassa meg oldalamat www.vitalioninfo.lapunk.hu Ajánlataim segítik Önt egészsége megőrzésében és jobbá tételében: allergia, bőrproblémák/ ekcéma,pikkelysömör,herpesz,lábszár fekély/erősödik immunrendszere, pótolja vashiányát, változókori problémákra, vízhajtó,alvássegítő, nyugtató, emésztéssegítő,cisztára,és daganatos betegségek megelőzésére.


Feladva: 2015-12-27    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vanszeretneÖntcukorszintjéncisztáralábszárfekélyVitalionsegítikEsetlegemésztéssegítőherpeszHRIAjánlataimszervezetétnyugtatópikkelysömörlapunkekcéma

Forrás: pepitahirdeto.multiapro.com

Legújabb digitális festékrétegmérő készülékünk az elmatronic F/NF HANDY. Nagyméretű LCD kijelzője könnyedén leolvasható, sőt a FLIP DISPLAY szolgáltatásnak köszönhetően az LCD kijelzőn megjelenő információk egy gombnyomással 180 fokban megfordíthatóak. Így a mérési eredmények minden esetben kényelmesen olvashatóak. Beépített mérőszonda, automatikus alapanyag felismeréssel. Gyors mérési sebesség, rendkívül egyszerű kalibrálás! 1 évgarancia! Magyar nyelvű használati útmutató! Áfás számla! ... további részletek >>

Szállítás raktárról azonnal! Ár: 49.000.-Ft Bruttó! Honlap: www.elmatronic.webnode.hu/products/elmatronic-f-nf-handy-digitalis-retegmero-keszulek


Feladva: 2017-02-26    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elmatronichandyLCDmérésifestékrétegmérődigitáliskeszulekdigitalisesetbenSzállításkijelzőnsebességkészülékünkmindenszámlaeredményekÁfásköszönhetően

Forrás: pepitahirdeto.multiapro.com

Hiába panaszkodsz nekem, hogy itt fáj-ott fáj, fáradt vagy... Sajnos interneten keresztül nem tudlak megmasszírozni! EL KELL JÖNNÖD! www.egeszseg-megorzes.com/masszazs


Feladva: 2017-04-20    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fájszenvedjJÖNNÖDottKELLittmegmasszíroznihogytudlaknekemnempanaszkodszkeresztülHiábainternetenBudapestsajnosTímeavagytovábbfáradt

Forrás: pepitahirdeto.multiapro.com

Moteck SW 280 kétszárnyas kapunyitó szett: 83500 Ft Országos házhoz szállítás, 1 év garancia! Magyar nyelvű telepítési és programozási útmutatóval! Szeretné kézben tartani a kényelmet? Ha IGEN! Akkor Önnek találták ki az elektromos kapunyitószettet! Egy távirányítóval megoldja a kapunyitást, sőt a kerti világítást is kapcsolhatja a távirányító segítségével! A Moteck SW-280 egy igen kedvező árú, extra sallangoktól mentes, kiváló ár/érték arányú, több éve forgalmazott kapunyitó szett ... további részletek >>

márka. Természetesen az nem akadály, ha Önnek egy régi kertkapuja van: a motor felszerelhető régi, új, egy-, vagy kétszárnyú kapura is, illetve tolókapuk esetén szinte a legtöbb, már működő kapura is. A kapunyitó szettek felszerelése tehát nem kíván különösebb átalakítást a meglévő kapurendszerén! Egyszerű telepítés, komolyabb szakértelmet nem igényel a felszerelése! Megrendelés, további technikai információk weboldalunkon: www.boltcenter.hu


Feladva: 2016-09-20    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: kapunyitóegynemszettÖnnekfelszerelésekétszárnyúkapuraigenrégi280MoteckMegrendeléskényelmetkülönösebbmentesházhoztolókapukvilágítástakadálysőt

Forrás: pepitahirdeto.multiapro.com

Tisza parti üdülőfaluban, különleges adottságokkal és széles vendégkörrel rendelkező 40 fő befogadására alkalmas étterem 30 fős terasszal, teljes berendezéssel, gépekkel családi okok miatt eladó. Az étterem 2015-ben épült, tetőtérben lakás, vagy vendégszobák kialakítására van lehetőség. Füvesített, gyümölcsfákkal, locsolórendszerrel ellátott, valamint belső parkolónak kialakított 1300 nm-es telken az épület 138 nm + terasz + tetőtér beépítési lehetőség. Az ingatlan Szegedtől 25 km-re, ... további részletek >>

Mártélyon, a természet közvetlen közelében, pusztai kilátással, ugyanakkor főút mellett helyezkedik el. Kiváló vendéglátás-turisztikai célra, vagy akár egy komplex családi birtok berendezésére. Az ingatlan csatornázott, központi fűtéses. Az étterem gépesített konyhával, pizza kemencékkel, raktárakkal, előkészítőkkel ellátott, igényesen berendezett és felszerelt. Az állandó vendégkör gyors megtérülést eredményez, ezáltal befektetésnek is kiváló lehetőség! A megadott ár irányár!


Feladva: 2016-07-19    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: étteremlehetőségcsaládiberendezésselteljesvagykiválóellátottingatlaneladóFüvesítettmegtérüléstugyanakkorokokpizza138adottságokkalkomplexvanegy

Forrás: pepitahirdeto.multiapro.com

HA ÖNNEK VAN ELADÓ MÁRKÁS KARÓRÁJA, AKKOR ÉRDEKLŐDJÖN A 06 30 350 319-ES TELEFONSZÁMON, VAGY AZ ALÁBBI E-MAIL CÍMEN: E-mail: aranybazarkft@gmail.com Óra, karóra felvásárlás Ha szeretné eladni márkás karóráját, mi magas áron megvásároljuk boltjaink egyikében, azonnali készpénzfizetéssel. Amennyiben van lehetősége fotókat küldeni a megadott E-mail címre, kérjük tüntesse fel mennyit szeretne érte kapni. Rövid időn belül válaszolunk. Amiket vásárolunk: Patek Philippe, Jager-LeCoultre, ... további részletek >>

Vacheron Constantin, Breguet, Audemars Piguet, Breitling, Panarei, IWC Schaffhausen, Omega, Rolex, ARANY ÓRÁKAT. Amiket nem vásárolunk; Aranyozott órákat, Japán-Kinai kvarcórákat, replika órákat, divat órákat nem vásárolunk. Debrecen, Csapó utca 52 sz. alatti ékszerbolt


Feladva: 2017-02-19    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: órákatmailvásárolunkAmiketDebrecenmárkásszeretnevannemfelvásárláskaróraÓracímreELADÓkvarcórákatboltjainkBreitlingaranybazarkft@gmailékszerbolt

Forrás: pepitahirdeto.multiapro.com

A magyar fejlesztésű és gyártású KREA gravitációs kéményrendszer a családi házak ideális kéménye. A kéménybe beköthető bármikor szilárd tüzelésű (cserép) kályha, kandalló, vagy akár kazán. Alkalmas atmoszférikus gázkészülékek füstgáz elvezetésére is, de megfelelő kiegészítőkkel egyszerűen és olcsón alkalmassá tehető turbós, ezen belül kondenzációs kazánok füstgáz elvezetésére égéslevegő ellátással együtt. Kedvező ár, hosszú élettartam, Kivitelezése egyszerű, akár saját kezűleg is elvégezhető. A ... további részletek >>

termékre 30 év garanciát vállalunk. A műszaki dokumentációk megtalálhatóak a Szegedi Székhelyünk és a Dunántúli Telephelyünk honlapjain! Országos házhoz szállítás : 12 000 Ft. Magyar Kéménygyártó Kft. Tüzeléstechnikai szaküzlet 8638 Balatonlelle, Kossuth Lajos utca 50/A Nyitva : H-P 8.00-16.00-ig. Tel.: 0630/8492544 www.kemenygyarto-balatonlelle.hu www.kemenygyarto.hu


Feladva: 2016-08-19    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: balatonlellekemenygyartoelvezetéséreKREAwwwfüstgázakárMagyardokumentációkAlkalmasélettartamkéményeTel000ezeneladóműszakikazánhosszúideálisKft

Forrás: pepitahirdeto.multiapro.com

A Bella Baby Happy Midi (5 - 9 kg), Maxi (8 - 18 kg) és Maxi Plus (9 - 20 kg) méretű pelenkái az elasztikus derékrésznek, a rugalmas tépőzárral történő rögzítésnek és a redőzött, szivárgás elleni védőgátaknak köszönhetően megbízható védelmet nyújtanak a kicsiknek. A Quick Dry fedőréteg, és az anatómiailag meghatározott nedvszívó mag minden eddigi megoldásnál szárazabban tartja a bababőrt: a felvett nedvesség ugyanis azonnal géllé alakul át, és egyenletesen eloszlik a nedvszívó réteg teljes ... további részletek >>

hosszában, egyben a kellemetlen szagokat is semlegesíti. A pelenka légáteresztő kivitele a bőr szabad szellőzéséért felel. Már első látásra is bababarát a pelenka külseje a sok bájos figura jóvoltából, a pelenkacserék a játékos mintáknak köszönhetően szórakoztató élményt is nyújtanak. Bella Baby Happy Webáruház - Olcsó pelenkák, baba termékek


Feladva: 2017-07-14    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: maxiHappyBabyBellanedvszívónyújtanakpelenkaköszönhetőenQuicktermékekszellőzéséértrétegrugalmastartjafigurakicsiknekbabaszabadderékrésznekbájos

Forrás: pepitahirdeto.multiapro.com

A ZOÉ Security Kft. elsősorban Veszprém megyében, de az egész ország területén is vállal vagyonvédelmi megbízatást és szívesen látnánk Önöket is a Megbízóink között. Tevékenységi területeink: objektum őrzés, porta szolgálat, pénz-és értékszállítás, járőr szolgálat, telephely őrzés, recepciós feladatok ellátása stb... Rugalmas alkalmazkodás az adott feladathoz, kedvező vállalási ár. Bővebben: www.zoe-security.com/szolgaltataso k


Feladva: 2016-05-20    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: securityzoevagyonvédelmiőrzésVeszprémszolgálatKftértékszállításmegbízatástElismertalkalmazkodáspénzszolgaltatasokRugalmasportavállalcomstbország

Forrás: pepitahirdeto.multiapro.com

Terhelhető aljzat szigetelés polisztirol EPS100 2cm 392Ft/m2 3cm 588Ft/m2 4cm 784Ft/m2 5cm 980Ft/m2 6cm 1176Ft/m2 7cm 1372Ft/m2 8cm 1568Ft/m2 10cm 1960Ft/m2 12cm 2352Ft/m2 15cm 2940Ft/m2 A készletről telefonon, vagy honlapunkon keresztül, emailon érdeklődjön. Országos szállítás!


Feladva: 2017-04-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: szigetelés6cm15cm980Ftaljzatszállítás2352Ft5cmTerhelhetőOrszágos12cm784Ftajánlóérdeklődjön1960Ft4cmHirdetőemailon10cm588FtPepitakeresztül

Forrás: pepitahirdeto.multiapro.com

Továbbá gyártunk különböző méretű, huzalvastagságú horganyzott és műanyagos drótfonat, vadvédelmi háló, vadháló, tüskéshuzal, tüskésdrót, szögesdrót, vezérdrót, kerítés háló, kerítésháló, feszítőhuzal, feszítő huzal, kerítésdrót, tüskés szöges vezér drót, vadkerítés, kerítés építés, kerítésépítés, kerítésfonat ,kiskapu, nagykapu, huzalfeszítő csavar, vibropréselt zsalukő, lábazati elem, fémoszlop, faoszlop, natodrót nato drót, fém fa beton kerítés oszlop, kerítéspanel, kerítéselem, kutyakennel, ... további részletek >>

drótháló, drótkerítés, kis nagy vas kapu, kutya kennel, szőlőoszlop, kerítésoszlop, betonoszlop, kutya kenel, szőlőkaró, kutyakenel, szőlő oszlop karó. Vállalunk az ország egész területén vadhálóval, vagy dróthálóval komplett kerítésépítést 1000 Ft/m áron. (Csak drótkerítéseket és vadvédelmi kerítéseket építünk, fakerítést nem!!!)Rengeteg terméket gyártunk és forgalmazunk a kerítésdróton és betonoszlopokon kívül, amit egy hirdetésben nehéz lenne felsorolni, ezért kérem, látogasson el honlapunkra www.kerites.hupont.hu oldalra, vagy telephelyünkre, a KÓTAJI DRÓTFONAT, VADHÁLÓ és BETONOSZLOP CENTRUMBA ahol személyesen akár további kedvezményekre is van lehetőség.


Feladva: 2017-05-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keriteswwwvadvédelmibetonBETONOSZLOPdrótVADHÁLÓDRÓTFONAToszlopgyártunkhálóvagyhupontkutyakerítéseketkerítéspaneltüskéshuzalaholegészkívülfém

Forrás: pepitahirdeto.multiapro.com

Könyvelés - Cégalapítás - Székhelyszolgálat Hosszított esti és hétvégi elérhetőséggel állunk Ügyfeleink rendelkezésére. Jelenlegi és leendő partnereinkkel a kölcsönös és feltétlen bizalmon alapuló baráti és üzleti kapcsolatra törekszünk, hiszen ebben a szakmában ez elengedhetetlen. Kft, Bt könyvelése 7.000 Ft-tól Egyéni vállalkozó könyvelése 6.500 Ft-tól Székhelyszolgálat 4500 Ft-tól Cégalapítás 19.990 Ft-tól Célunk, hogy az Ön számára is hasznos segítség lehessünk ... további részletek >>

mindennapjaihoz. Reméljük, hamarosan Önt is ügyfeleink körében üdvözölhetjük, s egyúttal várjuk mielőbbi jelentkezését. Részletes információ weboldalunkon!


Feladva: 2016-10-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: tólmindenMostügyfeleinkCégalapításSzékhelyszolgálatingyenKönyveléskönyveléseÜgyfelünknekegyúttalbarátiszámáraelérhetőséggelEgyéniüdvözölhetjükalapuló

Forrás: pepitahirdeto.multiapro.com

Munkatársakat keresek ingatlan ajánlói, és értékesítési területre. Ha még nem dolgoztál ilyen munkakörbe mi betanítunk, ha már dolgoztál az előnyt jelent.Ha foglalkoztál esetleg hitelezéssel vagy LTP-vel akkor is írj a számodra is van munka. Jelentkezni lehet a munka.ingatlan.srl@gmail.co m email címen. Kérlek, írj telefonszámot is hogy fel tudjam venni veled a kapcsolatot.


Feladva: 2017-08-29    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: ingatlanmunkakeresekdolgoztálírjMunkatársakatvelmunkakörbeemailLTPkapcsolatotilyencomvagyvelednemsrl@gmailhitelezésselvennimégesetlegtudjam

Forrás: pepitahirdeto.multiapro.com

LÁTOGASSON EL MUNKARUHA BOLTUNKBA! Munkaruha, munkavédelmi cipő, munkabakancs. Forgalmazott munkaruha és védőfelszerelés márkáink: Coverguard, Uvex, Lux Optical, Cado, Dunlop


Feladva: 2015-11-25    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: MunkaruhawwwMunkabakancscipőMunkavédelmiszívébenBudapestboltnyílóÚjonnanmrmunkaruha

Forrás: pepitahirdeto.multiapro.com

A Desigual színes. Vidám. Játékos! Ezek azok a szavak, amelyek tökéletesen leírják a Desigual márkát, amely a szenvedélyes Spanyolországból származik. Első pillantásra is látszik, hogy a Desigual táskái, cipői és kiegészítői különböznek a többiekétől. Minden egyes darab egy műalkotás, amely ötvözi a legújabb technológiákat, alapanyagokat és művészi kreativitást. A Desigual márka a sokszínűségéről híres és csak Önön múlik, hogy mit mivel párosít. Hagyja magát kísértésbe ejteni ... további részletek >>

játékosságával és különcségével! Szemlélje a divatot és a ruhákat egy teljesen új nézetből! www.lifestyleshop.hu/markak/desigual


Feladva: 2017-07-11    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: desigualhogyamelyegyalapanyagokatPepitakiegészítőiruhákatmittökéletesentechnológiákatkiegészítőkcipőidivatotamelyeklegújabbcipőtáskáiSzemlélje

Forrás: pepitahirdeto.multiapro.com

Fűkaszálást, fűnyírást, kis kertek ápolását, gyümölcsösök rendbehozatalát, permetezést vállalok kedvező áron. Tel: 0630-747-5888


Feladva: 2017-06-28    [Lakossági szolgáltatás]

Címkék, kulcsszavak: fűnyírástFűkaszálástvállalokTeláronkedvezőGáborNagypermetezésthozatalátrendbegyümölcsösök5888ápolását747kertek0630kis

Forrás: pepitahirdeto.multiapro.com

Vállaljuk műanyag, illetve alumínium redőnyök javítását. GURTNICSERE SZÉKESFEHÉRVÁR ÉS KÖRNYÉKE. Műanyag ablakok, ajtók beállítása, javítása, törött vasalatok cseréje. Hőszigetelt üvegek cseréje műanyag szerkezetekben. HÉTVÉGÉN IS!


Feladva: 2016-05-08    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: műanyagSZÉKESFEHÉRVÁRcseréjebeállításaRedőnyszervizajtókFejérHÉTVÉGÉNablakokredőnyjavításszerkezetekbenKÖRNYÉKEajtóAblakGURTNICSEREüvegekjavítását

Forrás: pepitahirdeto.multiapro.com

Hogy miért? Regisztrációkor leadott első 100 PV pontot meghaladó rendelésnél a következő AJÁNDÉKOKBA részesül: - 1 doboz ganodermás müzli - 1 doboz ganodermás fogkrém - Ingyenes regisztrációs díj - Ingyenes kiszállítás Ezen ajándékok értéke: 11.660,- Ft Legyen törzsvásárlónk


Feladva: 2017-05-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ganodermásdobozIngyenesfogkrémelsőtörzsvásárlóitörzsvásárlónkleadottExcelLegyenRegisztrációkorGano660müzlimiértregisztrálniértékerészesülHogy

Forrás: pepitahirdeto.multiapro.com

Elégedetlen a könyvelőjével? Új vállalkozást tervez? Adótanácsadásra van szüksége? Ne késlekedjen, keressen bennünket! Szombathely belvárosában több mint 15 éves szakmai tapasztalattal, valamint ügyvédi és könyvvizsgálói háttér biztosításával várjuk leendő megrendelőink jelentkezését Szombathely agglomerációs körzetéből is. Ügyfeleink igénye esetén a könyvelési anyagok a vállalkozás telephelyén történő átadása lehetséges. Teljes körű számviteli szolgáltatás ellátását vállaljuk egyéni ... további részletek >>

vállalkozók, Kkt-k, Bt-k, Kft-k, Rt-k, részére.


Feladva: 2016-10-05    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzombathelyszolgáltatásszámvitelikörűTeljesKftegyénimintkönyvelőjévelvállalkozásleendőtöbbvállaljukElégedetlenanyagokvárjukbelvárosábanellátását

Forrás: pepitahirdeto.multiapro.com

Magyarország első találka alapú (pay per date) és fokozottan biztonságos társkereső szolgáltatása! Csak akkor kell fizetni, ha összejön a randi, de lehet akár teljesen ingyen is! Nálunk nincsenek kamu profilok! Nincsenek zaklató levelek! Ne ülj otthon a képernyő előtt! Próbálj ki valami újat! www.beengedlek.hu


Feladva: 2016-11-06    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: levelekzaklatóNincsenekbeengedlekprofilokkamuotthonlehetdateüljrandiperösszejönpayfizetnialapúkelltalálkaakkorújatelsőCsakvalamiNálunk

Forrás: pepitahirdeto.multiapro.com

1 órán belül ott vagyunk, nincs kiszállási díj! Hétvégén és ünnepnapon is hívhat bizalommal, nonstop! Kerti kút, szökőkút vagy akár medence bekötését is vállalunk. Megoldunk mindent: legyen az átfúrt vízcső, ázás, -csap, - mosdó vagy akár -kádcsere, vagy vizes blokk teljes generálja, hívjon bátran. Mindenre van megoldás!


Feladva: 2016-08-12    [Lakossági szolgáltatás]

Címkék, kulcsszavak: vagyakármosdószökőkútvagyunkMindenrecsapkútottbátranázásKertibelülhívjonvízcsőnonstopórángeneráljaátfúrtbizalommalBudapestteljeslegyen

Forrás: pepitahirdeto.multiapro.com

Mistyque FehérneműSzalon Online Márkás termékek: Triumph, Sloggi, Felina, Skiny, Misty, Bahama. Rider papucsok, minőségi fehérneműk, fürdőruhák, harisnyák, zoknik - KIFUTÓ MODELLEK KEDVEZŐ ÁRON! Kínálatunkból: FIORE 40 den-es, mintás harisnyanadrágok, több színben: 1.550 Ft. SKINY Essentials Tolerance női trikó (kék vagy narancs): 4.250 Ft. Átadás személyesen: Budapesten (XVII. ker.), Bálványoson (Somogy), vagy országos kiszállítással. Webáruházunk: www.mistyque.hu


Feladva: 2015-11-27    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: mistyqueMárkásországosfehérneműkOnlinevagyFehérneműSzalonpapucsokRiderSKINYfürdőruháknarancsmintáskékdenminőségitrikóFIORESomogynőiTolerance

Forrás: pepitahirdeto.multiapro.com

Lófejes kulcstartó, nyaklánc, övcsat eladó. Érdeklődj telefonon: 30 640 5940, vagy postázni is tudjuk. www.hunbolt.hu/spd/2411/Lofej-patk oval-kulcstarto-3-x-4-cm


Feladva: 2016-11-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: eladónyaklánckulcstartóLófejes640telefononÉrdeklődjövcsattudjukpostázniBudapestvagyMargó5940

Forrás: pepitahirdeto.multiapro.com

Egyedi, minőségi, széleskörűen testre szabható kutyaházak többféle méretben és kivitelben. Egyéni elképzelések megvalósítása. Szigetelt, akár fűtött kutyaházak gyártása... Számos választható extra felszereléssel!


Feladva: 2017-07-06    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: kutyaházakgyártásaminőségiEgyediszabhatótestrefűtöttszéleskörűenakárSzigeteltmegvalósításaajánlóelképzelésekHirdetőfelszerelésselEgyéniPepitaextra

Forrás: pepitahirdeto.multiapro.com

Használt üzletberendezések eladók. Fali elem: 21.500.-/fm Gondola: 32.000.-/fm Szigetszentmiklósi raktárkészletről. Érd: 06-70-528-1162 ; 06-70-775-5205 Email: i roda@polcozzunk.eu


Feladva: 2017-07-04    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: raktárkészletrőlPolcozzunkSzigetszentmiklósiüzletberendezés000PolcrendszerGondolairoda@polcozzunk500Emailelem5205Fali775eladók1162üzletberendezések

Forrás: pepitahirdeto.multiapro.com

Megrendelőinknek díjmentes lakberendezési tanácsadás. Színvonalas választék, díjmentes felmérés. Költözik, tanácstalan? Enteriőr tervezés! Főbb területeink: - - Bútorszövet - Tapéta - Karnis - Függöny


Feladva: 2017-05-22    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: FüggönydíjmentesTapétaBútorszövettervezésajánlóEnteriőrHirdetőtanácstalanPepitaKöltözikotthonábafelmérésviszünkStílustKarnisválasztékSzínvonalas

Forrás: pepitahirdeto.multiapro.com

Kézzel horgolt babacipő, babaszandál, sapi, keresztelő babaszett. Rendelhető keresztelőre, babaszületésre, ünnepre, hétköznapra. Kiváló babaviselet. A babacipő szép és kényelmes. Pamut fonalból készül, természetes szellőzése miatt a baba lába jól mozog és nem izzad benne. Talphossza: 7-12 cm Méret és szín választható! Nézzen be weboldalamra, válogathat a szebbnél szebb babacipők és más horgolt baba termékek között.


Feladva: 2016-11-10    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: horgoltbabacipőbabababaszettkeresztelőbabaszandálszíntermészetesbabaszületésreMéretkészülkeresztelőreTalphosszafonalbólmásRendelhetőbennePamutnem

Forrás: pepitahirdeto.multiapro.com

Komáromi János (Málca, 1890. december 22. – Budapest, 1937. október 7.) író, újságíró. Több tucat elbeszélés és regény szerzője. Sorozatcím: Komáromi János munkái gyűjteményes kiadás IV. Kiadó: Genius Könyvkiadó Rt. Kiadás éve: 1930 Kiadás helye: Budapest Kötés típusa: egészvászon Terjedelem: 233 Nyelv: magyar Méret: Szélesség: 13.00cm, Magasság: 19.00cm Kategória: Irodalom szépirodalom regény, novella, elbeszélés Dedikált, aláírt könyvek Antik könyvek ... további részletek >>


Feladva: 2017-04-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: KiadásBudapestgenius1930DedikáltelbeszélésnapokszepregénykirJánosKomáromi00cmkönyvekSzélességHirdetőaláírtTöbbMéretPepitaéveújságíróíró

Forrás: pepitahirdeto.multiapro.com

Szalvéta felülnyomást vállalunk céges rendezvényekre, esküvőkre! Készítünk még: étlapot, itallapot, egyedi pincérblokkot, reklám gyufát, papír tányéralátétet, ültetőkártyát, menükártyát. www.ritternyomda.hu/keszites/szalv eta.php


Feladva: 2017-04-16    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szalvetaegyediajánlóritternyomdaétlapotHirdetőwwwmégPepitamenükártyátKészítünknyomásültetőkártyátesküvőkretányéralátétetrendezvényekrepapírcéges

Forrás: pepitahirdeto.multiapro.com

A méh pempő nemcsak étrendkiegészítőnek kiváló, de a bőr- és hajápoláshoz is az egyik legjobb termék. A méhek állítják elő, hogy ezzel a sűrű, ragacsos anyaggal táplálják királynőjüket. A méh pempő áldásos hatásait az ember már korán felfedezte és alkalmazza ma is szinte valamennyi betegség ellen sikeresen. Hatásait annak köszönhetjük, hogy benne rendkívül sok hasznos anyag található. A létfontosságú tápanyagok mellett számos más értékes összetevőt tartalmaz, többek közt acetilkolint és 10-HDA ... további részletek >>

savat is. Ezek adják intenzív gyulladásgátló antivirális és az agyműködést elősegítő hatásait.


Feladva: 2017-07-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásaithogypempőméhkiválóértékessűrűbenneétrendkiegészítőnekintenzívkoránmásezzelnemcsakadjákmárszámoselőköszönhetjükKittiEzekemberannak

Forrás: pepitahirdeto.multiapro.com

Számlaképes cégünk vállalja lakások, házak, irodák, komplett költöztetését, lomtalanítását, épületen belüli átrendezését. Igény szerint csomagolunk vagy csomagolóanyagot kiszállítunk, rakodási, szerelési feladatokat is végzünk. Minőségi, gyors munka több éves tapasztalattal, referenciával, hétvégén is hétköznapi árakon! Akár lakáscsere lebonyolítását is vállaljuk. T: +36 (70)23 53 403, +36 (1) 787 0230


Feladva: 2017-05-22    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: csomagolunkvállaljuklakásokmunkaszerintlebonyolításátvállaljagyorsIgénylakáscserecégünkMinőségiátrendezésétAkárSzámlaképesvégzünkbelüliárakon0230

Forrás: pepitahirdeto.multiapro.com

Hordozható cserépkályha 160.000 Ft-tól 320.000 Ft-ig. Akciós és egyedi kézzel készült csempéből! Hagyományosan járatokkal ellátva, hőtárolós kivitelben. Rendkívül gazdaságosak! A fűtési módok közül a leghatékonyabb. Kiváló ár-érték arány jellemzi a saját magunk készített cserépkályhákat. Minden darab egyedi! Építünk, cserépkályhákat, kandalló típusú cserépkályhákat, tartályos cserépkályha-kandallókat. Web: www.cserepkalyhak-mobilcserepkalyhak.hu Email: pollakferi@icloud.com Tel.: ... további részletek >>

06-20-397-91-02


Feladva: 2016-12-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: cserépkályhacserépkályhákat000HordozhatóegyediAkcióskandallókatmagunkRendkívül320sajátkivitelbentartályostóljellemzi397hőtárolós140arányTel

Forrás: pepitahirdeto.multiapro.com

Minden erőfeszítése ellenére sem tudja leadni a fölösleges kilóit? Nincs ideje,energiája edzőterembe járni? Megoldást ajánlunk. Biorezonanciával beállítjuk - az anyagcsere korrekcióját - a sejtszintű zsírbontást - étvágy csökkentést Már az első alkalommal beindul a fogyás. Heti 1 kezeléssel a folyamat fenntartható. A biorezonanciát ajánljuk,kisiskolás kortól,idős korig. A túlsúlyos gyermeket csúfolják a társaik és nem fogadják be. Ettől magányos,magábaforduló,sérült lesz,aki ... további részletek >>

evéssel és magányos játékokkal vigasztalja magát. Ebből a kiút az ésszerű fogyás. A túlsúlyos idősebbek - izületei nehezen cipelik a fölösleges súlyt, - a szívműködésük és - a vérnyomásuk fogyásért kiált. Alkalmanként egy 20 perces alakformáló masszázst ajánlunk,hogy a kilók onnan szívódjanak fel,ahol Önnek a legfontosabb. A normál súly - egészséget, - önbizalmat, - munkabírást, - boldog életet biztosít. Bővebb információért,időpont egyeztetésért hívjon a 06 30 907 47 86 telefonon. eletmod-debrecen.hupont.hu


Feladva: 2017-08-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogyásajánlunkfölöslegesmagányostúlsúlyosdebrecennemkilóithívjonfolyamatsúlyvigasztaljakorrekciójátmasszázsttársaikleadniegyeztetésértcipelikHeti

Forrás: pepitahirdeto.multiapro.com

Alsóörsi kiadó szálláshelyek fényképes gyűjtőoldala. Panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Több mint 100 fényképpel a szálláshelyekről és a településről! - SZÉP kártyát elfogadó szálláshelyek Alsóörsön - Egész évben nyitva tartó (kiadó) szálláshelyek - Weboldal: www.zimmerinfo.hu/alsoors/hu.htm


Feladva: 2017-05-04    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfomintapartmanokévbenTöbbnyaralóházakEgésznélkülvillákAlsóörsöndíjhtmvendégházakelfogadóközvetítésialsoorsPanziókkártyát

Forrás: pepitahirdeto.multiapro.com

A fogyókúra étrend követése során el kell felejtenünk a cukrot. Míg korábban a kávét, a kakaót, a teát előszeretettel cukroztuk, nem beszélve a házilag készült süteményekről, melyekből szintén nem sajnáltuk a fehércukrot, a fogyókúra étrend valami egészen másnak a kezdete. Egy olyan életmódnak, melyben a cukrot egészségesebb édesítővel váltjuk fel vagy hozzáadott formában teljesen kiszorítjuk a mindennapjainkból. Érdemes vásárláskor is odafigyelni arra, hogy az egyes termékek címkéjén mennyi ... további részletek >>

hozzáadott cukor van feltüntetve. Meg fogunk lepődni, hogy még az egészségesnek vélt paradicsompüré is nagy mennyiségben tartalmazza! Fogyókúra étrend tanácsok itt!


Feladva: 2017-08-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: étrendFogyókúracukrotnemhozzáadottméghogyfogyókúrásfeltüntetveÉrdemeskávéttartalmazzamelybenittvanszinténmindennapjainkbólkorábbanmennyiségben

Forrás: pepitahirdeto.multiapro.com

Lökhárító, motoridom javítás és műanyag karosszéria javítás, horpadás javítás, műanyaghegesztés. Sérült, törött lökhárítók, fényszórók és egyéb műanyag alkatrészek javítása. Robogók, nagymotorok műanyag burkolatainak javítása. Műanyag háztartási, és egyéb eszközök javítása. Képek és árak itt: http://muanyagjavitas.hu Tel. : (30) 9 124- 279 Budapest 1105, Halom u. 42. http://muanyagjavitas.hu


Feladva: 2017-01-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: javításMűanyagjavításamuanyagjavitashttpegyébBudapestLökhárítófényszórókZentaiKépeklökhárítókMŰANYAGJAVÍTÁStörötteszközökSérültHalom1105horpadás

Forrás: pepitahirdeto.multiapro.com

Kiemelt specifikációk: - Rendszermemória (RAM) 2 GB - Operációs rendszer verzió Android 7.1.1 (Nougat) - Kijelző átlója 5.2 - Kijelző felbontás 720 x 1280 - Fényképező felbontása, tulajdonságai 13 MP, f/2.0, phase detection autofocus, 1/3 - Processzor sebessége Octa-core 1.4 GHz Cortex-A53 - Akkumulátor kapacitása 3000 mAh Ingyenes kiszállítás 24 hónap garancia Minden gyári tartozékkal Magyar nyelvű készülék VIP Phone szaküzlet 1138 Budapest, Váci út 136/c. +3670-930-4414 ... további részletek >>


Feladva: 2017-07-12    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: mobiltelefonnokiavipkeksimKijelzőphone3000PepitadetectionnyelvűAndroidkapacitásakártyafüggetlenphasewwwMagyarverzióAkkumulátorDual4414A53

Forrás: pepitahirdeto.multiapro.com

Kongép Bt .Saválló, rozsdamentes polcok, pultok, tálcák, büfékocsik gyártása. Saválló ipari padlószifonok gyártása. Különböző saválló nagykonyhai termékek gyártása. Saválló, rozsdamentes anyagok megmunkálása, fémmegmunkálás, lemezmegmunkálás, lemezhajlítás, élhajlítás.


Feladva: 2013-08-04    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: SavállórozsdamentesgyártásaKongépgépektálcákanyagokpultokpolcokkongepbttartályokwwwtermékekfelhordószalagokhttpnagykonyhaiszállítószalagokKülönböző

Forrás: pepitahirdeto.multiapro.com

Ami egy házhoz kell Ha többet akar tudni, nézzen körül Akció !!!!!!!!! Itt www.vteam.hu www.vteam.hu/Komuves-munka www.vteam.hu/Kerites-epites www.vteam.hu/Lakasfelujitas Lakásfelújítás legkisebbtől a legnagyobbig. Ingyenes árajánlat. Mindenféle, ami egy ház és lakáshoz kell Viacolor- térburkolat Lakásfelújítás burkoló munkák Kerítés építése Gipszkarton Kőműves munkák Dryvitozás homlokzatjavítás Ajtó ablak csere Falazás, vakolás


Feladva: 2015-03-10    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: vteamwwwhttpmunkákKőművesegyamiKerítésLakásfelújításlegnagyobbiglegkisebbtőlkellDryvitozástöbbetlakáshozházhozházkerepitesGipszkartonXXIII

Forrás: pepitahirdeto.multiapro.com

Fájdalommentes és esztétikus fogszabályozás, a Fogszabályozás Centrum segítségével. Jöjjön el egy ingyenes konzultációra és minden lehetőségről tájékoztatjuk. GYERMEKKORI FOGSZABÁLYOZÁS oldalunk: www.fogszabalyozascentrum.hu/index .php/BLOG/Gyermekkori-fogszabalyoza s


Feladva: 2017-06-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: FogszabályozáshttpesztétikustájékoztatjukmenteslehetőségrőlFájdalommindenBudapestkonzultációragyermekingyenesFelnőttegyJöjjönsegítségévelCentrum

Forrás: pepitahirdeto.multiapro.com

Rövid- és hosszú ujjú bababody rendelhető kiváló minőségben és mosást tűrő nyomással, felirattal, többféle mintával. Rocker és motoros babáknak is, online rendeléssel. Webáruházunkban leadott rendelését 3-5 napon belül kiszállítjuk az ország bármely területére. www.rockpont.polomania.hu/termekek /4857_Babaruha-Rocker_es_motoros_be bibody


Feladva: 2017-08-24    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: motorosbababodyRockerujjúkiszállítjukmintávalhosszúbelültöbbféleRövidnaponfelirattalBudapestrendelésétnyomássalRockPontleadotttűrőbébiknek

Forrás: pepitahirdeto.multiapro.com

Egyedi ajándék a legjobb áron‎ Rendeld meg a legszebb névre szóló ajándékot szerettednek!


Feladva: 2017-09-24    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: szólónévreáronlegjobbajándékszerettednekEgyediajándékotajánlóHirdetőPepitalegszebbékszerekmegRendeld8206

Forrás: pepitahirdeto.multiapro.com

A Puli sétányon, Csepel kiemelt zöldövezetében, néhány lépésre a Katalin horgásztótól és az Akácfa utcai kiserdőtől egy pompás lakás eladó. A lakás felújított, 70 nm-es, 2+2 szobás, 1. emeleti, loggiás, csendes, világos, cirko fűtésű, jó beosztású, tiszta levegőjű. A lakáshoz egy pince is tartozik. A beépített konyhabútor és a háztartási gépek a vételár részét képezik. Ne az árat nézze, hanem a lakást! Hívjon még ma! Fotókat tudok még küldeni.


Feladva: 2017-07-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: PuliegylakásmégHívjonAkácfabeépítettAndrascsendeslakásthorgásztótóltartoziksétányloggiáshanemKatalinpinceemeletinézzelépésreszobásárat

Forrás: pepitahirdeto.multiapro.com

Bútorrestaurálás, asztalos és kárpitos munkák, galéria, egyedi bútorok és kópiák készítése. Bútorfényezés politúrral és lakkokkal, viaszokkal. Antik bútorok restaurálása, bútorjavítás és bútor készítés hagyományos és új módszerekkel. Bútorfényezés sellakpolitúrral, különböző viaszokkal és lakkokkal, intarzia, fafaragás készítés és javítás. Kárpitos bútorok restaurálása szerkezeti javítással, rugózat újra építésével, afrik és vattatöméssel, újabb garnitúrák, ágyak, heverők székek áthúzása.


Feladva: 2016-02-03    [Régiség - Művészet]

Címkék, kulcsszavak: bútorokKárpitosBútorfényezésasztaloskészítéslakkokkalviaszokkalrestaurálásaágyakmunkákmódszerekkelgarnitúrákhagyományosújabbBútorrestaurálásjavítás

Forrás: pepitahirdeto.multiapro.com

A Makulátlan Tiszta Terület Kft., Panoráma ablak, a PVC, a Parketta, a Felújítás utáni, A szőnyeg mély tisztítása, az Irodai eszközök tisztítását, a Zsíros kézmosó, a Boltíves üvegtető, a Lépcsőházi takarítás, a Kazánház takarítása, a Sportlétesítmény, a Kirakattisztítás, a Nagy felületű ablak tisztítása, a Mohás terasz takarítása, az Éttermi asztal tisztítása, a Maszatos, csíkos padló tisztítását a Gumicsík eltávolítását, a seprést, a Domború burkolatok, az Irodaház ablakainak tisztítását, az ... további részletek >>

Olajozott parketta tisztítását, a Garázs tisztítását, mind kihívásnak tekinti, és örömmel végezzük el.


Feladva: 2016-11-16    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tisztításáttisztításaMakulátlanparkettatakarításaKftTerületablakTisztafelületűeszközökpadlóNagyGarázsIrodaicsíkoskerületKirakattisztításmélyPVC

Forrás: pepitahirdeto.multiapro.com

Bontási és kőműves munkákkal foglalkozom. Felújítandó lakások és más helységekben, továbbá családi házakban stb... Falak, burkolatok nyílászárók kibontásával panel lakásokban is. Fűtés és gépészet megszüntetése radiátorok és csövek lebontása. Kádak, zuhanytálcák megszüntetése. Szaniterek és csaptelepek leszerelése. Fém szerkezetek bontása és épület bontás. Válaszfalak építése és vakolása aljzatbetonozás. Kisebb javító és helyreállító munkálatokat is elvégzem. Budapesten és környékén.


Feladva: 2016-11-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megszüntetésebontáskőművesleszereléseXIXlakásokbanGáborKisebbmáscsaptelepekXVIIIpanelNovákaljzatbetonozáslakásokSzaniterekXVIIkibontásávalXVI

Forrás: pepitahirdeto.multiapro.com

Szeretnél egy saját autót, melyet nem neked kell kifizetni? Mi lenne, ha álmaid autójának kifizetését egy cég átvállalná tőled? Akkor itt az idő, hogy csatlakozz hozzánk a DXN céghez! Tanulj, dolgozz, óvd meg egészséged a cég termékeivel, és add át tudásod másoknak is, ezzel kiérdemelve a cég elismerését! Az alább megjelenített honlapon csatlakozhatsz hozzánk!


Feladva: 2016-10-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: cégegyDXNhozzánkalábbmelyetóvdátvállalnáelismerésétautótdolgozzsajátTanuljkifizetésétkiérdemelveSzeretnélcéghezautójánakezzelKertvárosálmaid

Forrás: pepitahirdeto.multiapro.com

Robway Hoverboard-ok széles választéka. Legjobb minőség, garancia, Samsung akkumlátor, Bluetooth, Innovatív applikáció. 79.900 Ft-tól www.cityroll.hu/robway.html


Feladva: 2017-09-22    [Autó - Motor - Jármű]

Címkék, kulcsszavak: robwayHoverboardBluetoothHirdetőakkumlátorPepitaSamsunghtmlgaranciaminőségcityrollLegjobbwwwválasztékatólszéles900applikációGyőrInnovatív

Forrás: pepitahirdeto.multiapro.com

Rendelkezel már pénzügyi előképzettséggel? Szívesen segédkeznél új vállalkozások indulásában és működtetésében? Könnyen átlátod a pénzügyi hiányosságokat és új törvények alkalmazásában rejtőző nehézségeket, majd rövid időn belül mindenre találsz megoldást? Jelentkezz Budapesten induló Vállalkozási mérlegképes könyvelő OKJ-s tanfolyamunkra! A tanfolyamhoz szükséges szakmai előképzettség: Pénzügyi-számviteli ügyintéző, Vállalkozási- és bérügyintéző, Pénzügyi termékértékesítő vagy Államháztartási ... további részletek >>

ügyintéző szakképesítés. A Budapesten induló tanfolyam árát, akár részletekben is kifizetheted. A szükséges szakmai gyakorlat helyét az iskola biztosítja, így nem kell keresgéléssel töltened az idődet. Ha jelentkeznél az OKJ-s tanfolyamra vagy bármi kérdésed lenne, csak kattints az oldalunkra és töltsd ki az űrlapot: www.tanfolyamokj.hu/vallalkozasi-merlegkepes-konyvelo-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: PénzügyibudapestenokjmerlegkepesVállalkozásitanfolyamkonyveloügyintézővagytanfolyamokjszakmaiszükségesindulóbiztosítjaalkalmazásábanszakképesítésmár

Forrás: pepitahirdeto.multiapro.com

Az AR-5316-os A3-as másológép 1 db 250 lapos papírfiókkal és 1 db 100 lapos oldalsó adagolóval rendelkezik. Egyszerű, könnyen kezelhető berendezés. A másológép lézernyomtatóként is használható a beépített LPT és USB portjain keresztül. Windows 10 operációs rendszerrel nem kompatibilis. www.fullc.hu/sharp/webaruhaz.php?S HARP-AR-5316-hasznalt-masologep&ope n=&id=465&kat=24&menu=w


Feladva: 2017-09-18    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: 5316SHARPmásológéplaposHirdetőkeresztülEgyszerűPepitaportjainrendelkezikhasználtphpUSBadagolóvalwebaruhazLPToldalsófullcbeépítettmenuwww100

Forrás: pepitahirdeto.multiapro.com

Vállalom családi házak kivitelezését, átalakítását, felújítását, burkolást, hőszigetelést, gipszkarton szerelést, térkövezést, illetve mindennemű kőműves munkát. Hívjon bizalommal!


Feladva: 2016-10-24    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kőműveshőszigeteléstmunkákatburkolástbizalommalfelújítástHívjonátalakítástmunkátkivitelezésétházakmindenneműcsaládiilletveVállalomtérkövezéstIstván

Forrás: pepitahirdeto.multiapro.com

Luxus Cars Jaguar az országban egyedülállóan foglalkozik hófehér jaguárok bérbeadásával. A Jaguár ezen R-es típusából fehér színben, jelenleg a nálunk lévő kettő darab található Magyarországon! Ritka és egyedi esküvői autó. A méltán elhíresült hófehér Jaguár egyedi megjelenése minden esküvői stílushoz igazodik a retrótol a legmodernebbig, fehér színe pedig szintén minden stílussal össze illeszthető az esküvők alapszíneként. Az autó kölcsönzése, bérlése bármely célra megfelelő lehet.


Feladva: 2016-09-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: esküvőimindenegyediJaguárhófehérfehérautóegyedülállóanösszekettőlehetországbanstílussalmegjelenéselévőmegfelelőJaguarnálunkcélraCarsszintén

Forrás: pepitahirdeto.multiapro.com

Eladó XVI. Kerületben, egy 6-lakásos társasház alatt, főútvonalon, az Örs vezér tér közelében (Nagyiccén) 20 m2-es, komfortos garázs WC-vel, mosdóval, saját vízórával és villanyórával. Két ablak nyílik a főútvo-nalra. A billenő garázsbejáraton még egy külön nyitha-tó személybejárat is van. Ára: 3.900.000.- Ft. Tel: 06302226247


Feladva: 2017-09-24    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egyvelTellakásosbillenőgarázs000Kerületbennalrakomfortos900XVIfőútvoNagyiccénÁraEladónyílikközelébenvanBudapestablaktérszemélybejárat

Forrás: pepitahirdeto.multiapro.com

Imagine színkatalógus alapján 260 féle színárnyalatban választható. Hosszú élettartamú, vízzáró, de páraáteresztő, időjárás állósága kiváló, öntisztuló díszvakolat. 10 év gyártói írásos szín- és termékszavatossággal. Anyagszükséglet: ~ 2,5 Kg/m2 Kiszerelés: 15 Kg/vödör kiadósság ~ 6 m2


Feladva: 2016-04-06    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: díszvakolatfélekapartöntisztuló260SILICONkiválóalapjánkiadósságállóságaszínkatalógusvödöridőjárásImagineKiszereléspáraáteresztőKftAnyagszükséglet

Forrás: pepitahirdeto.multiapro.com

Felelős műszaki vezetői közreműködést, építési műszaki ellenőri tevékenységet, elektronikus építési napló vezetését, építési terv alapján költségvetés készítését vállalok, mind magánszemélyek, mind vállalkozások megbízottjaként, Budapesten és környékén magánszemélyek részére is. Csonka János OK-ÉP-2004 Kereskedelmi Szolgáltató Bt. +36 20 398 5284 csonkajanos58@gmail.com


Feladva: 2017-08-31    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: építésiműszakinaplómindJánosCsonkamagánszemélyekcomkészítéskörnyékénvezetésétcsonkajanos58@gmailellenőrBudapesten5284vezetőmegbízottjaként3982004

Forrás: pepitahirdeto.multiapro.com

Megbízható, kipróbált, havidíj mentes rádiós riasztórendszerek telefonos és GSM értesítéssel, vezeték nélküli érzékelők, hangjelzők közvetlenül a forgalmazótól. Szerelésre előkészített komplett riasztórendszerek, melyeket csak fel kell szerelnie. Keressen minket!


Feladva: 2015-01-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: riasztórendszereknélkülivezetékRiasztodepoGSMRiasztódepóTelwebáruházaelőkészítettrádióswwwSzerelésrementesminketforgalmazótólhavidíjKeressenkell

Forrás: pepitahirdeto.multiapro.com

Problémás a matek? Tanulj a ”Rendhagyó matek” sorozat könyveiből! Szeretsz gondolkodni, logikai feladatokat megoldani? Rengeteg feladatot találsz megoldásokkal a ”Gondolkodj!” című könyvben. Esetleg a természetbe vágysz? Szívesen olvasnál túraleírást, érdekel a Kéktúra? Akkor olvasd el a ”69 nap alatt Magyarország körül” című kiadványt. A megadott honlapon valamennyi könyvbe bele is olvashatsz.


Feladva: 2015-10-21    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: 8221matekcíműEsetlegbeleSzeretsznapkönyvbenkönyvbekönyveibőlolvasdGondolkodjvalamennyisorozatAkkormegoldásokkalhonlaponKéktúratalálszmegadott

Forrás: pepitahirdeto.multiapro.com

Szeretné gyógyszerek nélkül megszüntetni allergiáját? Akkor nálunk megtalálja a megoldást. A kiváló minőségű HYLA garantáltan megszünteti az allergéneket otthonában és így az Ön tünetei is elmúlnak. Magas minőség – alacsony áron! Kedvező áron végezzük otthonának teljes körű allergénmentes takarítását: kanapé, ágy, ágynemű, matrac, szőnyegtisztítás és levegőtisztítás! Utána nyugodtan fellélegezhet. Bővebb információért, árajánlatért forduljon hozzánk bizalommal!


Feladva: 2013-11-15    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: áronHYLAallergénmentesUtánaAkkorotthonánakotthonábanlevegőtisztításallergiájátvégezzükallergéneketszőnyegtisztításmegszüntetnibizalommalmegszüntetiágy

Forrás: pepitahirdeto.multiapro.com

A C-vitamin tabletta segítségünkre lehet különböző eredetű betegségek kezelésében. Mivel kitűnő immunerősítő és regeneráló hatással rendelkezik, fertőzések, gyulladások esetén elősegíti a gyógyulást. A C-vitamin tabletta a szív- és érrendszeri betegségek esetén is használható, hiszen erősíti az ereket, javítja a keringést, segít megelőzni és kezelni a különböző keringési problémákat, mint az érelmeszesedés, érszűkület. A C-vitamin tabletta kúra a megelőzéshez nagyon hasznos. Felvértezi a ... további részletek >>

szervezetet a kórokozókkal szemben, valamint antioxidáns védelmet nyújt a káros szabadgyökök ellen. Hogyan hat az 1000 mg C-vitamin? Tudjon meg mindent weboldalunkon, ahol vásárolhat is!


Feladva: 2017-07-04    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vitamintablettaeseténkülönbözőbetegségekkúramintKellér1000hiszenkórokozókkalhatássalproblémákathathasználhatószervezetetregenerálókeringésiHogyan

Forrás: pepitahirdeto.multiapro.com

Építésvezetőt keresünk felvételre, az alábbi elvárásokkal. Szakmai önéletrajzokat a hazai@upcmail.hu e-mail címre várjuk. FŐBB FELADATOK, MUNKÁK: Kivitelezési munkák teljes körű helyszíni koordinálása, alvállalkozók munkájának irányítása Ütemtervek készítése, határidők betartása és betartatása Árkalkulációk, anyagrendelések előkészítése, elektronikus építési napló vezetése Minőségi munka megkövetelése és ellenőrzése Minden egyéb építésvezetői feladat AZ ÁLLÁSHOZ TARTOZÓ ELVÁRÁSOK: ... további részletek >>

Legalább 3 éves kivitelezésben történt szakmai gyakorlat (magasépítés) Önálló és felelősségteljes munkavégzés Jó szervező és koordináló képesség Nagy terhelhetőség, rugalmasság Problémamegoldó- és feladat centrikus hozzáállás Jó kommunikációs képesség B kategóriás jogosítvány, saját gépkocsi ÁLLÁS, MUNKA TERÜLETE(I): Építőipar, Kivitelező, General kivitelező MUNKAVÉGZÉS HELYE: Rugalmas munkavégzési hely – Budapest-Pest megye


Feladva: 2017-09-19    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: feladatszakmaiMUNKAmunkákMUNKAVÉGZÉSképességkivitelezőbetartatásaPestteljesellenőrzésealábbiProblémamegoldóbetartása8211történtÁLLÁSmegkövetelése

Forrás: pepitahirdeto.multiapro.com

Vegye igénybe cégünk weboldal készítési szolgáltatásait.


Feladva: 2016-12-28    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: honlapokegyedikészítéseszolgáltatásaitweboldalakwebkészítésiMinőségicégünkigénybeVegyeBudapestWebnaviwebáruházak

Forrás: pepitahirdeto.multiapro.com

Cégünk tapasztalt emberei vállalják a nehéz tárgyak, berendezések, eszközök (gépek hűtők, klímák, jakuzik, zongorák, pianínók, egyéb nehéz hangszerek, stb.) szakszerű mozgatását, szállítását. Raktárainkban lehetőséget biztosítunk ügyfeleinknek, akár azonnal bútorok, eszközök, egyéb ingóságok rövidebb-hosszabb idejű elhelyezésére.


Feladva: 2017-10-03    [Lakossági szolgáltatás]

Címkék, kulcsszavak: eszközöknehézegyébtárgyaktapasztaltakárpianínókCégünkügyfeleinknekzongorákelhelyezéséreBudapestbiztosítunkjakuzikidejűCsacsitranszlehetőségetklímák

Forrás: pepitahirdeto.multiapro.com

Cégünk a szakszerű takarítási szolgáltatásra alakult, mind vállalatoknak mind magánszemélyek számára. Tevékenységi körünkbe tartozik a lakás-, ház-, épület, lépcsőház és irodatakarítás, amelyet napi, heti, havi rendszerességgel végzünk, vagy egyszeri alkalommal, -igény szerint. Cégünk építkezés vagy felújítás utáni nagytakarítást is vállal. Vállaljuk extrém takarítási helyszíneken a munkavégzést, pl. Elhagyott ipari területek, Erőművek, koncertek utáni nagytakarítás. Kiégett lakások, ... további részletek >>

épületek takarítása, és bármely extrém szennyeződés eltávolítása profilunkba tartozik. Igényelje szakszerű Ipari Alpinista munkáinkat: Homlokzat takarítás, Ablak pucolás, Fakivágás. Profilunkba tartozik továbbá, kertek rendezése, kertek fenntartása, sziklakertek, csobogók építése. Ingyenes felmérést vállalunk a helyszínen, valamint tanácsadással szolgálunk takarítási technikákkal kapcsolatban.


Feladva: 2016-09-11    [Lakossági szolgáltatás]

Címkék, kulcsszavak: takarításitartozikCompanytakarításCleanerskertekIpariszakszerűutánivagymindProfilunkbaCégünkextrémépületkapcsolatbanbármelymunkavégzéstcsobogók

Forrás: pepitahirdeto.multiapro.com

Antikvitás, lakberendezés, belsőépítészet Régi- és stíl bútorok, egyéb régiségek Porcelánok - Festmények - Házimunkák Nyitva: minden nap 9-17 óráig


Feladva: 2016-09-16    [Régiség - Művészet]

Címkék, kulcsszavak: GalériaStílusbútorokbelsőépítészetmindenlakberendezésNyitvaAntikvitásHázimunkákGyulakesziFestményekPorcelánokrégiségekmodernegyébAntikstílóráig

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés a Konténer Gurutól telefonon és emailben is lehetséges! Hívás előtt az egyik legfontosabb kérdés, hogy hova szeretné elhelyezni a konténert! Vizsgálja meg, hogy befér-e a kapuján vagy csak az utcán marad-e hely a lerakásához. Ez utóbbi esetben ugyansi lehet, hogy területfoglalási engedélyre lesz szükség, ami módosíthatja a leszállítás időpontját. A konténer rendelés a főváros valamennyi kerületébe és Pest megye több településére is lehetséges még hétvégén is. Ha lomtalanítást ... további részletek >>

tervez, hívjon még ma, hogy a feleslegessé vált holmik ne az út szélén végezzék! Kérdések és válaszok konténer rendelés előtt weboldalunkon!


Feladva: 2017-08-16    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: konténerhogyrendelésméglehetségeselőtttervezkonténertidőpontjátKittiválaszokutóbbilomtalanítástelhelyeznileszállításKellérKérdéseklerakásáhozami

Forrás: pepitahirdeto.multiapro.com

Ausztriai kapcsolatokkal keresünk olyan agilis embereket Nemzetközi piacvezető Törzsvásárlói Rt.-hez akik Ausztriában partneri vezető Referensként tevékenykednének. Kiemelten várjuk 25-45 év közötti felsőfokú végzettséggel rendelkező céltudatos, sikerorientált munkatársak jelentkezését, akik nyitottak a tudatos vásárlási tanácsadó területre. Díjmentes, teljes körű magas színvonalú duális átképzést biztosítunk. Karrierlehetőség: • Kiemelkedő, teljesítményarányos nemzetközi jövedelem ... további részletek >>

• Életpálya program • Szakmai oktatások • Biztos háttér • Gépkocsi támogatás • Bónuszok Feladat: Az embereket és a cégeket informálni arról, hogyan tudnak tudatosan és felelősen vásárolni, ott, ahol eddig, azt, amit eddig, hogyan tudnak jelentős visszatérítéseket kapni készpénzben. A Vásárlási Tanácsadók feladata, hogy olyan plusz pénzeket tegyenek az emberek zsebébe, amely eddig is meg volt, de senki nem jutott hozzá, mert nem tudta, hogyan kell! A munkához tartozó elvárások:  Felső vezetéssel kapcsolattartás  Képzéseken való megjelenés Jövedelmi lehetőségek: Vásárlónként havonta 500-3000 forint lehetséges, teljesítményarányos jövedelem, amely kimagaslóan magasabb, mint amit Magyarországon bármilyen területen és pozícióban megkereshető! / Pl. 1000 vásárlónál 500.000-3.000.000,- millió forint havonta, EGYSZERI MUNKÁVAL!!!! / Gondolja át, hogy Ausztriában 8 588 584–en élnek és hányan vásárolnak nap, mint nap, és ennek megfelelően kiszámolhatja a havi jövedelmét is!!!! Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet! Email: rozsabusiness@gmail.com


Feladva: 2017-04-04    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8226eddigVásárlásihogyanjövedelem000AusztriaiteljesítményarányosakikAusztriábanmeghogynapmintemberekethavontatudnakforintnemzetköziamitnem

Forrás: pepitahirdeto.multiapro.com

Kossuth-díjas énekesnőt haragított magára. Bochkor olyasmiket mondott az Önindító című műsorában, hogy Bangó Margit kiakadt... A teljes cikk: www.femina.hu/hazai_sztar/bango-ma rgit-beszolt-bochkor-gabornak


Feladva: 2017-11-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: bochkormargitbeszolthogyajánlásműsorábanHirdetőbangocíműPepitasztarÖnindítógyufáthazaimondottkihúztafeminaolyasmiketGáborwwwmagárakeresik

Forrás: pepitahirdeto.multiapro.com

Szeretne könnyedén bevételre szert tenni Facebook oldala, vagy weboldala segítségével? ITT A MEGOLDÁS!!! Legyen üzleti partnerünk! Ne hagyja ki! www.multiapro.com/online-penzkeres et.php?ref=PA211


Feladva: 2016-09-30    [Pénzkeresés - MLM]

Címkék, kulcsszavak: partnerünküzletiLegyenkönnyedénFacebookpénztnagyjatenniKeressenszertbevételrePA211refMEGOLDÁSSzeretnephpITTOrszágosanpenzkeresetsegítségével

Forrás: pepitahirdeto.multiapro.com

RASZTA haj (dreadlock) - készítés (póthajjal is) , - javítás, - karban tartás, - nagygenerál, - hosszabbítás... Sokéves intenzív szakmai tapasztalattal, profiktól, a Westendnél! Speciális, ragacsmentes technikával dolgozunk! Minden infót megtalálsz a Honlapon, időpontért írj üzenetet itt! www.facebook.com/HaircoholiX.Szalo n


Feladva: 2015-07-29    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: rasztaHaircoholiXcomprofiktólkészítéshttpjavításírjWestendnélpóthajjalidőpontértoldalontapasztalattalSzalondreadlockszakmaihajmegtalálszintenzív

Forrás: pepitahirdeto.multiapro.com

Lakókocsiját, lakóautóját és hajóját tárolja nálunk! Mi vigyázunk rá, hogy Ön nyugodtan gondolhasson a következő nyárra! Vállajuk még járművének javítását is: www.lakokocsidepo.hu/egyeb-szolgal tatasok


Feladva: 2016-08-04    [Autó - Motor - Jármű]

Címkék, kulcsszavak: hajójátlakokocsidepolakóautójáthttpLakókocsijátnyárraSzigetszentmiklóskövetkezőKftgondolhassonkenyérnyugodtanKalászhogylehetőségvigyázunktárolási

Forrás: pepitahirdeto.multiapro.com

A legjobb otthoni segéd. E világszabadalmazott szerkezet szinte bárhol, bármilyen körülmények között felállítható, használható magunk, barátaink nagy megelégedésére. Minden grillezhető rajta. Teljes egészében rozsdamentes anyagból kézzel készült. A hihetetlen teljesítményű, fém hajtóműves kis méretű motor egy akkumulátor töltéssel több mint 20 órán át képes üzemelni. Bárhová vihető, vagy szállítható akár egy kis táskában is. Mérete igény szerint.


Feladva: 2016-08-08    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: kisegyGrillDobvagykörülményekméretű174rajtavihetőbármilyenhajtóműveskényelmesengrillezhetőBárhovábárholfémGrillezésszerintMindenüzemelniigény

Forrás: pepitahirdeto.multiapro.com

Mérleges adagoló gép eladó, az Ön igényei szerint! Poros, szemcsés vagy kisebb darabos áru (morzsa, száraztészta, magvak, stb.) adagolására, csomagolására alkalmas adagoló gép eladó. www.gepetgyartok.hu/adagolo1.htm Írja meg igényeit, és kérjen árajánlatot e-mailben! Elérhetőség: Kálmán László 6791 Szeged, Negyvennyolcas u. 49. Tel.: 30/604-5453 www.gepetgyartok.hu


Feladva: 2016-07-11    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: gépadagolóSzegedLászlóeladóKálmángepetgyartokwwwhtmmorzsa6791adagolo1árudaraboskisebbElérhetőségvagymailbenalkalmasszemcsésárajánlatot5453

Forrás: pepitahirdeto.multiapro.com

Sport HD kamera nem csak mindenféle sport események rögzítésére alkalmas, de lehet csatlakoztatni egy autóba, egy motorra, stb tartalmaz a sokféle tartót a csomag, hogy csatolja a kamerát könnyen mindenféle helyre. Tartalmaz egy vízálló tokot is a csomag. Kamera kijelzője 2” és a tömege a kamerának akkumulátor nélkül csak 46 gramm. www.elektronikai-webshop.hu/hu/spo rt-akcio-kamerak/30-sport-kamera-er intokepernyos-hd-720p.html


Feladva: 2017-10-14    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: sportkameraegycsakTartalmaz720perintokepernyosmindenfélecsomaghtmlmotorraautóbanélkülhelyrecsatlakoztatniakkumulátorlehetkameránakkönnyentömege

Forrás: pepitahirdeto.multiapro.com

A születésnapi idézetes papírtekercset minden férfi ismerősünknek ajánljuk, mely egyedi ajándék bármely korosztálynak. Termékleírás: Papírtekercs, színes szalaggal átkötve, fapálcikára feszítve, amelynek végei fagolyócskákkal vannak lezárva. Méret: 21cm X 16cm Itt található: www.dekorkucko.hu/papirtekercs-fer fi-szulinapi-koszonto


Feladva: 2017-04-27    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ferfipapirtekercskoszontoszulinapiátkötveminden16cmszalaggalpapírtekercset21cmszínesidézetesMéretTermékleírásszületésnapilezárvakorosztálynakvannak

Forrás: pepitahirdeto.multiapro.com

Akuna Alveo gyógynövények kombinációja, mely több évtizedes kutatómunka eredményeként született meg. Összetett hatásaival bárki egészségi állapotán képes javítani, hiszen kizárólag értékes hatóanyagok találhatók benne. A méregtelenítő Alveo ital fokozza a kiválasztószervek működését, így segíti a szervezet megtisztulását. Hatására a bevitt tápanyagok jobban felszívódnak és intenzívebben érvényesíthetik előnyeiket. Mivel a benne lévő növényi összetevők fokozatosan és kíméletesen hatnak, ... további részletek >>

fogyasztása nem okoz kellemetlen mellékhatásokat a méregtelenítés során. Méregtelenítés Akuna Alveo itallal - rendelés webshopunkban! www.gyogynovenyek.megoldascsomagok.com/akuna-alveo-szolos-950ml


Feladva: 2017-02-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: AlveoAkunaitalméregtelenítőMéregtelenítésbennewebshopunkbanműködésétképesfogyasztásatöbbintenzívebbenrendeléskiválasztószervekállapotánhatnakmely

Forrás: pepitahirdeto.multiapro.com

A legnèpszerűbb eladható tudàs a jobb agyfèltekès rajzolàs. Legyen ön is az Imre Dezső módszer akreditàlt kèpviselője. Akciós àr ötszàzezer Ft. Elvègezhető intenzív egy èv, vagy kèt èv alatt. Online konzultàciós lehetősèg tàvoktatàssal is.


Feladva: 2017-05-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 232224eladhatóegyImressaloktatóintenzívLegyentudásgezhetőrajzolvoktatlegnépszerűbbElvltekzezeragyflehetősötszjobbciósAkcióstudkonzult

Forrás: pepitahirdeto.multiapro.com

Bécsi úti referenciaszalonba felelősségteljes, munkájára igényes lelkes és kreatív, a szakma iránt elkötelezett fodrász munkatársat keresünk! Ha érdekelnek a vegyszermentes csúcs technológiák, és a környezet tudatos anyagok, és szeretnéd a legjobbat ajánlani vendégeidnek, nálunk a helyed! Elérhetőség: 20/ 323-7254-s számon!


Feladva: 2017-05-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkanyagokirántBudapestszámontudatosszakmaGabriella7254környezetkreatívNovotni323technológiáklelkesFodrásztElérhetőségcsúcsigényeshelyed

Forrás: pepitahirdeto.multiapro.com

Ha ön egy sok éven át használható és kényelmes garnitúrát szeretne prémium minőségben, jó helyen keresi! Egy szék ára 8000 Ft. Bármennyi készíthető és az asztal mérete és formája is változhat igény szerint, ha egy más garnitúrát szeretne. Új állapotban 2 év garanciát adok rá. Könnyen szállítható, mert egyszerűen szétszerelhető. A garnitúra ára lecsiszolt állapotban, festésre készen értendő, mindenki igényei szerint festheti akár, de megegyezés szerint le is festhetem. Kiszállítás is ... további részletek >>

megoldható.


Feladva: 2017-07-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: szerintegyállapotbanszeretnegarnitúrátáragarnitúramegoldhatókészíthetőfestésresokgaranciátKiszállításBármennyiprolignumfesthetem8000lecsiszoltmás

Forrás: pepitahirdeto.multiapro.com

10 éve működő tánc tanfolyam várja új kis tanítványait! 4-14 éveseknek. Helyszínek: XVI. kerület (Erzsébetligeti Színház, és Mltc Sportklub. XIV. kerületi Németh I. Ált.Isk. Korosztály szerint több csoportban: balett alapok, táncelőkészítő gimnasztika, videoklip táncok,divattáncok, színpadi show táncok, musicalek ... Fellépések, nyári napközis tánctábor. 5200 Ft/hó.


Feladva: 2017-02-17    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: kistánctáncokXVIvideoklipNémeth5200tanítványaitgimnasztikakerületitánctábortáncelőkészítőXIVnapközisvárjaalapokSportklubnyáritanfolyambalett

Forrás: pepitahirdeto.multiapro.com

Debrecen Biczókert utcában telek ELADÓ! 720 nm-es, városhoz közeli, jó közlekedéssel! Közel a városhoz! Autóval, busszal könnyen megközelíthető! Aszfaltos az utca. Vezetékes víz, villany, kerti kút a telken! Gáz a telek előtt, építkezni lehet rá, nagyon jó lakott környezetben, jó szomszédokkal!


Feladva: 2017-01-15    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: BiczókertDebrecenvároshoztelekmegGázkönnyentelkenbusszalEgerkútAutóval3300szomszédokkalkertiFerencnékörnyezetbenvillanyKözelNagylakottvíz

Forrás: pepitahirdeto.multiapro.com

Típus: Kompakt Érzékelő: 20 Mp CMOS LCD: 3.2”, 1.620.000 pont, Fix, érintőképernyő Videó: 1920×1080 (60p kép/mp) Áramforrás: Li akku + töltő (Alaptartozék) Memória: SD-XC, SD-HC, SD Optikai zoom: 25× (24 - 600 mm) optikai stab. Magyar menü, CMOS érzékelő, LCD touch, Wifi Megtekinthető: www.digifenykep.hu/canon/kompakt-p owershot-sorozat


Feladva: 2017-05-22    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: LCDérzékelőezustCMOSg9xpowershotcanonoptikaiPepitaMegtekinthetőzoomérintőképernyőWifiMemóriaFixtouchAlaptartozékponttöltő000akku6208221

Forrás: pepitahirdeto.multiapro.com

Ha nem tudjuk pontosan hol és hogyan jelenik meg a hirdetésünk, akkor valójában csak hisszük, hogy hirdetünk! A PEPITA HIRDETŐ is weboldal, éppen ugyan úgy látja a legtöbb internetes kereső, mint minden más weboldalt... Sajnálatos, de a legtöbb hirdetni szándékozó nem is tudja, hogy mit is kellene tennie hirdetése kereshetővé tételéhez, megtalálhatóságához. Vélhetően azért kívánnak hirdetni is, mert saját weboldalaikkal nem tudják a kívánt webforgalmat elérni! Prémium kiemelést kérő ... további részletek >>

hirdetőink számára ezt a problémát megoldjuk! Minden Pepita oldalunkon megtalálható Google keresőnkben a hirdetése mellett az összes weboldalrészletét is megjelenítjük önálló keresési találatként. További részleteket ezen az oldalunkon talál: www.pepitahirdeto.multiapro.com/apro.php?page_id=60547 Megjelenési, kereshetőségi garanciát kizárólag kért hirdetésekre és megbeszélés alapján vállalunk!


Feladva: 2015-12-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: PepitaHirdetőakikmegjelenéstbeállításukkalrendelkeznekKiemeltHatékonyabbSpeciálishirdetésseltulajdonosnakérdeklődőketaktívwebáruházmegfogadniirányítják

Forrás: pepitahirdeto.multiapro.com

Falmatrica, faltetoválás, faldekoráció webáruház. Olcsó falmatricák, óriási választék! Ha unod otthonod egyszínű, fantáziátlan falait...


Feladva: 2016-10-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falmatricashopwwwwebáruházfaldekorációfaltetoválásFalmatricaválasztékóriásifalmatricákOlcsó

Forrás: pepitahirdeto.multiapro.com

Búvóhely pároknak Siófokon néhány órára vagy éjszakára is! Csak hívj és foglalj. A feltüntetett ár 3 órára vonatkozik.Új szolgáltatásunk, dézsafürdőnk is igénybe vehető.(egyeztetést igényel) Rejtett telefonhívásokat nem fogadunk! Csak párok hívjanak! Nálunk a diszkréció az elsődleges szempont!


Feladva: 2017-06-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: pároknakBúvóhelyCsakóráraRejtetthívjszempontigényeléjszakáraelsődlegesegyeztetéstvagydiszkrécióvehetőnéhányNálunkigénybeSiófokonhívjanakpárok

Forrás: pepitahirdeto.multiapro.com

-AKCIÓS SERTÉSHÚS ÁRAK !- Sertéscomb ár : 890 Ft/kg Sertéslapocka ár : 880 Ft/kg Sertéskaraj ár : 890 Ft/kg Sertésoldalas ár : 880 Ft/kg Sertésdagadó ár : 880 Ft/kg Sertéstarja ár : 880 Ft/kg Sertéscsülök ár : 690 Ft/kg Budapest 1113.Bocskai út 42 sz. --- Telefon:061/3611-609 --- Web: www.lazarhus.hu Email: lazarhusmintabolt@gmail.com< /a>


Feladva: 2016-08-16    [
Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: 880BudapestÁRAKSERTÉSHÚSAKCIÓS890Email690lazarhusSertéscsülökwwwÉlelmiszerWebSertéstarjaHús609SertésdagadóLázár3611SertésoldalasBudapesten

Forrás: pepitahirdeto.multiapro.com

A projekt alap célkitűzése az volt, hogy egy olyan agrár online piacteret hozzunk létre, amely a mai magyar piacon egyedülálló funkcionalitással rendelkezik. Ennek köszönhetően az agráriumban tevékenykedő gazdák a számukra érdekes termékeket és szolgáltatásokat egy helyen, a lehető legrövidebb idő és energia ráfordítás mellett tudják megtalálni és a beszerzéseiket elindítani. Ezen a webes felületen informálódhatnak az aktuális pályázatokról, a szakmai programokról és a szakmai kiállításokról. A ... további részletek >>

gépek, az eszközök, az alkatrészek, a tápanyagok, a növényvédelmi és állattartási eljárások innovációiról, az oldalunkon található videók megtekintése útján informálódhatnak a gazdák. Honlapunkat a gazdáknak készítettük, de a gazdákkal együtt szeretnénk egy igazán jól használható, modern és innovatív agrár online piactérré formálni. A jövőben is a látogatók felmerülő igényei alapján fejlesztjük tovább. A folyamatos megújulni akarás visz minket előre.


Feladva: 2017-11-07    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: KftPendaszárzúzókrendsodrókekékimmárNégyáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetéti

Forrás: pepitahirdeto.multiapro.com

----Pick téliszalámi reklám áron! ---- Pick eredeti téliszalámi ára : 4390 Ft/kg Herz eredeti téliszalámi ára : 4390 Ft/kg Csongrádi füstölt kolbász ára : 1190 Ft/kg Pick paprikás szalámi ára : 990 Ft/db ---- Budapest XI. Bocskai út 42 sz. ----- ---- Telefon: 061/3611-609 ---- Web: http://www.lazarhus.hu Email:lazarhusmintabolt@gmail.com< /a>


Feladva: 2016-08-16    [
Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: áraPicktéliszalámiLázár4390Budapesteredetiszalámi1190Hús3611kolbász061füstöltárakTelefonCsongrádicomHúsboltBocskailazarhusmintabolt@gmail

Forrás: pepitahirdeto.multiapro.com

Zenerajongó vagy? A SoundCloud, a hang YouTube-ja. Adj hangot magadnak! Akár zenész vagy, akár amatőr rajongó, tudunk Neked segíteni. Válassz SoundCloud csomagjaink közül, akár zenehallgatást, akár követői csomagot, mind a kettőt olcsó árakon megteheted. www.likebolt.com/?product=1000-sou ndcloud-lejatszas


Feladva: 2016-07-09    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: akárSoundCloudhangvagyYouTubesegítenikettőtNekedZenerajongómindtudunkIldikocsomagotrajongókövetőiamatőrcomzenehallgatástzenészlikeboltközül

Forrás: pepitahirdeto.multiapro.com

- Szerszámok - Szerszámgépek - Kötőelemek - Rögzítéstechnika - Kötéstechnika - Hegesztéstechnika - Forrasztástechnika - Munkavédelem - Zárak- Lakatok- vasalatok - Festékek- Vegyiáru - Mérőeszközök - Csiszolástechnika


Feladva: 2016-10-04    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: FestékekSzerszámokvasalatokBudapestLakatokKftZárakBauMunkavédelemBarkerForrasztástechnikaSzakáruházHegesztéstechnikaSzerszámKötéstechnikaIparcikk

Forrás: pepitahirdeto.multiapro.com

Szeretnél egy emberbarát és hasznos médiamegosztó közösséghez tartozni? - Akik szeretnének bárki által gyorsan megtanulható otthoni (játékkal) pontot és pénzt keresni. - Akik szeretnének új barátságokat , szabadságot és minőségi életformát. Csatlakozz, gyere Te is légy Zenduja rajongó!


Feladva: 2017-07-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: játékkalszeretnénekAkikközösséghezrajongókeresnimédiamegosztóZendujapénzthasznoslégypontotemberbarátgyereegyCsatlakozzotthoniSzeretnéléletformát

Forrás: pepitahirdeto.multiapro.com

A szilvalekvár akkor az igazi, ha cukor nélkül főzzük. Ez akár egy teljes napot is igénybe vehet, de megéri a fáradozást, hiszen nemcsak finom, de nagyon egészséges csemegét kapunk végeredményként. Az aszalt szilva és a szilva lekvár hatásai hasonlóan jók, sőt, ez a gyümölcs nyers és aszalt formában tartogatja a legtöbb előnyt az emberi szervezet számára. Felhasználhatjuk székrekedés és túlzott gázképződés, puffadás ellen, valamint általánosságban az emésztés javításához. Ugyanakkor segíti a ... további részletek >>

májműködést és az agyi tevékenységet is. A szilva fajták és hatásuk bővebben weboldalunkon!


Feladva: 2017-02-14    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: szilvalekváraszalthatásukvalamintvehetlegtöbbKittifajtákvégeredménykéntellenigénybetartogatjaKellérkapunkpuffadásnapotformábankészítésecsemegét

Forrás: pepitahirdeto.multiapro.com

A D3 vitamin hatása nagyon jelentős, a legtöbb ember szervezetében mégis csak a kelleténél kevesebb található belőle. A hiány pedig súlyos következményekkel járhat! A D 3 vitamin fogyasztás rendszeresen már gyermekkortól kezdve fontos, amikor a csontok, a fogak és az izmok fejlődése a legaktívabb. Ilyenkor különösen oda kell figyelni rendszeres pótlására, hogy elkerüljük az angolkór és más mozgásbeli rendellenesség kialakulását. A D3 vitamin hatása kiterjed az immunrendszerre, az idegrendszerre, ... további részletek >>

a szív- és érrendszerre is. Segítségével sok gyakori krónikus betegség megelőzhető. www.d3.d-vitamin.bolt.hu/d3-vitamin


Feladva: 2017-07-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vitaminhatásaidegrendszerrekövetkezményekkelhogyemberfogakimmunrendszerresúlyospótlásáralegtöbbcsontokkiterjedpedigrendszeresjelentősamikorhiány

Forrás: pepitahirdeto.multiapro.com

Online kávé üzlet! Nemzetközi munkalehetőség kényelmesen otthonról! Új korszak az MLM üzlet történetében: A kezdőcsomagok árának 110-150%-a levásárolható www.kavekiraly.hu/blog-2014-12-22- DXN_DSP_Dynamic_Start_Program__A_ki t__B_kit__C_kit 70%-os heti bónuszkifizetés: www.kavekiraly.hu/blog-2014-12-01- DXN_DSP_Dynamic_Start_Program__Ingy enes_Ganoderma_kave_csomagok


Feladva: 2016-09-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kitwwwProgramStartDynamicDSPkávéDXNOnline2014blogkavekiralyüzletMLMGanodermaegészségesbónuszkifizetéskorszakIngyenesAkkorhetiotthonról150

Forrás: pepitahirdeto.multiapro.com

A lícium gyümölcs, másnéven farkasbogyó létfontosságú tápanyagokkal van tele. Szervezetünk számára kitűnő forrása vitaminoknak, ásványi anyagoknak, sejtvédő antioxidánsoknak és az emésztést segítő rostoknak. A lícium, azaz a lycium barbarum összetevői természetes formában vannak jelen, így könnyen felszívódnak a szervezetben. Gyermekeknél hozzájárulnak az egészséges fejlődéshez, felnőtteknél vitalizáló, krónikus betegségeket megelőző és kezelő hatásuk kiemelkedő. A lícium gyümölcs segítségével ... további részletek >>

közérzetünk, szellemi és sportteljesítményünk is javítható, fogyókúránk hatékonysága pedig megsokszorozható. www.lycium-barbarum.gojibogyo.net/lycium-barbarum


Feladva: 2017-07-24    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: líciumgyümölcsösszetevőibarbarumlyciumjavíthatósegítőtelebetegségeketígysportteljesítményünkemésztéstvankrónikusjelenszellemiantioxidánsoknakvannak

Forrás: pepitahirdeto.multiapro.com

Nem tud bejutni ingatlanába? Elveszett a kulcs vagy beletört? Elhagyta vagy ellopták? Segítünk! Sérülés mentes zárnyitás minden nap 24 órás ügyelettel Budapesten és Pesten. Hétvégén és ünnepnapokon is elérhetőek vagyunk plusz költség mentesen! Zár nyitása, zárfeltörése non- stop ügyelettel. www.ajtoambulancia.hu/zarnyitas.ht ml


Feladva: 2017-05-13    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: ügyelettelvagyzárnyitásajtoambulanciamenteswwwtudvagyunkSérüléshttpNemelérhetőekSegítünkBudapestünnepnapokonelloptákstopZárfeltörésHétvégénnon

Forrás: pepitahirdeto.multiapro.com

Az isiász gyógyítása általában teljes sikerrel jár, hiszen nem rosszindulatú betegségről van szó. Ez sokkal inkább egy tünetegyüttes, melyet az ülőideg összenyomódása okoz. Rendszeres testmozgással, a gerinc és a hátizmok ülés közben történő megtámasztásával, a helyes ülésmód elsajátításával megelőzhető a kialakulása és a kiújulása is. Az isiász lelki okai a túlterhelés érzésében gyökereznek. Ha valakin túl nagy a nyomás, a felelősség, túl sokat vállal magára pl anyagi gondok miatt, nagy ... további részletek >>

eséllyel alakul ki nála ez a probléma. Az idegbecsípődés és isiász kezelése történhet gyógyszerekkel és megfelelő tornával is.


Feladva: 2017-01-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: isiászidegbecsípődéstúlnagykezelésevállalsokkalkiújulásagyógyításagerincsokatszókialakulásaKittiproblématestmozgássalvanmegelőzhetőKellérnála

Forrás: pepitahirdeto.multiapro.com

”B” kategóriás jogosítvánnyal vezethető kisteherautók bérbeadása Budapesten és környékén rövid távra, vagy hosszú távra is tartós bérlettel, akár külföldre is. www.teherautorent.hu +3630/298-4353


Feladva: 2017-04-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: távra8221rövidbérlés3630környékénTeherautóteherautorentBudapestenwwwbérbeadásakülföldrekisteherautókakárvezethetőbérletteljogosítvánnyaltartós298

Forrás: pepitahirdeto.multiapro.com

Keresünk németországi intenzíves ápolásra szoruló betegekhez ápolókat, gyermekápolókat, diplomás nővéreket, két heti váltásban, jó kereseti lehetőséggel. Jelentkezni német nyelvű fényképes önéletrajzzal lehet e-mailben. Elvárások: -honosított (Anerkennung) vagy honosítható bizonyítvány -középszintű német nyelvtudás(B2-es nyelvvizsga) -munkatapasztalat Bővebb információ telefonon: H-P, 9-16 óráig!


Feladva: 2017-10-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németnémetországiElvárásokkétmunkatapasztalatMohácsmailbennővéreketnyelvvizsgaKftlehetdiplomásnyelvtudás2011önéletrajzzalgyermekápolókatKezeknyelvű

Forrás: pepitahirdeto.multiapro.com

Rutinos számítógép szerelőt keres? Megtalálta. Számítógép szerviz Budapest egész területén házhoz megy. Amit vállalok: számítógép javítás, szerelés, karbantartás, amennyiben megoldható, bővítés, korszerűsítés. Nem csak asztali számítógépet, hanem laptopot is szervizelek. Ha meglévő gépét szeretné lecserélni, akkor a számítógép vásárlásban is megbízható partnere lehetek. Ne habozzon, tekintse meg weboldalamat a további részletekért és minél hamarabb kérjen ajánlatot.


Feladva: 2016-06-22    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: számítógépszervizBudapestterületénArnoldrészletekértmegyakkorteljesNemtovábbiházhozlecserélnikorszerűsítésweboldalamatszeretnébővítésmegegész

Forrás: pepitahirdeto.multiapro.com

Siófoki Aranyparton apartmanok szabad strand mellett kiadók. Földszinti 3 szobás,fürdőszobás, konyhával nappalival, Tv, hűtő, kertkapcsolatos apartman 4-5-6 főnek. emeleti 1 szobás fürdőszobás, tv. hűtő felszereltséggel. Ebből 2 db van. Szép kártyát elfogadunk. Légkondi igényelhető térítés ellenében. Bővebben: gosyapartmanok.info


Feladva: 2016-09-29    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: hűtőfürdőszobásszobásapartmanokSiófokiBővebbenvízpartimellettellenébenstrandtérítésszabadigényelhetőemeletiLégkondifőnekAranypartonelfogadunkSzép

Forrás: pepitahirdeto.multiapro.com

A kívánság lampion története: Ezeket a papírballonokat repülő lámpásnak, azaz Tiang Deng-nek nevezik, eredete a keleti világban több száz évre nyúlik vissza. Ázsiában a mai napig hagyományosan több ezer ilyen repülőlampiont, azaz kívánság lampiont engednek fel az emberek újév napján, vagy az ismert ”Fullmoon” ünnepeken. Annyi év elteltével még mindig él a szokás, hogy feleresztésekor a belesuttogott, ráírt kívánságok valóra vállnak. Megrendelhető - lásd Honlap alább!


Feladva: 2015-02-18    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: kívánságlampiontöbb8221azazhogykeletinapjánalábbszokáseredeteújévSzegedHonlaphagyományosanmindignevezikemberekLátványPontlásdnapigmégnek

Forrás: pepitahirdeto.multiapro.com

Ha igen, akkor a lehető legjobb helyen jársz! Az UtazzFillerekért.hu segít benne, hogy a lehető legolcsóbban és legmegbízhatóbb módon foglalhasd le álmaid nyaralását, belföldi utazását, párnapos városlátogatását vagy esetleg a számodra legkedvezőbb repülőjegyet. Egyszerűen fogalmazva: levadásszuk Neked a legjobb ajánlatokat! Kell ennél több? Csapatunk tapasztalt, profi utazókból áll, akik az elmúlt évtizedben bejárták a világ összes kontinensét és rengeteg tapasztalatot halmoztak fel, ... további részletek >>

megismerkedtek a legnépszerűbb helyekkel és minden fontos infót gondosan feljegyeztek az adott desztinációról. Küldetésünk és célunk nem más, mint hogy a naponta frissülő utazási ajánlatok közül a legjobbakat és a legkedvezőbbeket kiválogatni utazni vágyó közönségünk számára. A wellness hotel, last minute utak és olcsó repülőjegy ajánlatok szövevényes világában ez nem olyan egyszerű feladat, mint aminek hangzik. Az UtazzFillerekért.hu oldalon nem csak a legolcsóbb repülőjegy kínálat, utazási opciók, szállás ajánlatok, vagy akár ingyenes nyaralás lehetőségek érhetők el, de könnyen inspirációt meríthetsz következő utazásodhoz, pihenésedhez is. Exkluzív választékkal jelentkezünk továbbá mind a belföldi nyaralás, mind pedig a külföldi utazás ajánlatok terén. Oldalunkon egyszerűen hozzáférhetsz autóbérlés keresőnkhöz, választhatsz magadnak útikönyvet és köthetsz utasbiztosítást – egyszóval mindent megtalálsz, ami a tökéletes utazás előkészítéséhez szükséges lehet! Belföldi és külföldi utazás ajánlatok egy helyen Ahhoz, hogy naprakész lehess és azonnal kihasználhasd a legkedvezőbb, legizgalmasabb utazási ajánlatokat és belföldi pihenés lehetőségeket, egyszerűen iratkozz fel hírlevelünkre e-mail címed megadásával oldalunk bal felső részén és lájkold Facebook oldalunkat! Amennyiben ajánlataink között nem találsz megfelelőt, szívesen segítünk megtalálni a számodra legjobb repülőjegy és szállás opciót. Írj nekünk bátran!


Feladva: 2016-10-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: ajánlatoklegjobbbelföldinemutazásUtazzFillerekértegyszerűenhogyajánlatokatutazásirepülőjegyvagymintszálláshelyenszámodralehetőlegkedvezőbbmind

Forrás: pepitahirdeto.multiapro.com

Ha nyaralni, üdülni, vagy egyszerűen kikapcsolódni szeretne a Balatonnál, jó helyen jár, válasszon minket, a 2× 5+1 férőhelyes, két hálóteres, az egész évben nyitva tartó apartman házunkat Siófokon. Az apartman Siófok kertvárosában helyezkedik el, közel mindenhez. A Balaton kb. 15 perc séta, a Galerius fürdő kb. 10 perc autóval. A feltüntetett ár 1 db 5 fős apartmanra értendő főszezonban! Új szolgáltatásunk, dézsafürdőnk is igénybe vehető (egyeztetést igényel). T: 06302760722 ... további részletek >>

Figyelem! Ha bulizó helyet keresnek, akkor ne minket válasszanak!


Feladva: 2016-12-02    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: BalatonnálminketSiófokapartmanpercSiófokonvehetőhelyenfürdőházunkatválasszanakigénybeGaleriustartódézsafürdőnkszeretnesétanyitvaakkorBalaton

Forrás: pepitahirdeto.multiapro.com

Munkatársat keresek. Egészségtudatos, kitartó, célorientált, magáért tenni akaró személyt keresek, számítógépes ismeret előnyt jelent, mivel profi online eszközökkel dolgozunk.


Feladva: 2017-09-18    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekMunkatársatproficélorientáltmivelkitartójelentEgészségtudatoselőnytismeretArankaszámítógépesszemélytdolgozunkakaróeszközökkeltennionline

Forrás: pepitahirdeto.multiapro.com

Cégünk vállalja autók-motorok mentését szállítását Budapesten és Magyarországon belül. Hívjon bizalommal! Gyors, pontos, precíz kiszolgálás, versenyképes árak. Autómentés - Motormentés www.csupiautomentes.hu tel.:06 70 62 62 777 ALFA ROMEO AUDI BMW CHRYSLER CITROEN DACIA FIAT FORD HONDA HYUNDAI KIA LANCIA LAND ROVER MAZDA MERCEDES MITSUBISHI NISSAN OPEL PEUGEOT RENAULT SEAT SKODA SSANGYONG SUZUKI TOYOTA VOLKSWAGEN VOLVO


Feladva: 2016-09-19    [Autó - Motor - Jármű]

Címkék, kulcsszavak: AutómentésMotormentés777TOYOTAMAZDAMagyarországonCHRYSLER6262SUZUKIROVERBudapestenBMW24hSSANGYONGárakLANDszállításátAUDIszállításSKODALANCIA

Forrás: pepitahirdeto.multiapro.com

Interaktív eszperantó tanfolyam, nulláról az eszperantó nyelvvizsgáig – hanganyaggal, gyakorlatokkal, házi feladatokkal. NEM zsákbamacska, próbáld ki az első leckét! . Budapesti Eszperantó Központ, www.eszperanto-online.hu/elso-leck e.htm


Feladva: 2017-03-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: EszperantótanfolyamwwwgyakorlatokkalKözponthanganyaggal8211BudapestinyelvvizsgáigleckétnullárólelsőpróbáldInteraktívzsákbamacskaLászlóNEMSzilvási

Forrás: pepitahirdeto.multiapro.com

Festmény a léleknek, a lélek festőjétől. Tisza-Kalmár György festménye A festmény címe: Távolban Méret: 18 x 24 cm Anyag: olaj vásznon A ragyogó fehér gyöngyház és a kék különböző árnyalatai adnak erős expresszív hatást a képnek. A festék néhol vastagon került a vászonra, a felületnek gazdag képi struktúrát kölcsönözve. Amennyiben különleges alkotást szeretne, ez a festmény kis mérete ellenére a részletek gazdagságával nagy élményt nyújt. ... további részletek >>

www.tisza-kalmar.hu/index.php/galeria/40-kis-festmenyek/113-olaj-festmeny-1 A festményt személyesen át lehet venni Egyházashetyén (Vas megye, Sárvár közelében), vagy futárszolgálat kézbesíti a megadott címre.


Feladva: 2016-09-15    [Régiség - Művészet]

Címkék, kulcsszavak: festmenyolajkisfestményeGyörgyKalmártiszawwwragyogófutárszolgálatAmennyibenléleknekképneknyújtvásznonvagykölcsönözveEgyházashetyehatástélményt

Forrás: pepitahirdeto.multiapro.com

Ha kicsivel is, de meghaladja a háromszázezer forintot a bruttó átlagkereset Magyarországon, amiből kétszázezer forint körül visz haza egy átlagos magyar munkavállaló. Ha esetleg nem keresi meg ezt az összeget, akkor jelezze, megmutatom, hogy hogyan tudja egyszerűen kiegészíteni a jelenlegi jövedelmét. Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet! Email: ... további részletek >>


Feladva: 2017-03-01    [Pénzkeresés - MLM]

Címkék, kulcsszavak: magyarbruttóátlagosforintotegykeresezer305megTanácsadónakátlagkeresethogyanEmailVásárlásihogykerülhetlevéllelmegmutatomkategóriájábamotivációs

Forrás: pepitahirdeto.multiapro.com

Nagy lépés ez egy embernek, és még nagyobb az emberiségnek! Megtakarítások nélküli probléma megoldás! Sok család eddig azért nem tudta megoldani nagy kiadásokkal járó problémáit, mert a bevételből nem tudott megtakarítani ezek érdekében! Ennek a korszaknak vége, most már nincs akadálya annak, hogy minden tervét megvalósíthassa! A „Jövőképem a Létem” Támogató rendszer többek között lehetőséget nyújt: Családi ház, nyugdíj, Gépjármű vásárlás, Áram és gázszámla megszüntetése, ... további részletek >>

Gyermeke magas szintű oktatása, Családja anyagi jóléte, utazások, hobby, karitatív tevékenység, egyéb álmok, célok megvalósítására! A „Jövőképem a Létem” Támogató rendszer célja, hogy megszüntessük Magyarországon a szegénységet, hogy ne kelljen családoknak szétválniuk külföldi munkavállalás miatt, hogy a családok életszínvonalát jelentősen növeljük annak érdekében, hogy a jelen és a jövő generációja már egy sokkal jobb világban élhessen! Úgy oldhatja meg a jövőben felmerülő jelentős összegű anyagi kiadásait, hogy nincs szüksége havi rendszeres megtakarításokra! Jövőkép Programunk tökéletes megoldás arra, hogy akár már 2-3 év alatt megoldhassa az igényeihez szükséges anyagi hátteret! Mivel Önnek garantáltan ez egy fillér költségébe sem kerül, és a programot követve garantáltam megoldhatja a jövőben felmerülő jelentős anyagi kiadásokkal járó problémáit, ezért jelentkezzen bátran, mert kizárólag csak nyerhet a Tökéletes Támogató rendszerünkkel! rozsabusiness@gmail.com


Feladva: 2017-04-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyanyagiTámogatómáregymegoldásproblémanélkülinemMegtakarításokproblémáitrendszerjáró8221nagykiadásokkalLétemTökéletesnincsJövőképemjelentős

Forrás: pepitahirdeto.multiapro.com

Hatékony folteltávolítás kedvező áron. Csepke folteltávolító spray www.mososzerbolt.hu/id/00207_Csepk e_folteltavolito_spray_500_ml__ - Hazai mosószer és tisztítószer webáruház.


Feladva: 2016-01-27    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: sprayfolteltávolítóCsepkeHazaiáronKftkedvezőFuturefolteltávolításCudyHatékonywebáruháztisztítószermosószer

Forrás: pepitahirdeto.multiapro.com

Hinta ágy keret 6000 Ft, Jézus az olajfák hegyén gobelin 60 x 90 cm-es 33000 Ft, Teraszkorlát 5 x 2 m-es 44000 Ft!


Feladva: 2016-07-02    [Vegyes hirdetések]

Címkék, kulcsszavak: 60x90cmHaidtnergobleneladókhegyéndolgokolajfákMindenféleJézus6000ftkeret44000ftágy5x2mesHintaTeraszkorlátTököles33000ftMedárd

Forrás: pepitahirdeto.multiapro.com

Állást keres? Vizsgázik? A táblázatkezelés, az adatbázis-kezelés egyáltalán nem nehéz! Meg fogja látni, mennyire egyszerű az Excel, az Access, vagy a Word, a PowerPoint. Milyen szép dolgokat lehet Corel vagy Flash segítségével létrehozni. Egyszerűen, gyorsan megérthető. Forduljon hozzám! Tapasztalataim szerint az egyéni foglalkozás előnye, hogy kevesebb idő alatt, hatékonyabban lehet elsajátítani az új ismereteket, mivel csak Önre figyelek, mindennel csak addig foglalkozunk, ameddig ... további részletek >>

Ön igényli, nem kell senkihez sem igazodnia. Fontos előny az is, hogy nincs ”kihagyott” óra. Csoportban, ha Ön nem ér rá, nem tud az órára eljönni, a csoport halad tovább, Így Önnek, ha a lépést tartani akarja, pótolnia kell a kimaradt óra anyagát. Szívesen tanítok csoportokat is, ebben is hosszú múltra tekinthetek vissza.


Feladva: 2016-07-21    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nemtáblázatkezeléshogyóravagykelllehet8221kezelésadatbázisEgyszerűencsakkevesebbtovábblétrehoznimindennelExcelanyagátelőnyeVizsgázikhalad

Forrás: pepitahirdeto.multiapro.com

Győr - Pápa - Kisbér - Tata - Csorna térségébe biztonsági őr, portás munkatársakat keresünk főállásban, bejelentve, szabadság, betegszabadság kifizetéssel. Jelentkezni lehet önéletrajzzal, a bi.technika@gmail.com e-mail címre.


Feladva: 2017-07-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: portásbiztonságiIldikómailkeresünkOrbáncommunkatársakatGönczinétechnika@gmailállásönéletrajzzallehettérségébeJelentkezniCsornakifizetésselTata

Forrás: pepitahirdeto.multiapro.com

Kiadó próbatermek Csepelen! Érdeklődni: telefonon!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: próbatermekKiadóÉrdeklődniCsepelenBudapestTulajpróbateremtelefonon

Forrás: pepitahirdeto.multiapro.com

Minőségi Taktikai, outdoor, sport, vadász ruházat, kiegészítők és felszerelések nagy választékban! Webshopunkban több 100 termékkel, kedvező árakkal és folyamatos akciókkal várunk! Országos kiszállítás.


Feladva: 2016-10-30    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: FreskaZonetermékkeloutdoor100TaktikaitöbbMinőségiWebshopunkbanBudaörskiszállításválasztékbanNetOrszágosnagyvárunkfelszerelésekWebáruházakciókkal

Forrás: pepitahirdeto.multiapro.com

Kőműves-, ács-, lakatos-, térburkoló munkák, bontás, épületfelújítás, kertépítés, festés, mázolás Budapesten, Pest megyében. Dumitru György www.gisi.hu 06-30-538-2573


Feladva: 2016-07-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GyörgyDumitrugisibontáshttpvállalásamunkáktérburkolómegyébenlakatosPestácsBudapestenKőművesmázolásPilisvörösvárfestésházépítés2573kertépítés

Forrás: pepitahirdeto.multiapro.com

Tökéletesen tisztítja a többféle felületet. Univerzális alkalmazású: fürdőszoba, konyha, terasz és erkély. Használja fazekakhoz, odaégett maradékokhoz, mosogatókhoz, üvegekhez, porcelánhoz. Erős és biztonságos - a biológiailag lebomló. Nagyon szennyezett, pl. kenőanyagokkal szennyezett kezet is lehet vele mosni 500 g-os kiszerelésben. ERŐS ÉS BIZTONSÁGOS - KÉZKÍMÉLŐ - KÖRNYEZETBARÁT Azért is foglalkozom vele, mert én is használom a saját háztartásomban. Emellett keresek pénzt is vele, ... további részletek >>

mert megismertetem mindazokkal, akiket szintén érdekel...


Feladva: 2017-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: veleBIZTONSÁGOSERŐSUniverzálisszennyezettmertkonyhapasztabiológiailagfürdőszobapénztlebonthatóporcelánhozalkalmazásúkeresekkiszerelésbenzöld500

Forrás: pepitahirdeto.multiapro.com

Gold-Styll antiallergén prémium divatékszer! A Gold-Styll családi vállalkozásunk ebben az ékszerek iránti szenvedély jegyében egy nőies, rafinált és minőségi divatot kíván létrehozni. Szeretnénk meghódítani az európai piacot és minél több országban jelen lenni. Értesüljön akcióinkról, látogassa honlapunkat! Megtalál bennünket a Facebook-on is: facebook.com/goldstyll


Feladva: 2015-12-08    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: egytöbbminélStyllGoldlétrehozni2015embernekEleganciakívánkeresünkévbendivatotRégioembereketebbenminőségimanezsereketőszintevállalkozásunkadni

Forrás: pepitahirdeto.multiapro.com

Megoszlanak a vélemények azzal kapcsolatban, hogy a természetes hormonmentes fogamzásgátlás mennyire biztonságos. Tény, hogy napjainkban nem létezik olyan módszer, tabletta vagy eszköz, amivel 100%-os biztonsággal védekezhetnénk a terhesség ellen. A fogamzásgátlás otthon házilag történhet a testhőmérséklet, a hüvelyváladék figyelésével, naptár módszerrel vagy akár megszakítással is, amit azonban az orvosok egyáltalán nem javasolnak teherbeesés ellen. A hormonmentes fogamzásgátlás eszközei a ... további részletek >>

pesszárium, a spirál és különböző spermicid készítmények, melyek krém, kúp és hüvelytabletta formájában is kaphatók.


Feladva: 2017-01-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogamzásgátláshormonmenteshogyvagyellennemazonbanMegoszlanakházilagpesszárium