0.26 húsüzembe - MultiApro.com hirdetések - Ingyen apróhirdetés, egyszerűen több apróhirdető oldalra
Nincs találat .... Nézze meg kiemelt hirdétéseinket.

húsüzembe

Otthonról is végezhető munkát keresel, de nem tudod fog-e menni? Egy hónap elég lenne, hogy kipróbáld magad? Mit szólnál egy harminc napos ingyenes próbához? Ráadásul egy automata eszköz elvégzi a munka nehezét helyetted. Megkeresi azokat, akiket érdekel az ajánlatod, és bemutatja nekik. Ne töprengj, hanem vágj bele most azonnal. Csatlakozz, és már kezdheted is. Még regisztrációs díjat sem kell fizetned. A cég napi fogyasztási cikkekkel foglalkozik, tehát biztos a kereslet. A jutalékod miatt ... további részletek >>

sem kell aggódnod, mert megkapod forintban. A videókból mindent megtudhatsz. Mutasd meg ismerőseidnek, milyen remek lehetőséget találtál, még mielőtt ők mutatják neked ugyanezt. Katt ide és nézd meg a videókat! => http://bit.ly/tesikered


Feladva: 2017-11-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: megegyautomatakellsemjutalékodeszközKattregisztrációskipróbáldmegtudhatszbemutatjavégezhetőkeresletugyaneztkezdhetedhogymindentajánlatodbiztos

Forrás: pepitahirdeto.multiapro.com

HEGESZTŐ és LAKATOS állásaink Németországban! LAKATOS: Szerződött Bajor partnerünk (NEM Zeitfirma) részére München közelében keresünk 2 fő fémipari munkást (lakatos, kovács, hegesztő, stb) aki műszaki rajz alapján különböző fém-, és vasmunkákat tud végezni. A1-A2 (melós) némettudás szükséges. A próbamunka van, ami alatt a szállás ingyenes. Szerződéskötés után a szállást a cég megoldja, ami a fizetésből kerül levonásra. (Kb. 250 €/hónap) HEGESZTŐ: Szerződött német partnerünk (NEM ... további részletek >>

Zeitfirma) részére Mannheim közelében keresünk hegesztőt (WIG és MAG) aki műszaki rajzról precízen tud dolgozni, valamint bonyolultabb fémkonstrukciókat készíteni, varratokat köszörülni, polírozni. A munkához legalább A2-B1 némettudás szükséges, mert a feladatok megbeszélése némettudás nélkül nem lehetséges. Minősítés nem feltétlenül szükséges, de precízen kell tudni hegeszteni. A próbamunka alatt a szállás ingyenes, sikeres próbamunka után szerződést kap a hegesztő. A szállást a cég megoldja, ami a fizetésből kerül levonásra. (Kb. 300 €/hónap) Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1.) E-mailben: info@nemetmunka.hu 2.) Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3.) Telefonon munkaidőben a magyar 06 1 920 3433, ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9.00-17.00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-10-23    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: némethegesztőnemlakatospróbamunkaIngyenesnémettudásamicégszükségeshónapTelefononműszakiSzerződött8364utánakivagylevonásrakerülszállásTeam

Forrás: pepitahirdeto.multiapro.com

A tolmácsolás összetettebb és kifinomult képességeket igénylő tevékenység, mint a fordítás. A tolmácsnak a másodperc tört része alatt kell reagálnia és fordítania a kommunikáció folyamatosságának fenntartása érdekében. Alapvetően kétféle tolmácsolást szoktunk vállalni. Konszekutív, azaz követő tolmácsolást. Ebben az esetben a szónok, tárgyaló fél, stb. elmond 2-3 mondatot, majd megvárja, amíg a tolmács azt lefordítja azt és így tovább. A tolmács egy üzleti tárgyaláson például 2 nyelvre is ... további részletek >>

fordít és közvetít a 2 tárgyaló fél között, mondjuk német-magyar, angol-magyar, német-angol, vagy épp az ügyfél által kért nyelveken. Profi tolmácsra van szüksége? Hívjon most! Tolmácsaink (az ügyvezetőnket is beleértve) számos üzletembernek segítettek már tető alá hozni a jó üzletet külföldi partnerével. Tegyen próbára minket Ön is, nem fog csalódni! Bármilyen szakterületen megálljuk a helyünket. Tolmácsoltunk már auditokon, szakmai konferenciákon, üzleti tárgyalásokon, szakszervezeti egyeztetéseken, nagy cégmegnyitó rendezvényeken, sajtótájékoztatókon, éves közgyűléseken, műszaki szakterületeken betanításokon, képzéseken, oktatásokon, stb. Szinte minden szakterületről tudunk referenciát felmutatni. Szinkron-, vagy konferenciatolmácsolás. Az alapvető különbség a konszekutívhoz képest, hogy ebben az esetben a tolmács párhuzamosan beszél az előadóval, az előadónak nem kell megvárnia, amíg a közönséghez eljut az információ az adott nyelven, mivel a hallgatósághoz fülhallgató segítségével jut el a tolmács által közölt információ. Ehhez természetesen szükség van bizonyos technikai feltételekre is, így tolmácsfülkére, tolmácsgépre, mikrofonra, a közönség számára fejhallgatókra, stb. Szinkron esetén a tolmács kizárólag az anyanyelvére fordít. Kollégáinkkal számtalan konferencián jártunk már, így tapasztalatunk rendkívül szerteágazó. Elsősorban német és angol nyelveken vállalunk szinkrontolmácsolást.


Feladva: 2017-07-01    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: tolmácsígymárstbangolnémettolmácsolástüzletiSzinkronvagyvanmagyaraztesetbentolmácsolásnyelvekenebbeninformációfélamígfordíttárgyalóáltal

Forrás: pepitahirdeto.multiapro.com

Olcsó új gyerekruhák és játékok! Gyerekruhák bébi, gyerek és kamasz méretekben, bébi kiegészítők nagy választékban. Több mint 10.000 gyerekjáték a bébitől egészen 12 éves korig. Személyes átvétel Budapesten, házhoz szállítás az ország egész területén.


Feladva: 2016-03-27    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: GyerekruhákbébijátékokOlcsóJátékBudapestenválasztékbanátvételnagySzemélyeskiegészítőkkorigkpjatekévesméretekbenwwwegészenkamaszterületénbébitől

Forrás: pepitahirdeto.multiapro.com

Ausztriai kapcsolatokkal keresünk olyan agilis embereket Nemzetközi piacvezető Törzsvásárlói Rt.-hez akik Ausztriában partneri vezető Referensként tevékenykednének. Kiemelten várjuk 25-45 év közötti felsőfokú végzettséggel rendelkező céltudatos, sikerorientált munkatársak jelentkezését, akik nyitottak a tudatos vásárlási tanácsadó területre. Díjmentes, teljes körű magas színvonalú duális átképzést biztosítunk. Karrierlehetőség: • Kiemelkedő, teljesítményarányos nemzetközi jövedelem ... további részletek >>

• Életpálya program • Szakmai oktatások • Biztos háttér • Gépkocsi támogatás • Bónuszok Feladat: Az embereket és a cégeket informálni arról, hogyan tudnak tudatosan és felelősen vásárolni, ott, ahol eddig, azt, amit eddig, hogyan tudnak jelentős visszatérítéseket kapni készpénzben. A Vásárlási Tanácsadók feladata, hogy olyan plusz pénzeket tegyenek az emberek zsebébe, amely eddig is meg volt, de senki nem jutott hozzá, mert nem tudta, hogyan kell! A munkához tartozó elvárások:  Felső vezetéssel kapcsolattartás  Képzéseken való megjelenés Jövedelmi lehetőségek: Vásárlónként havonta 500-3000 forint lehetséges, teljesítményarányos jövedelem, amely kimagaslóan magasabb, mint amit Magyarországon bármilyen területen és pozícióban megkereshető! / Pl. 1000 vásárlónál 500.000-3.000.000,- millió forint havonta, EGYSZERI MUNKÁVAL!!!! / Gondolja át, hogy Ausztriában 8 588 584–en élnek és hányan vásárolnak nap, mint nap, és ennek megfelelően kiszámolhatja a havi jövedelmét is!!!! Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet! Email: rozsabusiness@gmail.com


Feladva: 2017-04-04    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8226eddigVásárlásihogyanjövedelem000AusztriaiteljesítményarányosakikAusztriábanmeghogynapmintemberekethavontatudnakforintnemzetköziamitnem

Forrás: pepitahirdeto.multiapro.com

Eladom bélyeggyűjteményemet egyben vagy darabonként. Érdeklődni lehet: Bodor Csaba: 06-20/556 9841 bodormotor@gmail.com


Feladva: 2017-05-27    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: CsabaBodorÉrdeklődnidarabonkéntvagyegybencombélyeggyűjteményemetbodormotor@gmailEladom9841Tahitótfalu556eladóBélyeglehet

Forrás: pepitahirdeto.multiapro.com

A makett építés egy igen kedvelt és érdekes hobbi. Katonák, harckocsik, repülők, egyéb kiegészítők nagy választéka áll rendelkezésetekre, hogy elkészítsetek egy makettet, vagy akár egy igényesen kidolgozott diorámát. Akik még csak most ismerkednek ezzel, vagy szeretnék elkezdeni, azoknak ajánlom a kisebb, egyszerűbb maketteket, ezeknek az összeállítása nagyon egyszerű. Méretarányuk: 1 : 100 Általában 6-8-10 elemből összeépíthető makettek, amik nem igényelnek nagy szaktudást, de már az első ... további részletek >>

makett összeállítása is nagy élmény lehet a gyermek számára. Bővebben: www.kpjatek.hu/KEZDo-MAKETTEZoKNEK-c63_0_1.htm


Feladva: 2017-08-23    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: nagyegymakettMAKETTEZŐKNEKvagyKEZDŐösszeállításadiorámátnagyonszaktudástazoknakhtmkidolgozottegyszerűkiegészítőkmárelkezdeniJátékigényesenegyéb

Forrás: pepitahirdeto.multiapro.com

Munkánkat telephelyünkön végezzük. Weboldalunkon minden információt megtalál rólunk!


Feladva: 2017-01-27    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: FalusimarásmegmunkáláscncvégezzüktelephelyünkönMunkánkatImre

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Szalonunkban a hajhosszabbítás, hajdúsítás gyakorlattal (1997), egyedi hajfelvarrással illetve csomózással, európai póthajjal készül. Hozott hajjal is pótolunk! Látogass el honlapunkra, Facebook-ra: facebook.com/hajhosszabbitas.hajdus itas


Feladva: 2017-01-02    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: facebookhajdúsításhajhosszabbításCsepelcomilletveSzépségszalonhajfelvarrássalCityhonlapunkraegyediLátogass1997pótolunkgyakorlattalhajjalHozottXXI

Forrás: pepitahirdeto.multiapro.com

A születésnapi idézetes papírtekercset minden férfi ismerősünknek ajánljuk, mely egyedi ajándék bármely korosztálynak. Termékleírás: Papírtekercs, színes szalaggal átkötve, fapálcikára feszítve, amelynek végei fagolyócskákkal vannak lezárva. Méret: 21cm X 16cm Itt található: www.dekorkucko.hu/papirtekercs-fer fi-szulinapi-koszonto


Feladva: 2017-04-27    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ferfipapirtekercskoszontoszulinapiátkötveminden16cmszalaggalpapírtekercset21cmszínesidézetesMéretTermékleírásszületésnapilezárvakorosztálynakvannak

Forrás: pepitahirdeto.multiapro.com

Cégünk a szakszerű építési projektek kivitelezésére alakult. Családi házak, lakások, irodaházak, társasházak teljes körű generálkivitelezését, valamint felújítási munkákat vállalunk a Dunántúl szinte bármely pontján. Vállalunk mély és magasépítő munkákat, kézi - gépi földmunkákat, közműépítést, útépítést, tereprendezést, kertépítést, alakító földmunkákat, tereprendezést, ingatlanfelügyeletet, karbantartást, felújítási munkálatokat. Vállalatoknak, önkormányzatoknak, magánszemélyeknek is!


Feladva: 2015-11-06    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: vállalunkfelújításimunkákattereprendezéstföldmunkákatgenerálkivitelezésétmunkálatokatépítésikézikörűszakszerűteljeskarbantartástCégünkmagasépítőmély

Forrás: pepitahirdeto.multiapro.com

Falpanelt keresel? A legnagyobb választék falpanelekből a KERMA Design webáruházban: gipsz, farost, fa, pvc, cukornád, műbőr, polisztirol, poliuretán, beton falpanelek. Tervezés, gyártás, és kivitelezés! KERMA www.kerma.hu #falpanel #kerma #műbőr #design #burkolat #bőrpanel


Feladva: 2017-09-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kermadesignfalpanelműbőrakkorkereselburkolatpoliuretánFalpaneltpolisztirolDebrecencukornádKftpvcfarostfalwwwgipszkivitelezéswebáruházbanbeton

Forrás: pepitahirdeto.multiapro.com

Szabaduljon meg adóssággal terhelt cégétől, akár több milliós tartozás esetén is. Eladósodott veszteséges, banki vagy köztartozással terhelt,tagi hitel és házipénztár gondokkal küzdő, csődközeli cégek ÁTVÉTELE, kiközvetítése belföldi partnerek részére. Hivatalos, gyors ügyintézés, jogi garanciával. (Végrehajtás, végelszámolás NEM AKADÁLY) 15 MFt feletti adósság esetén is! Problémás cégek adás vétele, ügyvezető kölcsönzés, cégalapítás.


Feladva: 2016-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: cégekeseténterheltSzabaduljonNEMkiközvetítésebankiügyvezetőKatalinvégelszámolásÁTVÉTELEveszteségesvételeMagyarVégrehajtáscsődközeliEladósodottadás

Forrás: pepitahirdeto.multiapro.com

Nem ígérek milliókat, de egy olyan lehetőséget ajánlok, amivel hozzájárulhatsz a családi kasszához hosszú távon. Vásárold meg most a neked tetszőt! 18 terméket 50%-al olcsóbban! Miért várnál kedvezményeket csak az év egy napján? Teremtsd meg a saját Black Friday napodat! Keress a részletekért!


Feladva: 2017-11-17    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 224232242hozkatkasszmilliolcscsalrekketrulhatszNemtermhozzSiófokmegamivelErzsébetroldnlokHajdugetingyenesenvonlehetősszletek249

Forrás: pepitahirdeto.multiapro.com

Albérletből könnyedén saját otthonba! Kérd segítségünket! Üzenetben megadott telefonszámon is visszahívunk. Albérletben te is saját lakásról álmodozol? Esetleg meglévő lakásodat bővítenéd, vagy cserélnéd nagyobbra? Amiben segíteni tudunk: Havi 20.000 forinttal, 30 %-os vissza nem térítendő állami támogatással, OBA garanciával, kamatadó- és járulékmentesség. Álmaid otthona neked is elérhető! Kérd üzenetben ingyenes visszahívásunkat telefonszámod és egy számodra megfelelő időpont ... további részletek >>

megjelölésével. Segítünk megteremteni, eligazítunk a lehetőségek között. Tájékoztatást nyújtunk személyesen.


Feladva: 2016-12-26    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: sajátüzenetbenKérdvagycomtámogatássalOTTHONeligazítunknagyobbravisszahívunkbindererika56@gmailállamiALBÉRLETmegteremtenicserélnédtelefonszámonwebnode

Forrás: pepitahirdeto.multiapro.com

Nemtudom szilva fa csemete, és magonc milotai10-es diófa csemete eladó. Alanynak és oltásra kiváló.


Feladva: 2017-02-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: csemeteeladóbajcsydiófamilotai10magoncszilvaNemtudomKérsemjénkiválóTótholtásraBarnabasalanynakut10

Forrás: pepitahirdeto.multiapro.com

A DXN-nél semmi... Átáll a cég egy másik, mobil barát kinézetre. Hát abba már nem fér bele az a fajta blogolás, amit néhányan annak tartottak. Feltételezhető azonban, hogy van rengeteg normális DXN üzletépítő, akik azért még folytatnák... Nekik fenntartunk egy lehetőséget, amivel a saját DXN oldalukra tudnak látogatókat szerezni. Titok nincs, kereshetőnek kell lenni! (Persze csak annak, aki kereshető akar lenni...) ... további részletek >>


Feladva: 2017-08-16    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: DXNlenniannakblogolásegyhogyajánlófenntartunkwwwazonbanabbaTitokHirdetőNekikFeltételezhetőHátszerezniPepitahtmlfolytatnákakartartottakmég

Forrás: pepitahirdeto.multiapro.com

3 rétegű üveggel, 80 mm vastag, 6 légkamrás ablakok és ajtók, 2-4 héten belül legyártva a kívánt méretre. Beszerelést is szakszerűen kivitelezzük, 1994 óta nyílászárókkal foglalkozunk. Kizárólag német „A” osztályú minőség, 7 év teljes körű garanciával. Többféle műanyag, fa és alumínium nyílászárót forgalmazunk, biztosan megtalálja az Önnek megfelelőt. A legjobb nyílászáró árak nálunk vannak. Részletes árlisták: www.ablakajtoaruhaz.hu/hu/arlistak.html Rendelje meg most az ... további részletek >>

ablakait, a párkányt ajándékba adjuk minden 200.000.- Ft feletti rendeléshez Július 30-ig. A beépítést 6500.-/m2 áron végezzük. Nézzen körül weboldalunkon és a webáruházunkban: www.ablakajtoaruhaz.hu/hu/aruhaz/category/muanyag-ablak.html


Feladva: 2017-07-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: ablakajtoaruhazhttpshtmlablakáronmuanyagmostmegszakszerűenÖnneküveggelrendeléshezosztályúRendeljeBeszereléstmegtaláljarétegűfeletti8221arlistak

Forrás: pepitahirdeto.multiapro.com

A mosott kavics 16-32 ára bruttó 4200 Ft/m3. A folyami kavics 16-32 ára bruttó 4200 Ft/m3. A dunai kavics 16-32 ára bruttó 4200 Ft/m3. A dísz kavics ára bruttó 5842 Ft/m3. A gyöngy kavics ára bruttó 5842 Ft/m3. Az osztályozott kavics ára bruttó 5842 Ft/m3. A rostált kavics ára bruttó 5842 Ft/m3. A bánya kavics ára bruttó 3500 Ft/m3. A töltő kavics ára bruttó 3000 Ft/m3. A mosott dunai folyami kavics 24-40 kerti utak, parkok lefedésére, a rostált osztályozott dísz kavics 16-32 ... további részletek >>

lábazatok díszítéséhez, szikkasztóhoz, a gyöngy kavics 4-8 és a gyöngy kavics 8-16 parkok, játszóterek lefedésére, a bánya és a töltő kavics terület feltöltésre, szerelő beton alá használható. A mosott kavics, osztályozott kavics, dísz kavics, gyöngy kavics, kulé kavics, rostált kavics, töltő kavics kapcsán felmerülő kérdéseikre szívesen válaszolunk, e-mail címünk és telefonszámaink honlapunkon megtalálhatóak.


Feladva: 2016-10-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kavicsbruttóáragyöngydíszosztályozottmosott5842rostált4200töltőfolyamidunaikulébányalefedéséreparkokfeltöltésrehonlapunkonszállításterület

Forrás: pepitahirdeto.multiapro.com

Olcsó, gyors személyszállítást végzünk Ausztriába, Németországba


Feladva: 2017-03-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: NémetországbavégzünkszemélyszállítástgyorsOlcsóBudapestEutaxiKisbusszalAusztriába

Forrás: pepitahirdeto.multiapro.com

Luxus Cars Jaguar az országban egyedülállóan foglalkozik hófehér jaguárok bérbeadásával. A Jaguár ezen R-es típusából fehér színben, jelenleg a nálunk lévő kettő darab található Magyarországon! Ritka és egyedi esküvői autó. A méltán elhíresült hófehér Jaguár egyedi megjelenése minden esküvői stílushoz igazodik a retrótol a legmodernebbig, fehér színe pedig szintén minden stílussal össze illeszthető az esküvők alapszíneként. Az autó kölcsönzése, bérlése bármely célra megfelelő lehet.


Feladva: 2016-09-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: esküvőimindenegyediJaguárhófehérfehérautóegyedülállóanösszekettőlehetországbanstílussalmegjelenéselévőmegfelelőJaguarnálunkcélraCarsszintén

Forrás: pepitahirdeto.multiapro.com

Új műnövények érkeztek! fák, futók, bokrok. www.selyemviragok.hu/index.php?id= 2039 Válogasson és rendeljen a Zöldvilág Webáruházban


Feladva: 2017-12-11    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ZöldvilágfákérkeztekműnövényekGyőrWebáruházWebáruházbanNagykereskedésSelyemvirágrendeljenMűnövényVálogassonbokrokfutók

Forrás: pepitahirdeto.multiapro.com

Szeretnél egy könnyen megjegyezhető domain nevet és egy weboldalt? Esetleg tetszenek a rövidebb, pár betűből álló domain kombinációk? Vagy egy régi, koros domainnel szeretnéd segíteni a weboldaladat, hogy már az elején előnnyel indulj a többi lappal szemben? Bővebb információ és az eladó weboldalak teljes listája itt tekinthető meg: www.eladhatatlan.hu/elado-domain-w eboldal


Feladva: 2016-04-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: domainegyeladóweboldalakweboldalbetűbőlakciósanweboldaladatpárinformációneveksegítenieladorövidebbBővebbszeretnédeladhatatlantetszenekszemben

Forrás: pepitahirdeto.multiapro.com

Még mindig a leghatékonyabb módja a dohányzás leszoktatásnak a biorezonanciás kezelés. Kínlódás, és elvonási tünetek nélkül. A biorezonanciás kezeléssel megszűnik a nikotin éhség. Stresszoldást és általános méregtelenítést is adunk,a tartós eredmény érdekében. A rögzült szokások oldását életmód tanácsokkal segítjük. A kezelés személyre szabott, kérjük hozza el magával az utolsó szál, félig elszívott, majd eloltott cigarettáját. Időpont egyeztetésre hívjon a megadott telefonon.


Feladva: 2017-05-19    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kezelésMégbiorezonanciáskérjükDebreceneredményIdőpontnélkülszabott06309074786tartóscigarettájáttünetekszemélyrecigarettátóladunkeloltottelvonási

Forrás: pepitahirdeto.multiapro.com

Póló szitanyomás, póló nyomtatás cégeknek, iskoláknak. Egyedi póló kiváló minőségben! Tervezze meg kedvenc pólóját, küldje el nekünk mit szeretne és mi megszitázzuk az ön által kiválasztott színű méretű pólójára. Megrendelését akár személyes, akár postai utánvéttel veheti át. A megrendelt termékeket 5-10 munkanap alatt juttatjuk el önhöz. Nagyobb mennyiségű megrendelések esetében ez az idő akár 10-15 nap is lehet megegyezés szerint. További kérdésére szívesen válaszolunk ... további részletek >>

keressen minket élérhetőségeink egyikén. A Facebook-on is megtalál: www.facebook.com/poloranyomas.hu


Feladva: 2017-02-16    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: pólószitanyomásakárnyomtatáspoloranyomasNagyobbiskoláknakakkorutánvéttelTovábbimitönhözcégeknekpostaiszerintnekünkjuttatjukszemélyesmegegyezés

Forrás: pepitahirdeto.multiapro.com

Miért érdemes még hozzánk jönni? ⋅ mert ha valamit nincs nálunk, azt 24-48 órán belül megszerezzük ⋅ mert termékigényét eljuttathatja hozzánk a webáruházon keresztül, vagy e-mail-en, amit aztán célba juttat egy futár, esetleg átveheti egy PickPackPont-on, de akár személyesen is ⋅ mert üzletünkben van: spirálozás, fénymásolás, laminálás, nyomtatás, bélyegzőkészítés és szkennelés, (e-mail-ben juttassa el hozzánk dokumentumait majd a kész kötészeti anyagot vegye át a ... további részletek >>

futártól, vagy a PPPonton. ⋅ mert szakmai tanácsot is adunk (térítés nélkül!). Aki inkább a hagyományos vásárlást részesíti előnyben, azt szeretettel várjuk kiskereskedelmi üzletünkben: 1133 Budapest, Dráva u. 5/d. H - CS: 9.00 - 17.00; P: 9:00 - 16:00 óra között.


Feladva: 2017-10-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: mert8901hozzánkaztvagymailBudapestegyüzletünkbennélkülesetleganyagotbelülnyomtatásajánláskiskereskedelmitérítésfutárkötészetióránlaminálás

Forrás: pepitahirdeto.multiapro.com

Márványcsiszolás, mészkőcsiszolás, gránitcsiszolás, terrazzocsiszolás, grescsiszolás, betoncsiszolás, műkőcsiszolás, cement anyagok csiszolása Magyarországon, Romániában, Szlovákiában, Horvátországban, Németországban, és Ausztriában. www.everfloor.hu +3630/298-4353


Feladva: 2017-04-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: mészkőcsiszolásRomániábanMárványcsiszolás4353MagyarországonKatalin298csiszolásaNagy3630anyagokPadlócsiszoláseverfloorcementwwwműkőcsiszoláshttp

Forrás: pepitahirdeto.multiapro.com

Zeneszeretõ - Bakelit rajongók figyelmébe! Az Audió Design Studió hosszú évek óta foglalkozik hangrestaurálásal. A stúdió vállalja minden tipusú hanganyag rendbe hozatalát, archív hangzók feljavítását ujra masterelését. Bakelit lemezek, kazetták, professzionális szinten történõ átirása, zajmentesítése az az, a hangzó anyagok restaurálása, digitális technológiával úgy , hogy a kész anyag megegyezzen az eredeti hangzással. Ne hagyja, hogy kincsei kárba vesszenek!


Feladva: 2017-10-09    [Zene - Hangszer]

Címkék, kulcsszavak: stúdióDesignBakelithogy245anyagévektörténátjátszáshozatalátkészhosszúszintenhangjavításrendbeúgyprofesszionálisDigitalizálásvesszenekhanganyag

Forrás: pepitahirdeto.multiapro.com

A vörös szőlőlevél magas antioxidáns tartalmáról ismert keringésfokozó hatású. Az Ultra Weich vörösszőlő levél krém enyhíti a fájdalmas feszülő érzetet a bőrfelületen és frissíti a fáradt, elnehezedett igénybe vett végtagok vérkeringését, ezzel kellemes, hidratált érzést biztosít. Minden bőrtípusra alkalmazható. Külsőleg, a bőr felületén alkalmazandó. Ingyenes szállítási lehetőséggel! www.mososzerbolt.hu/id/00245_UW_Vo rosszolo_level_krem_100_ml_


Feladva: 2016-01-27    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: hatássalbőrfelületetfokozóhidratáljaKeringésNyugtatjaKftsejtregenerációtFutureFokozzaCudywebáruházesetérekrémmosószertüneteklevélHazailábNehéz

Forrás: pepitahirdeto.multiapro.com

Hogyan kaphat ajándékba egy olyan pénztermelő gépezetet, ami nulláról indulva, alig 29 nap alatt, képes volt 3.748 eurós jövedelmet generálni, miközben emberek tucatjainak tettük egészségesebbé az életét…


Feladva: 2017-08-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8230egészségesenvoltegyéletétvégreképesajándékbaegészségesebbéSzeretnealattkaphatsztettüknapHogyantucatjainakalig8220emberekindulvaJózsef

Forrás: pepitahirdeto.multiapro.com

Táplálékunk az egészségünk! Túlszennyezett világunkban rengeteg káros anyag halmozódik fel bennünk, ezért fontos a szervezetünk megtisztítása, és az ételeink megtisztítása is! Ehhez nyújt segítséget e készülék, mely ózonnal (O3) kitisztítja a zöldségekbe, gyümölcsökbe felhalmozódott vegyszer, rovarölő-szer maradványokat. A húsokból és halakból a hormon és egyéb maradványokat. De fertőtleníthetjük lakásunkat, autónkat a különböző gombáktól, baktériumoktól is. Igazi természetes fertőtlenítő! ... további részletek >>


Feladva: 2014-10-23    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: megtisztításamaradványokatfertőtlenítőkészülékvegyszerautónkatvilágunkbanfelhalmozódottételeinklakásunkatTúlszennyezettgyümölcsökbeszervezetünkegészségünk

Forrás: pepitahirdeto.multiapro.com

A reggeli futás hatásai a nap további részére azontúl, hogy megadják a kellő lendületet, még szellemi teljesítményünket is képesek javítani. Ha lassú tempóban végezzük, szervezetünkben felszabadul a kreativitás hormonja, melynek nagy hasznát vehetjük a napi problémák megoldásában. A futás és zsírégetés közti kapcsolat sokak számára a legnagyobb ösztönzést adja ahhoz, hogy ezt a mozgásformát válasszák. A megfelelő pulzusszámot elérve beindul a zsíranyagcsere, ennek köszönhetően érhetjük el a ... további részletek >>

szép, tónusos izomzatot. Futás kezdőknek és haladóknak - hasznos tippek weboldalunkon!


Feladva: 2016-11-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Futászsírégetéshogyköztitónusosfelszabadulmozgásformátkellőszépszervezetünkbeneztmegadjákmegoldásábanérhetjükvégezzükazontúlproblémákköszönhetően

Forrás: pepitahirdeto.multiapro.com

Cigány (lovari) nyelvoktatás, középfokú állami nyelvvizsgára szakszerű felkészítés (10 hét, 80 óra)! Vizsga- és oktatási anyagokat (órai jegyzeteket is) biztosítok cigány és magyar nyelven. A képzés helye: a Nyugati Oktató Központban Jelentkezés: az alábbi elérhetőségeken.


Feladva: 2015-05-08    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 06204284486cigánylovariBudapestvagyVizsgaLászlóóraciganynyelvoktatasÁgostonJelentkezéshétwwwDemeternyelvenfelkészítéshttpKözpontbanmagyarLink

Forrás: pepitahirdeto.multiapro.com

A tisztaság fél egészség! Persze a mondás máshogy is szól, mely akár még igaz is lehet. Hiszen minek vesződjön a ruhatisztítással, a fárasztó mosással, vagy a korán sem kíméletes vegytisztítással, amikor van, aki szívesen megcsinálja Ön helyett? A mosoda Budapesten biztosítja azon professzionális ruha- és vegytisztítási szolgáltatásokat, melyek garantáltan foltmentes világot teremtenek. A mosoda Budapesten több évtizedes múltra tekint vissza. Új üzemeltetőként igyekszünk a patinás patyolat ... további részletek >>

hírnevét tovább vinni, munkatársaink a mosást, a vegytisztítást és a ruhatisztítást gyorsan és precízen látják el, olyan kiegészítő szolgáltatásokkal együtt, mint például a frissen mosott ruha házhoz szállítása. Teljes körű szolgáltatásaink, kedvező áraink, szakképzett kollégáink és a professzionális eszközeink teszik lehetővé, hogy a mosoda Budapesten még a háztartási mosógépek világában is versenyképes legyen. Ruhatisztítás Budapesten és egész Pest megyében, gyorsan és precízen!


Feladva: 2016-10-05    [Lakossági szolgáltatás]

Címkék, kulcsszavak: mosodaBudapestenprecízengyorsanmégRuhatisztításruhaprofesszionálismegcsináljamintfárasztóháztartásitovábbteremtenekmondáskedvezőszívesenegyüttaki

Forrás: pepitahirdeto.multiapro.com

Komplett házimozi, moziszoba, multiroom rendszerek építése! Próbálja ki otthonában · HáziMozi beállítás · Egyedi ajánlatok · Profi helyszíni telepítés Moziszoba tervezés-építés | Mark Levinson erősítők | Revel hangfalak | REL mélyládák | Arcam www.hazimozistudio.hu/szolgaltatas ok


Feladva: 2017-05-27    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: 183HáziMoziMoziszobatervezésPróbáljawwwépítéseArcamtelepítésrendszerekmélyládákhelyszínimultiroomRELProfiKompletthangfalakajánlóRevelajánlatok

Forrás: pepitahirdeto.multiapro.com

Rejtett Kamerák raktárról otthoni és ipari használatra is! www.kameradepo.hu/komplett-rejtett -kamera-rendszer


Feladva: 2017-06-14    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: RejtettBudapestKameradepokészletünketóriásimeghasználatraNézzeipari8211otthoniKamerarendszerekraktárrólKamerák

Forrás: pepitahirdeto.multiapro.com

A hyaluronsavas ráncfeltöltés a Bionic Lifter segítségével egyedülállóan hatékony. A Washingtoni Egyetem vizsgálata szerint hatására a bőr elasztin tartalma 45%-kal nő, ami hihetetlen eredmény a bőrfeszesítés szempontjából. A hyaluronsavas ráncfeltöltés nagyon gyengéd és kíméletes módszer. A természetes hatóanyagok bőrbe juttatása nem injekcióval, hanem egy speciális technológiával, az iontoforézissel történik. Ez a forradalmi újítás teszi lehetővé, hogy a bőr mélyebb rétegeibe is eljusson a ... további részletek >>

nedvességmegkötésben verhetetlen hyaluronsav. Hyaluronsavas ráncfeltöltés árak itt!


Feladva: 2017-07-17    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: ráncfeltöltésHyaluronsavasbőrhatásárarétegeibespeciálisKellérgyengédszerintmélyebbegynagyonvizsgálatahanemszempontjábólitthogyEgyeteminjekcióval

Forrás: pepitahirdeto.multiapro.com

Hatékony nyelvtanulás kezdőknek és újrakezdőknek. Közérthető nyelvtani leírások, érthető magyarázatokkal. Az otthoni tanulás segítője.


Feladva: 2017-09-12    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nyelvtanulásHatékonymagyarázatokkalérthetőleírásoknyelvtaniKözérthetőújrakezdőknekkezdőkneksegítőjetanulásIstvánotthoniotthon

Forrás: pepitahirdeto.multiapro.com

Horvát Tengerpart Zadar! Kiadó Tengerparti Apartmanok! Kedvezményes apartman kínálatok! Már most foglalja le Álmai apartmanját Nyári Tengerparti nyaralásához! Akciók már 39 Euro/4 fő/apartman/nap! Felejtse el a Booking.com-ot! Nálunk minősegi garancia van és olcsóbbak vagyunk min. 30%-al mint a Booking. Személyesen adunk át minden apartmant a vendégeinknek és bármikor ott a magyar kolléga Zadarban, ha segítség, vagy információ kell. Alkudni lehet! Ne felejtse el, spórolhat ... további részletek >>

idejekorán megkötött előfoglalásával és a legjobb tengerparti apartmanjaink közül választhat! Közvetlen információs profilunk ajánlatokkal: www.facebook.com/zadarkiadoapartmanokraczattila Ha szeretné hogy a barátai is lássák a hirdetést, ossza meg az idővonalán is. Kiadó Tengerparti Apartmanok Már 10 Euró/fő-től! Nyaralást, vagy örök tengeri hajóvezetői jogosítványt szeretnének? Akár Egy nap alatt? Esetleg Tengerparti Ingatlant Vásárolnának Magyar zadari ügyintézéssel? Keressen! Ha tetszik a Horvát Tengerpart, Hirekért, kedvezményes Szállás ajánlatokért, ingatlanvásárlásért-tanácsadásért jelöljön ismerősnek bennünket, vagy a honlapon az információs profilunk linkje: www.facebook.com/zadarkiadoapartmanokraczattila Honlapunk: www.horvatapartman.eu Ha szeretné hogy a barátai is lássák a hirdetést, lájkolja és ossza meg az idővonalán is!


Feladva: 2016-10-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: TengerparticomvagywwwApartmanokKiadófelejtseosszaMagyarfacebookhirdetéstlássákprofilunkkedvezményesbarátaiZadarbookinghogyTengerpartszeretné

Forrás: pepitahirdeto.multiapro.com

Vállalatunk sok éve foglalkozik duguláselhárítással, vízszereléssel, fűtésszereléssel. Vállalunk szervízelést, javítást, cserét, és karbantartást. Akár évi ellenőrzésre is hívhat minket. Foglalkozunk kazánokkal, gázkészülékekkel, cirkókkal, bojlerekkel, lapradiátorokkal. Ügyfélszolgálatunk éjjel-nappal működik, fix árakkal dolgozunk.


Feladva: 2017-11-22    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: javítástAttilagázkészülékekkelszervízeléstdolgozunkFarkaskazánokkalVállalunkárakkalMesterFoglalkozunkfűtésszerelésselfixFűtésszerelőminketműködikévi

Forrás: pepitahirdeto.multiapro.com

Itt az idő, az ablakcsere ideje. Vásárolja Ön is nyílászáróját nagykerből 48% kedvezménnyel! Rendelje meg most ablakait és ajándékba adjuk az egyik ablakra a redőnyt vagy szúnyoghálót! (250000 Ft feletti rendelés esetén) IGLO5, IGLO5 CLASSIC •5 kamrás, •70 mm beépítési mélységű, •2x külső EPDM gumitömítéssel, •alap üvegezése 4/16 Ar/4 Low-e thermofloat üveggel, argon gázzal töltve, •Uw=0.92 W/m2K, •EN-674 szabványnak megfelelően, •MACO MULTI ... további részletek >>

MATIC KS vasalattal, •Lehetőség változó vastagságú üveg beépítésére Redőny, szúnyogháló, reluxa kedvező áron, rövid határidővel! További 5% kedvezmény nyugdíjasoknak és egyedülálló 2 vagy több gyerekes családoknak Látogasson el weboldalunkra, ahol részletes leírást talál termékeinkről. 2017. május 1-31. között regisztráló felhasználóink között ajándékokat sorsolunk ki, amelyet megrendelésével együtt szállítunk! Ajándékok: Hoppe Secustic kilincs 3 megrendelőnk minden ablakára, amelyet tőlünk rendel, Aereco légbevezető 5 lakásba, amelybe tőlünk rendelik a nyílászárókat.


Feladva: 2017-05-02    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 8226vagyRedőnyAblakamelyetközötttőlünkIGLO5MULTIablakaitmájusLowEljöttamelybetöbbeseténHoppeszúnyoghálóMACOmost2017üvegezéseBudapestmeg

Forrás: pepitahirdeto.multiapro.com

Oly sokszor üzentem, versbe szedve, szépen. - El is olvashatod, már ezen a héten. Új verseskötetem napvilágot látott, ”MEGSÚGOTT TITKAIM” hiszed, majd, ha látod. Verseim díszíti 69 képem, mit magam festettem, a számítógépen. Valóra válik hát, dédelgetett álmom, s ki előre utal, annak dedikálom.


Feladva: 2015-11-05    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: TITKAIMMEGSÚGOTTverseskötetemErvinAranyosi8221szedveszámítógépenversbefestettemdedikálomüzentemmagamlátottannaksokszormitnapvilágotutalOlymár

Forrás: pepitahirdeto.multiapro.com

Ha egy teljesen legálisan működő, most induló osztrák céggel szívesen dolgoznál együtt - ahol az összes tulajdonost más üzletekből régebb óta személyesen ismerünk -, akkor nincs mire várnod, itt a hét minden egyes napja pénzgyártásról szól!


Feladva: 2017-09-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: együttRomanoczkiakkordolgoználszólFerencismerünkszívesenpénzgyártásrólPénzgyártásszemélyesencéggelnapjaótaosztrákegyesrégebbindulómindenmost

Forrás: pepitahirdeto.multiapro.com

Jóslás, sorselemzés, párkapcsolat, karrier, pénz, egészség, stb. lelki tanácsadás. Jóslás, döntéshelyzet, elakadás, krízis esetén... Minden nehézségből van kiút, a kártya megmutatja más nézőpontból a dolgokat, megmutatja a helyes irányt. A mágia segíti a pozitív energiák áramlását. Személyes tanácsadás Szegeden, Budapesten és online. Hívjon bizalommal: 308199987 www.joslasszeged.com


Feladva: 2017-06-07    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: JóslássorselemzésmegmutatjatanácsadáskarrierbizalommalmágiaMindenpárkapcsolatHívjonirányteseténonlinehelyeskrízisSzegedBudapestenelakadásBudapest

Forrás: pepitahirdeto.multiapro.com

VALTSD VALORA AZ ALMAIDAT A DXN-NEL LEGY ANYAGILAG FUGGETLEN Keress egy olyan terméket, amit minden nap fogyasztasz és beszélj róla másoknak is, mint eddig, amikor semmi anyagi érdekeltséged nem fűződött hozzá! Ilyen egyszerű! Semmi több! www.kaveido.ganodermakave.hu Két jó hírem van: Nem kell tovább keresned, megtaláltad ezt a terméket: a ganodermás kávét! Te is meg tudod csinálni! Kapcsolat ilonakovacs60@gmail.com Skype ilonakovacs1960


Feladva: 2017-09-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: VALTSDterméketSemmiNemALMAIDATVALORAkávétamitKétanyagiganodermásolyanganodermakaveilonaamikoregykaveidohorvathilonakovacs1960eddigeztKeress

Forrás: pepitahirdeto.multiapro.com

Solnhofeni német mészkő kiválóan alkalmas kültéri és beltéri burkolásra. Kültérben lábazatok, kerítések, támfalak. Beltérben falra kandalló mögé, konyhába, fürdőben aljzatra egyaránt alkalmas, fagyálló burkolókő. Kültérben kizárólag csak függőleges felületre ajánlott, csak zárt, illetve fedett terasznál! Ajánlott még a 6-7 mm-es vastagság. Nyitott terasz és járda burkolás esetén 8-12 mm-es vastagság az alkalmazandó. Az ár az Áfa-t nem tartalmazza. Országos házhoz szállítás ... további részletek >>

kedvezményesen. www.kocenter.hu


Feladva: 2017-03-30    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: németKültérbenSolnhoffeniajánlottalkalmasvastagságcsakmészkőnyitotttartalmazzatérben7mmburkolókőnemBelkövesfagyállóÁfatámfalakterasználfedet

Forrás: pepitahirdeto.multiapro.com

Nagy lépés ez egy embernek, és még nagyobb az emberiségnek! Megtakarítások nélküli probléma megoldás! Sok család eddig azért nem tudta megoldani nagy kiadásokkal járó problémáit, mert a bevételből nem tudott megtakarítani ezek érdekében! Ennek a korszaknak vége, most már nincs akadálya annak, hogy minden tervét megvalósíthassa! A „Jövőképem a Létem” Támogató rendszer többek között lehetőséget nyújt: Családi ház, nyugdíj, Gépjármű vásárlás, Áram és gázszámla megszüntetése, ... további részletek >>

Gyermeke magas szintű oktatása, Családja anyagi jóléte, utazások, hobby, karitatív tevékenység, egyéb álmok, célok megvalósítására! A „Jövőképem a Létem” Támogató rendszer célja, hogy megszüntessük Magyarországon a szegénységet, hogy ne kelljen családoknak szétválniuk külföldi munkavállalás miatt, hogy a családok életszínvonalát jelentősen növeljük annak érdekében, hogy a jelen és a jövő generációja már egy sokkal jobb világban élhessen! Úgy oldhatja meg a jövőben felmerülő jelentős összegű anyagi kiadásait, hogy nincs szüksége havi rendszeres megtakarításokra! Jövőkép Programunk tökéletes megoldás arra, hogy akár már 2-3 év alatt megoldhassa az igényeihez szükséges anyagi hátteret! Mivel Önnek garantáltan ez egy fillér költségébe sem kerül, és a programot követve garantáltam megoldhatja a jövőben felmerülő jelentős anyagi kiadásokkal járó problémáit, ezért jelentkezzen bátran, mert kizárólag csak nyerhet a Tökéletes Támogató rendszerünkkel! rozsabusiness@gmail.com


Feladva: 2017-04-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyanyagiTámogatómáregymegoldásproblémanélkülinemMegtakarításokproblémáitrendszerjáró8221nagykiadásokkalLétemTökéletesnincsJövőképemjelentős

Forrás: pepitahirdeto.multiapro.com

Klíma javítás, klímatelepítés - akár hűtésre, akár fűtésre -, karbantartás (gázzal feltöltés, gombátlanítás, fertőtlenítés), áthelyezés garanciával!!! Klíma telepítés 4m csőhosszig nettó 43.000 Ft! Minőségi klímakészülékeink: Panasonic, Nord, Samsung, Midea, Fisher, Fujitsu, Daikin


Feladva: 2015-04-01    [Lakossági szolgáltatás]

Címkék, kulcsszavak: klimaakárgaranciávalKlímaszerelés000wwwnettóDaikincsőhosszighűtésreFujitsutelepítésklímatelepítésFisherjavításMideaáthelyezéstólSamsungNord

Forrás: pepitahirdeto.multiapro.com

-550L-es alsó kifolyású, raklapra szerelhető rozsdamentes tartály -kb 400 db/perc teljesítményű gravitációs levező -4,5m3-es rozsdamentes tartályok -2 m3-es rozsdamentes tartály -rozsdamentes konténerek -pedálos zacskó záró gép -vibrációs rázók - 2 db 3m-es csigás felhordó -rozsdamentes szállítószalagok talpaslánccal: -2,5m-es -7,5m-es -3m-es -3,8m-es -3,5m-es


Feladva: 2013-09-02    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: rozsdamentesszállítószalagoktartálytartályokgépektalpaslánccalkonténerekkifolyásúalsó550Lfelhordó5m3Kongépcsigáslevezősavállórázókgravitációsgép

Forrás: pepitahirdeto.multiapro.com

Három és négy napos jobb agyféltekés rajzolás ID módszerrel kurzusok akciósan 17500 Ft-ért eszközökkel együtt. Mindenkinek sikerül!


Feladva: 2017-04-30    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: rajzolásagyféltekésjobbeszközökkelHáromértBudapest17500DezsőakciósanImrekurzusokakciómódszerrelsikerülMindenkineknaposegyüttnégy

Forrás: pepitahirdeto.multiapro.com

Költöztetéssel, szállítással, megrendelőink nagy megelégedettségére! Tevékenységünk köré tartozik a Pianínó és Zongora szállítás is. Bízunk benne hogy minket választ. Kérem tekintse meg a költöztetés kalkulátorunkat, amivel ön előre ki tudja számítani a költöztetés árát! Nem csak Budapesten, hanem Vidéken is költöztetünk.A Költöztetés Budapest oldalon, További Információ: www.koltoztetesbudapest.eu vagy www.pianinoszallitas.eu Főbb tevékenységi területeink: Budapest, Budaörs, Budakalász, ... további részletek >>

Budakeszi, Dunakeszi, Dunaharaszti, Érd, Fót, Göd, Gödöllő, Gyál, Halásztelek, Kistarcsa, Mogyoród, Nagytarcsa, Őrbottyán, Pécel, Pilisvörösvár, Pomáz, Ráckeve, Szentendre, Szigethalom, Szigetmonostor, Szigetszentmiklós, Tököl, Törökbálint, Üllő, Vác, Vecsés, Veresegyház.


Feladva: 2017-02-26    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KöltöztetésBudapestwwwVácTevékenységünkPécelcsakDunaharasztiválasztÜllővagymegelégedettségéreŐrbottyánNemDunakesziminketTörökbálintnagyNagytarcsa

Forrás: pepitahirdeto.multiapro.com

Vállaljuk műanyag, illetve alumínium redőnyök javítását. GURTNICSERE SZÉKESFEHÉRVÁR ÉS KÖRNYÉKE. Műanyag ablakok, ajtók beállítása, javítása, törött vasalatok cseréje. Hőszigetelt üvegek cseréje műanyag szerkezetekben. HÉTVÉGÉN IS!


Feladva: 2016-05-08    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: műanyagSZÉKESFEHÉRVÁRcseréjebeállításaRedőnyszervizajtókFejérHÉTVÉGÉNablakokredőnyjavításszerkezetekbenKÖRNYÉKEajtóAblakGURTNICSEREüvegekjavítását

Forrás: pepitahirdeto.multiapro.com

A Makulátlan Tiszta Terület Kft., Panoráma ablak, a PVC, a Parketta, a Felújítás utáni, A szőnyeg mély tisztítása, az Irodai eszközök tisztítását, a Zsíros kézmosó, a Boltíves üvegtető, a Lépcsőházi takarítás, a Kazánház takarítása, a Sportlétesítmény, a Kirakattisztítás, a Nagy felületű ablak tisztítása, a Mohás terasz takarítása, az Éttermi asztal tisztítása, a Maszatos, csíkos padló tisztítását a Gumicsík eltávolítását, a seprést, a Domború burkolatok, az Irodaház ablakainak tisztítását, az ... további részletek >>

Olajozott parketta tisztítását, a Garázs tisztítását, mind kihívásnak tekinti, és örömmel végezzük el.


Feladva: 2016-11-16    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tisztításáttisztításaMakulátlanparkettatakarításaKftTerületablakTisztafelületűeszközökpadlóNagyGarázsIrodaicsíkoskerületKirakattisztításmélyPVC

Forrás: pepitahirdeto.multiapro.com

Új és használt ipari csavarkompresszorok széles választékban! - 5,5 kw-tól 150 kw-ig - gyári új - felújított kompresszorok garanciával - alap gép - frekvencia váltós - légtartály - hûtveszárító - országos szervíz szolgálat 690.000.- Ft-tól Pitair KFT Tel: 06-20-330-6665 www.pitair.hu


Feladva: 2017-04-26    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: pitairKFTtólszervízlégtartályszélesTelváltóscsavarkompresszorokfrekvenciaiparigéphasznált000alapRáckeve690garanciávaljavításszolgálatországos

Forrás: pepitahirdeto.multiapro.com

Eddig mennyit kerestél abból az üzletből, amely mellett minden körülmények között kiállsz? Értem én, hogy hirdetéseket adsz fel, mert valami csodát ajánlasz! Értem Én, hogy pénzt szeretnél keresni abból, amit ajánlasz! Azt nem értem, hogy miért kell külföldiek zsebét tömnöd! Minden külföldi tömhetné a Te zsebedet is! Gondolkozz!!!!!!!! Biztos vagy abban, hogy az a csoda termék, amit ajánlasz, Neked milliókat hozhat? Sok pénzt kifizettél, befektettél már világmegváltó lehetőségekbe? Sok ... további részletek >>

pénzt elveszítettél? Meg is érdemled! Ez fájdalmas tanuló pénz volt! Mindent értek! Csak azt nem, hogy miért nem vagy nyitott olyan lehetőségre, ahol minden másképp működik, mint amit eddig megismertél! Nem kell befektetned, nincsenek MLM eladások, nincsenek vásárlási és egyéb kötelezettségek, nincs semmi, amit nem szeretnél! Vannak lehetőségek, amelyeket kihasználhatsz, ha szeretnéd! Van arra lehetőséged, hogy akár 5-10 év alatt milliomos legyél továbbajánlások nélkül is!!!!!!!!!!! Ingyen van az információ, nem kell befizetned, és mégsem érdekel???? Mondd meg Te, hogy mit szeretnél, és megnézzük, hogy lehetséges e, de valószínű, hogy igen! Keress bizalommal kérdéseiddel az email címemen. Ha megadod a telefonszámod, szívesen fel is hívlak! Email: rozsabusiness@gmail.com


Feladva: 2017-03-07    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmindenamitértemabbólkellszeretnélajánlaszpénzteddigaztSokmellettamelyEmailüzletbőlkerestélfelmennyitnincsenekvankiállszmegvagy

Forrás: pepitahirdeto.multiapro.com

Struccok eladók, előjegyezhetők 2-4 hetes kortól tenyészérett korig! Strucc keltetők, keltetés, strucc adás-vétel, hús, szalámi, étkezési tojás, kifújt tojások stb...! Tenyésszen, hizlaljon struccot vágóhidaknak! EU konform technológiával! A jövő haszonállatát, a legjobb áron felvásárolom!


Feladva: 2015-01-19    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: struccjövőétkezésihetestechnológiávalszalámielőjegyezhetőkkonformhúseladókvágóhidaknakvételStruccokstruccotadásKiskunhalashizlaljonSándorkeltetés

Forrás: pepitahirdeto.multiapro.com

100+ nyelvpárban fordítunk szakszövegeket, a legmodernebb nyelvtechnológiai eszközökkel, magasan képzett szakfordítók bevonásával, professzionális irodai háttérrel. Specialitásunk a többnyelvű projektek kezelése, magyarról és angolról fordítunk egyszerre akár 40+ nyelvre. Leggyakrabban az alábbi témakörökben fordítunk, napi kapacitásunk több száz oldal: - jogi és pénzügyi szakszövegek, műszaki dokumentációk - felhasználói kézikönyvek, útmutatók, honlapok és online tartalmak - ... további részletek >>

szoftverfelületek és mobil applikációk - betegtájékoztatók, egészségügyi kiadványok - marketing anyagok - tréning és e-learning anyagok, multimédia tartalmak Irodánk kiemelten sok műszaki és élelmiszeripari szöveget fordít, ezekkel a projektekkel két külön divíziónk foglalkozik. A fordításokat fordítástámogató szoftverrel készítjük el, így lehetőség nyílik a szövegen belüli és a korábban lefordított szövegek közti egyezőségek felismerésére. További előnyök: - ismétlődésekkel arányos kedvezményes vállalási ár - garantált, következetes terminológia használat - könnyebb és hatékonyabb minőségellenőrzés - rövidebb határidők A fordításhoz kapcsolódó szolgáltatásainkra is felhívjuk a figyelmét: - lokalizálás - lektorálás - nyelvi konzultáció - fordítómemória és terminológiaépítés - szövegszinkronizálás - stílusútmutató - nyelvi tesztelés - gépi fordítás és utószerkesztés - DTP - internationalization „i18n” - leírás - kreatív fordítás | transzkreáció - voice over Kérje ajánlatunkat! www.edimart.com/szolgaltatasok


Feladva: 2017-04-12    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: fordításfordítunkműszakinyelviakártartalmakanyagokdokumentációkszakszövegeketfelhívjukfordítástámogatóalábbiovertranszkreációkövetkezetesegészségügyi

Forrás: pepitahirdeto.multiapro.com

Paleo Gluténmentes csoki, édesség termékek nagy választékban a NaturTéka webshopban. Rendeljen online vagy telefonon akár ingyenes kiszállítással!


Feladva: 2017-05-22    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: NaturTékaédességcsokiGluténmentesPaleoRendeljenHirdetőwebshopbanPepitawebáruházválasztékbannagykiszállítássaltermékekingyenesakártelefononvagy

Forrás: pepitahirdeto.multiapro.com

A goji bogyó és a chia mag szuperélelmiszerek, melyeknek nevét ma már az egész világon ismerik. Immunerősítő és antioxidáns hatásuknak köszönhetően nagyon jól felhasználhatók a betegségek megelőzéséhez. A goji bogyó szuperélelmiszer legfőbb hatóanyaga a zeaxantin és a béta-karotin, melyek egyenként is óvják a szem egészségét, együtt pedig még fokozottabban segítenek a látásromlás elkerülésében még idősebb korban is. Agyműködést serkentő, energiát adó, fáradtságot megszüntető hatása miatt a ma ... további részletek >>

embere számára különösen értékes növény. A szuperélelmiszerek jótékony hatásai kapcsán tudjon meg még többet: www.gyumolcsok.veganostra.hu/goji-novenyi-feherje


Feladva: 2016-12-06    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: mégszuperélelmiszerekbogyógojiVeganostraegyenkéntszámárabetegségekidősebbmártöbbetmelyekemberefelhasználhatókelkerülésébennevétkarotinmiattjól

Forrás: pepitahirdeto.multiapro.com

Otthonosan berendezett lakás kiadó Szegeden. Szállóvendégeink szeretik a jól felszerelt konyhát, valamint a szép fürdőszobát. olcsó szállás Szeged : 2800ft/fő/nap


Feladva: 2017-10-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SzegedszállásCsabakonyhátFülöpfelszereltapartmanjólpanziónapszeretikszegedi2800ftSzállóvendégeinkSzegedenkiadóolcsólakásfürdőszobátberendezett

Forrás: pepitahirdeto.multiapro.com

Clímatrend termékeinket továbbra is ClimaGuard™ Premium üveggel (Ug=0,6 W/m2K), és extraként Swisspacer™ távtartó profillal (meleg perem) gyártjuk. Mindezek ellenére árainkat nem emeljük! Vásároljon extra hőszigetelésű üveggel készült ablakot, erkélyajtót és bejárati ajtót régi áron! Minőségi termékek elérhető áron, Schumacher™ nyílászárók! Kérjen ingyenes árajánlatot! Tel:06-79/478-405 E-mail: info@schumacherajto.hu www.schumacherajto.hu


Feladva: 2016-01-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SchumacherüveggeláronbejáratiellenéreingyenesClimaGuarderkélyajtótMindezekKérjentovábbraablakotgyártjuknyílászáróktermékeinketkészültschumacherajto

Forrás: pepitahirdeto.multiapro.com

Tessék már belegondolni! Mi szüksége van a Google-nak egy MLM cégre? Ha pedig mégis lenne, pont olyan emberekre bízná a toborzást, akik nem, vagy alig értenek valamit az internetes megjelenéshez? Értem én hogy nagy a szükség és meg kell ragadni - főként - a kínálkozó online lehetőségeket! De... 1. Rendkívül etikátlan valamit álláshirdetésként hirdetni, ami nem az! 2. Az MLM (Multi Level Marketing) értékesítési szisztéma jó dolog. Pont ilyen megtévesztésekkel kell elijeszteni tőle jó ... további részletek >>

sok mindenkit, hiszen sokakban úgy csapódik le, mintha az összes MLM erről szólna. 3. Legyen már legalább annyi igénye végre az internet használóknak, hogy bármi, amit olvasnak a neten, annak utána néznek előbb a jellemző szavakat keresve! A XXI. századi ember attól lesz valaki, ha tudja és akarja használni az eszközeit! www.pepitahirdeto.multiapro.com/apro.php?page_id=60546


Feladva: 2016-11-01    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: MLMPontvalamitmárGooglehogynemkellbíznájellemzőmegtévesztésekkelszükségeinternethirdetniakarjaminthaszükségemberekreelőbbilyenbelegondolni

Forrás: pepitahirdeto.multiapro.com

Ásvány medál ékszer szett 12 féle ásvány egy dobozban: www.lilibizsu.hu/modules.php?name= termek&id=01275_ASVANYMEDAL-KESZLET


Feladva: 2018-01-12    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ásványszettmedáldarabosdobozbanegyféleékszerWEBÁRUHÁZBIZSULILI

Forrás: pepitahirdeto.multiapro.com

Értékesítésben jártas munkatársat keresek. Egészségtudatos, kitartó, célorientált, magáért tenni akaró személyt keresek, számítógépes ismeret előnyt jelent, mivel profi online eszközökkel dolgozunk.


Feladva: 2017-08-22    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekjártasÉrtékesítésbenmunkatársatszámítógépesArankaszemélytdolgozunkakaróeszközökkeltennionlinemagáértproficélorientáltmivelkitartójelent

Forrás: pepitahirdeto.multiapro.com

Készbeton szivattyúzásához rendelhet nálunk beton pumpát vagy pumix-ot huszonhárom méteres gémhossztól egészen ötven méteresig, melyeket igény esetén meg is lehet hosszabbítani földre fektetett csövek összeszerelésével. Készbeton szivattyúzási óradíjainkat megtalálja weboldalunkon!


Feladva: 2014-07-04    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: Készbetonbetonarhosszabbítanihuszonháromwwwlehetpumixweboldalunkonmegvagymegtaláljaeseténpumpátóradíjainkatigénybetonszivattyúzásimelyeketnálunk

Forrás: pepitahirdeto.multiapro.com

Hölgyeim, Uraim! Engedjék meg, hogy fegyelmükbe ajánljam ezt az új építésű lakást, melynek LEGYEN Ön az első új tulajdonosa. Először is hadd vezessem körbe leendő otthonában. Kezdjük hát körutazásunkat. Miután be jöttünk a kapun és kényelmesen le parkoltunk a házunk előtt a saját parkolónkba már csak néhány lépést s bent is vagyunk a lakásunkban. Itt egy kényelmes elő térben találjuk magunkat, ahol kényelmesen le vehetjük a cipőket és kabátokat. Balra fordulva találjuk a lépcsőt, amin kicsit ... további részletek >>

később a felső szintre fogunk fel menni. A lépcső mellett találunk egy kicsi tárolót ahol akár a kabátokat tárolhatjuk. Forduljunk jobbra ahol egy másik ajtó található ahol is a háztartási gépeknek adhatunk otthont. Majd tovább haladva egyenesen egy tágas Amerikai konyhás nappaliban találhatjuk magunkat. Itt van elég hely, hogy kényelmesen tudjunk sütni, főzni, sőt egy étkező asztal is kényelmesen elfér. Innen nyílik továbbá egy kisebb terasz is ahol igazán remekül élvezhetjük a reggeli adta ébredés idejét. Hiszen fontos, hogy jól induljon a napunk. De nézzük meg a felső szintet is ahol az éjszakánkét töltjük. Itt a felső szinten három kényelmes szoba található, amit kényünk kedvünk szerint használunk. Mind A három szoba világos és tágas is. Így kényelmesen tudjuk elhelyezni a bútorainkat. Ami elengedhetetlen a tökéletes pihenéshez. Tetszett? Nézzük meg személyesen is.


Feladva: 2017-09-28    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egyaholkényelmesenhogyfelsőIttmegtalálhatóNézzüktágaskényelmeskabátokatszobahárommagunkattaláljukigazánjobbraparkolónkbaKihagyhatatlanÍgy

Forrás: pepitahirdeto.multiapro.com

Szeretettel várunk minden pihenni, szórakozni és kirándulni vágyó vendéget a Velencei-tó mellett lévő pákozdi vendégházunkban! A ház közvetlenül az erdő mellett, csendes festői környezetben található, ami családias hangulatot, kényelmet, nyugalmat biztosít vendégeink számára. Ideális szórakozni, pihenni vágyó családoknak, osztályoknak, baráti társaságoknak (max. 45 főig, egyeztetés után).


Feladva: 2016-12-03    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: pákozdivágyópihenniszórakoznimellettvendégházingókőamilévőtalálhatóVelenceikörnyezetbenutánVendégetIdeálisfestőiegyeztetéskirándulniszámárafőig

Forrás: pepitahirdeto.multiapro.com

Eladó szamurájkard, katana, wakizashi, tanto! Minőségi acél, választható markolat és sok minden más... Aktuális árukészlet és akciók a honlapunkon!


Feladva: 2017-04-28    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szamurájkardEladóKardokSzamurájtantowakizashikatana

Forrás: pepitahirdeto.multiapro.com

Budapesten belül vállalok kedvező árakon burkolást és felújítást, nagy tapasztalattal! Rövid határidővel dolgozom, hétvégén is hívható vagyok. Árak: burkolás 3000.-/nm Mozaik, díszkő, diagonál 3200.-/nm Metro csempe 3500.-/nm Laminált parketta 1000.-/nm További részletek telefonon.


Feladva: 2017-10-11    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BudapestenburkolásárakonLamináltvagyokkedvező3500hívhatóvállalokcsempehétvégénbelülMetrodolgozom3200határidővelBudapestdiagonálRövidtelefonon

Forrás: pepitahirdeto.multiapro.com

Tavaszi selyemvirág csokrok közül válogasson a Zöldvilág Webáruházban! www.selyemviragok.hu/index.php?id= 2004


Feladva: 2018-01-13    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ZöldvilágcsokrokselyemvirágTavasziGyőrWebáruházNagykereskedésWebáruházbanválogassonközül

Forrás: pepitahirdeto.multiapro.com

Cégünk személyszállítást vállal kényelmes, 9 személyes mikrobuszokkal. Extra nagy csomagtérrel, dupla klímával, állítható ülésekkel, TV-vel, DVD lejátszóval. Buszainkon 220 voltos töltés lehetőség. Kedvező, 0% os áfás számlás árak. Fiatal korszerű, Euro 4-es motorral felszerelt, biztonságos kisbuszok, képzett hivatásos sofőrök, komoly referenciák.‪


Feladva: 2017-10-10    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: áfáscsomagtérrelképzettmikrobusszalKedvezőnagykisbuszokSzemélyszállítástöltésExtrabiztonságosvoltosmikrobuszokkalfelszerelt220személyesmotorralvel

Forrás: pepitahirdeto.multiapro.com

Susani, ez a szomorú szemű,1,5 év körüli,közepes nagyságú kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni ... további részletek >>

lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagygazdaörökbeGYEPMESTERISÜRGŐSgazdinakszeműszomorúkutya325elaltathatóakmegegysürgősenMEGTELTáltallehetszerintmentsdkankeresünkTELEP

Forrás: pepitahirdeto.multiapro.com

Megbízható, korrekt és kitartó üzlettársakat, munkatársakat keresek! KI sem kell mozdulnod otthonról az internet segítségével otthonról dolgozhatsz. Vannak anyagi gondjaid? Téged is megérintetett a válság szele? Sok munkád mellett nem jut elég időd a családodra? Csak rajtad múlik mennyire vagy kitartó!


Feladva: 2017-12-11    [Pénzkeresés - MLM]

Címkék, kulcsszavak: otthonrólkitartócsaládodraTégedkeresekidődgondjaidmunkatársakateléganyagiüzlettársakatjutVannakkorrektnemdolgozhatszMegbízhatómellettvagySiófok

Forrás: pepitahirdeto.multiapro.com

Megrendelőinknek díjmentes lakberendezési tanácsadás. Színvonalas választék, díjmentes felmérés. Költözik, tanácstalan? Enteriőr tervezés! Főbb területeink: - - Bútorszövet - Tapéta - Karnis - Függöny


Feladva: 2017-05-22    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: FüggönydíjmentesTapétaBútorszövettervezésajánlóEnteriőrHirdetőtanácstalanPepitaKöltözikotthonábafelmérésviszünkStílustKarnisválasztékSzínvonalas

Forrás: pepitahirdeto.multiapro.com

Nem elég a keresete? Szeretne jobban élni. Akkor most ön jó helyen jár. Hiszen megfelelő időben jó helyen lenni az ami meghozhassa az ön számára is az üzleti életében a siker lehetőségét. Magyarországról nyitott Európa felé az Axxa So Plus termékével az Axxa Global cég. Terméke kiváló, rendkívül népszerű ázsiai országokban. Világ sikere elkerülhetetlen. Axxa Global termék tanácsadóként akár komolyabb plusz bevételi forrás elérése lehetséges. Ha érdekli a lehetőség, regisztráljon ... további részletek >>

Axxa global céghez, a www.axxasoplus.hu, vagy az axxasoplus.blog.hu segítségével, vagy keressen elérhetőségeimen. Kovács Zoltán www.axxasoplus.blog.hu www.axxasoplus.blog.hu infó: axxaglobal2017@gmal.com Tel:06-20/8012282


Feladva: 2017-10-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AxxaaxxasoplusblogglobalwwwtermékhttpZoltánPlushelyenvagyregisztráljonszámáraélnitermékévellehetőségmeghozhassaelkerülhetetlenjobbanérdekli

Forrás: pepitahirdeto.multiapro.com

Kéziemelő Raklapemelő BÉKA javítás Felújítás Kölcsönzés Eladó. ollósemelő, magasemelő, raklapmozgátó, szb. 06-30-243-4771 Használaton kívüli rosszat, felvásárolunk, javítás vagy eladás esetén, beszámítunk.


Feladva: 2015-10-18    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: javításRaklapemelőBÉKAvagyhttp4771Kéziemelőfelvásárolunk243BudapestrosszatszbHidraulikakívüliraklapmozgátóRakHasználatonmagasemelőhtmollósemelő

Forrás: pepitahirdeto.multiapro.com

Házi ápolást, idősgondozást vállalok szakképzett ápoló képesítéssel. Folyamatos 24 órás bentlakásos ápolásra vállalok bármilyen beteget, vagy gondozásra, felügyeletre szoruló idős nénit, bácsit. Kórházi gyakorlattal, demens betegelállásában is jártas, empátiával, sok türelemmel rendelkező, önmagára igényes, ápolt, tiszta, mosolygós, leinformálható középkorú, beteg centrikus nővér vagyok. Kérem, keressen bizalommal! Kovácsné Erika Tel: 06-30-463-6404


Feladva: 2017-01-11    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ErikaKovácsnévállalokidősgondozásrendelkezőnénitvagyokórásHáiápolástürelemmelidősnővérfolyamatossokszorulóbetegcentrikusképesítésselempátiával463

Forrás: pepitahirdeto.multiapro.com

Tanuld meg irányítani a sorsodat? Ne fusd a felesleges köröket! Csináltass személyes horoszkópot! Oldjad fel blokkjaidat, jobb életminőséget kapsz érte és nem neked, de gyermekeid élete is ez által javulni fog! Online tanácsadás: asztrológia-horoszkóp, numerológia-számmisztika, névmisztika, tarot-kártya-jóslás, feng-shui. Email: dk kati33@gmail.com Web: www.dk-magie.com


Feladva: 2016-08-23    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: comSegítőSorsshuifusdonlineéletminőségetfengsorsodat8226jobbjóslásirányítanifogblokkjaidatkártyamegjavulnifeltarotTanuldáltalOldélete

Forrás: pepitahirdeto.multiapro.com

Az isiász gyógyítása általában teljes sikerrel jár, hiszen nem rosszindulatú betegségről van szó. Ez sokkal inkább egy tünetegyüttes, melyet az ülőideg összenyomódása okoz. Rendszeres testmozgással, a gerinc és a hátizmok ülés közben történő megtámasztásával, a helyes ülésmód elsajátításával megelőzhető a kialakulása és a kiújulása is. Az isiász lelki okai a túlterhelés érzésében gyökereznek. Ha valakin túl nagy a nyomás, a felelősség, túl sokat vállal magára pl anyagi gondok miatt, nagy ... további részletek >>

eséllyel alakul ki nála ez a probléma. Az idegbecsípődés és isiász kezelése történhet gyógyszerekkel és megfelelő tornával is.


Feladva: 2017-01-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: isiászidegbecsípődéstúlnagykezelésevállalsokkalkiújulásagyógyításagerincsokatszókialakulásaKittiproblématestmozgássalvanmegelőzhetőKellérnála

Forrás: pepitahirdeto.multiapro.com

Ez a vergődés ismétlődik már több éve hónapról hónapra? Változtasson rajta! Változtatás nélkül nincs változás! Ha nem változtat az életén, akkor mitől vár változást? Élni akarja az álmait vagy álmodni a céljait? Ugye nagyszerűnek tűnik, hogy hetente akár több ezer Dollárt is kereshet játszi könnyedséggel? Minden internetes munkával foglalkozó ember álma egy ilyen lehetőség, de a helyzet az, hogy az álom ez esetben mindenképpen csak álom marad. Több átveréssel is lehet találkozni az internetes ... további részletek >>

munka lehetőségek közt. Ha ilyen kétes kimenetelű ajánlatot keres, akkor csalódni fog. mert nem Önn ek szól. Munkát ajánlunk kiemelten magas fizetésért. Az okos ember előre gondolkodik, a buta a múltban él, és a még butább azt gondolja, hogy ha nem tesz semmit sem, akkor sokkal jobb lesz Neki! Sajnos ezért is sok család fog úgy élni, mint most, sok év múlva is, sőt sokkal rosszabbul! Ajánlat azoknak, akiknek komoly céljai vannak és olyan havi jövedelemre van szükségük, amelyből kényelmesen biztosíthatják családjuk megélhetését: / kb. 500.000,- / hónap / Pl: Első sorban több szabadidővel rendelkezők, kiskeresetűek széles kapcsolatokkal rendelkezők vagy több gyermekes családok, stb. Munkaidő: Heti 30 – 40 óra Egyedülálló, rendkívülien magas jutalékkal keresek olyan embereket, akik széleskörű ismeretséggel és kapcsolatokkal rendelkeznek! Jelentkezzen ha konkrét céljai vannak, mindenben segítek. Kérem, hogy az email címemen jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-05-08    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogytöbbnemakkorolyanélnivannakembercéljaimagasspórolvagyfogálombárrendelkezőkfizetésébőljelentkezzenilyenkapcsolatokkalsokkalvégéigjön

Forrás: pepitahirdeto.multiapro.com

Pest megyében Farmoson, jelenleg zártkerti ingatlanom eladom, vagy budapesti önkormányzati garzonra cserélem. 2500 négyszögöles telken 85 nm-es téglaház. Fürdő, WC bent van. Fűtés kályhával. CSOK igényelhető. Ár: 4,5 millió, vételnél az ár alkuképes. Cserénél 4 millió, egy az egyben.


Feladva: 2017-12-28    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vagymillióFarmosonvételnél2500PestmegyébenigényelhetőcserélemFarmosCsokgarzonraSándorkályhávalönkormányzatiSzűcsFűtésBudapesticserélhetővanbent

Forrás: pepitahirdeto.multiapro.com

5 Féle Napkristály ital egy dobozban - 5 x 500ml - 5 Napos Bioflavonoid program - Kibővített összetétel - A legkorszerűbb nanotechnológia - Új vonzó íz, kellemes a gyomor számára. A flavonoidok a szervezet antioxidáns kapacitását növelik, amely képes csökkenteni a szabadgyökök sejteket romboló hatását. Támogatják a védekező rendszer optimális működését. A vörösszőlő segíti az érrendszer optimális működését, javítja a keringést. Antioxidáns tulajdonsága révén, segíthet megvédeni a bőrt is...


Feladva: 2015-11-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: optimálisitalNapkristályAntioxidánsműködésétszabadgyökökvonzócsökkenteniszabananotechnológiaérrendszerképesbőrtlegkorszerűbbsegítiFéleamelyVali

Forrás: pepitahirdeto.multiapro.com

Álmait megvalósítjuk, otthonát hangulatosabbá tesszük, komplett szolgáltatást nyújtunk. Egyéni megrendelők és közületek számára egyaránt a klasszikus megoldásoktól a modern stílusig. Minőségi munkát, minőségi szolgáltatást végzünk, korrekt áron. Szolgáltatásaink: függönyvarrás, drapériák, ágytakarók készítése, római roló és lapfüggöny készítése, függönytisztítás. Varrodánkban textilválasztás is lehetséges!


Feladva: 2016-07-24    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: függönyvarráskészítéseszolgáltatástminőségistílusigtesszükágytakarókmodernhangulatosabbádrapériákmegoldásoktólotthonátklasszikuslehetségesmegvalósítjuk

Forrás: pepitahirdeto.multiapro.com

Német piacra gyártott I. osztályú, prémium minőségű franciaágy, az ottani Deutsch Qualität elvének megfelelő minőségben, akár felső közép-kategóriás aloe vera-s extra szivacsos, rugós és memory-réteges NASA matracokkal, különböző színnel és mérettel(160/180) P1-es minőségű anyagokból a forgalmi értékük 50%-áért. Ágykeret ácsráccsal már 119.000 Ft-ért. Az ár az ágy méretének, funkciójának és anyagának függvényében változik. www.franciaagy.net/franciaagyak/florida-franciaagy Aktuális és ... további részletek >>

tényleges árukészletünkről érdeklődjön személyesen vagy telefonon üzletünkben, ahol állunk szíves rendelkezésére. Jelen hirdetés nem minősül ajánlatnak, a változtatás jogát a hirdető fenntartja.


Feladva: 2017-04-13    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: minőségűfranciaagyfloridahirdetőfranciaágyszínneltelefononkategóriáswwwácsráccsalprémiumajánlatnakkülönbözővagyváltozikközépÁgykeretosztályúfelső

Forrás: pepitahirdeto.multiapro.com

Több mint 10 éve foglalkozunk PIANÍNÓ és ZONGORA szállítással. Szállítóink profi, gyakorlott szakemberek! Vállaljuk magánszemélyek, és cégek PIANÍNÓ és ZONGORA szállítását, alkalmanként, vagy rendszeres időközönként is! Továbbá vállaljuk Cégek és Magánszemélyek Költöztetését Budapesten és Vidéken egyaránt! Pianínó Szállítás, Költöztetés Budapest, Szállítás, Lomtalanítás, Költöztetés kalkulátor, Költöztetés olcsón a PianinoSzallitas.eu weboldalon AKCIÓS ÁRAKON!


Feladva: 2016-03-11    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KöltöztetésPianinóMagánszemélyekCégekvállaljukSzállításBudapestZONGORAPianínószállításolcsóngyakorlottprofikalkulátorSzállítóinkLomtalanításTovábbá

Forrás: pepitahirdeto.multiapro.com

Fűtsön hagyományosan fával, szénnel vagy vegyesen. Elégetheti a papír hulladékot, reklámújságokat és a kartondobozokat is. Magyarországon az egyik legolcsóbb áron. Hagyományos fűtéshez és gázhoz kályhacső, füstcső és kiegészítők. Webáruházunkból országosan kiszállítunk!


Feladva: 2015-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: fustcsokályhacsőkiegészítőkpapírKergázhozElégethetifűtéshezvegyesengazhozHagyományosvagyaluminiumboláronszénnellegolcsóbbfávalkinalategyikfjs

Forrás: pepitahirdeto.multiapro.com

Alkalmi sminkek, maszkmesteri effektek készítését vállalom. Ígény szerint fotóval is! Báli, menyasszonyi, szilveszteri, natúr, nappali, extrém, tablósmink, ballagási smink, fotós és színházi sminkek. Gyermek arcfestés, csillámtetoválás partyk, testfestés, egyéni smink és maszk oktatás. Airbrush és kézi falfestés egyéni igény szerint! Budapest, Csepel, Lakihegy, Szigethalom, Szigetszentmiklós, Halásztelek, Tököl környékén profi smink és maszkmester! FB: www.facebook.com/Djongimakeupsfx


Feladva: 2016-01-17    [
Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: sminkdjongisminkekAlkalmimakeupszerintigényegyéniballagásiSzigetszentmiklóseffektekoktatástablósminkSzigethalommaszkmesterimaszkcomextrémLakihegy

Forrás: pepitahirdeto.multiapro.com

Ránk számíthatsz, ha szállíttatsz! Megbízható szakembereket keres akik megóvják értékeit a költöztetés során? Ne keressen tovább, hívjon minket még ma! Költöztetés 2 fő: 6500 Ft/óra Költöztetés 3 fő: 8000 Ft/óra Lomtalanítást is vállalunk!


Feladva: 2017-12-21    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: Költöztetésóra245minketszállíttatszhívjonszámíthatszvállalunktovábbRánkLomtalanítástkeressenatlaszsoránLomtalanítás8000értékeitmegóvjákKöltözetés

Forrás: pepitahirdeto.multiapro.com

A SkyWatcher 70/500-as lencsés távcsövét kis méretének, könnyű súlyának köszönhetően egyszerűen magunkkal vihetjük családi kirándulásaink alkalmával. Városoktól távol, sötét égen igen kitűnő mély-eges távcső: hatalmas látómezejébe sziporkázó nyílt halmazok sokasága vagy a kiterjedt, sejtelmes csillagközi ködök is beleférnek. De a távcső nappal sem hagyja unatkozni: jól használható spektívként a környező táj megfigyelésére. Az alaptartozék zenittükör egyenes állású, de jobb-bal irányban ... további részletek >>

megcserélt képet ad. A csomagban 25 mm-es, valamint 10 mm-es Super Bárium okulárokat találunk, melyek 20x és 50x-es nagyítást adnak. Spektívként alkalmazva 8-24 mm zoom okulárt javaslunk, mely a 21x-62x nagyítástartományt fedi le. Még nagyobb nagyítások elérésére egyszerű 2x-es Barlow lencse is a csomagban található. Az AZ-2 mechanika egyszerűen használható, ideális természetfigyelésre. Az okulártálcára számos kiegészítőt helyezhetünk, akár az észlelőteánkat is. A kihúzható alumíniumláb pedig testmagasságunkhoz igazítható. www.tavcso-mikroszkop.hu/termek/skywatcher-70-500-az2-refraktor


Feladva: 2017-07-01    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: skywatchertávcsőSpektívkénthasználhatóegyszerűen500csomagbanmelyködökPepitaigazíthatózoomSuperegestermészetfigyelésremegfigyeléséremagunkkalkitűnő

Forrás: pepitahirdeto.multiapro.com

Jó minőségű külső és belső fa nyílászárók, harmonika-toló, emelő-toló, bukó-toló erkélyajtók, valamint egyedi méretre gyártott konyha-háló-fürdőszoba-ebédlő-gardr ób-gyerekszoba-nappali-iroda-üzleti bútorok közvetlenül a gyártótól! Kérem hívjon bizalommal! 0620/473-7816 Megnyílt Nyergesújfalun a Kossuth Lajos u. 70. alatt a GU-BKS viszonteladói boltja! Minden kedves vásárlót szeretettel várunk! Tel/Fax: 0633/355-111


Feladva: 2016-10-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: tolóharmonikaBKSajtóKéremhálóFaxnyílászárókalattgyártótólkonyha0633belsőLajosközvetlenülgyártottTelkülsőKossuthbútorokméretrevárunküzleti

Forrás: pepitahirdeto.multiapro.com

A szálláshely szobái légkondicionáltak (csak a tetőtéri szobák) , TV-vel, hűtővel felszereltek. Minden szobához zuhanyfülkés fürdőszoba tartozik. Lehetőség van számítógépes csatlakozásra, internet használatra. Vendégeink még teljesebb kikapcsolódását medencével és hozzá kapcsolódó szaunával szolgáljuk.


Feladva: 2017-03-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: medencéveltartoziklégkondicionáltakkikapcsolódásátfürdőszobaszobáiteljesebbzuhanyfülkésszálláshelymégszobáhozSzékesfehérvárVendégeinkMindenIgnácPap

Forrás: pepitahirdeto.multiapro.com

Eladó Suzuki Baleno, Swift I, Swift II (2005-töl), Ignis, Wagon R+, Splash felújított váltók. 3 hónap garancia! Cseredarab szükséges. Szállítás az ország egész területén. Ár: 40.000 Ft + szállítási díj - Budapest területén: 3.000 Ft - Pest megye: 4.000 Ft - a többi megye: 6.000 Ft Beszerelést vállalunk: 15.000 Ft


Feladva: 2015-10-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: SuzukiváltókfelújítottmegyeSwiftterületén15000ftdíjvállalunkszállításiSplashbeszerelést40000ftWagon6000ftegészIgnisországtöltöbbiszállítás

Forrás: pepitahirdeto.multiapro.com

Antikvitás, lakberendezés, belsőépítészet Régi- és stíl bútorok, egyéb régiségek Porcelánok - Festmények - Házimunkák Nyitva: minden nap 9-17 óráig


Feladva: 2016-09-16    [Régiség - Művészet]

Címkék, kulcsszavak: GalériaStílusbútorokbelsőépítészetmindenlakberendezésNyitvaAntikvitásHázimunkákGyulakesziFestményekPorcelánokrégiségekmodernegyébAntikstílóráig

Forrás: pepitahirdeto.multiapro.com

Kiemelt specifikációk: - Rendszermemória (RAM) 2 GB - Operációs rendszer verzió Android 7.1.1 (Nougat) - Kijelző átlója 5.2 - Kijelző felbontás 720 x 1280 - Fényképező felbontása, tulajdonságai 13 MP, f/2.0, phase detection autofocus, 1/3 - Processzor sebessége Octa-core 1.4 GHz Cortex-A53 - Akkumulátor kapacitása 3000 mAh Ingyenes kiszállítás 24 hónap garancia Minden gyári tartozékkal Magyar nyelvű készülék VIP Phone szaküzlet 1138 Budapest, Váci út 136/c. +3670-930-4414 ... további részletek >>


Feladva: 2017-07-12    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: mobiltelefonnokiavipkeksimKijelzőphone3000PepitadetectionnyelvűAndroidkapacitásakártyafüggetlenphasewwwMagyarverzióAkkumulátorDual4414A53

Forrás: pepitahirdeto.multiapro.com

Kedves Régi és Új Vendégeim! Következő szolgáltatásokkal várlak Benneteket: * Műköröm építés, manikűr * Géllakk kézen, lábon * Alkalmi make up * Fülbelövés, orrbelövés, köldök-piercing behelyezés Bővebb infó a honlapomon. Várlak szeretettel!


Feladva: 2017-06-28    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: makeupmukoromGéllakksminkVárlakkézenorrbelovesNailscsoportomhozfulbelovesSzigretcsépenCsatlakozzmanikűrkezapolasbehelyezésépítéspiercingBenneteket

Forrás: pepitahirdeto.multiapro.com

Akuna Alveo gyógynövények kombinációja, mely több évtizedes kutatómunka eredményeként született meg. Összetett hatásaival bárki egészségi állapotán képes javítani, hiszen kizárólag értékes hatóanyagok találhatók benne. A méregtelenítő Alveo ital fokozza a kiválasztószervek működését, így segíti a szervezet megtisztulását. Hatására a bevitt tápanyagok jobban felszívódnak és intenzívebben érvényesíthetik előnyeiket. Mivel a benne lévő növényi összetevők fokozatosan és kíméletesen hatnak, ... további részletek >>

fogyasztása nem okoz kellemetlen mellékhatásokat a méregtelenítés során. Méregtelenítés Akuna Alveo itallal - rendelés webshopunkban! www.gyogynovenyek.megoldascsomagok.com/akuna-alveo-szolos-950ml


Feladva: 2017-02-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: AlveoAkunaitalméregtelenítőMéregtelenítésbennewebshopunkbanműködésétképesfogyasztásatöbbintenzívebbenrendeléskiválasztószervekállapotánhatnakmely

Forrás: pepitahirdeto.multiapro.com

Vállalom családi házak kivitelezését, átalakítását, felújítását, burkolást, hőszigetelést, gipszkarton szerelést, térkövezést, illetve mindennemű kőműves munkát. Hívjon bizalommal!


Feladva: 2016-10-24    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kőműveshőszigeteléstmunkákatburkolástbizalommalfelújítástHívjonátalakítástmunkátkivitelezésétházakmindenneműcsaládiilletveVállalomtérkövezéstIstván

Forrás: pepitahirdeto.multiapro.com

Fuvarozna? Fuvarozót Keres? Regisztráljon Oldalunkon még ma! Közúti fuvarozás · Szállítás és Szállíttatás · >15000 Felhasználó · Biztonságos fuvarbörze Árak | Szállításra Váró Áru | Járműkeresés | Rakományok és Járművek


Feladva: 2017-07-15    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 183megbízhatóSzállításramégÁrakOldalunkonfuvarbörzeRegisztráljonBiztonságosKeresFuvarozótFelhasználóFuvaroznaJárművek15000ajánlóRakományokHirdető

Forrás: pepitahirdeto.multiapro.com

A stressz korunk népbetegsége, melyet a rohanó életformának köszönhetünk. Oldalunkkal segítséget szeretnénk nyújtani mindazoknak, akik felismerik, hogy legfőbb érték az egészség és ennek megőrzéséért tenni is akarnak valamit. Stresszoldó technikák: www.blog.topponleszel.com


Feladva: 2017-04-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: StresszoldótechnikáknépbetegségeakikkorunkvalamitmindazoknakstresszakarnaknyújtaniTrénertenniszeretnénkElmemegőrzéséértsegítségetennekOldalunkkal

Forrás: pepitahirdeto.multiapro.com

1 órán belül ott vagyunk, nincs kiszállási díj! Hétvégén és ünnepnapon is hívhat bizalommal, nonstop! Kerti kút, szökőkút vagy akár medence bekötését is vállalunk. Megoldunk mindent: legyen az átfúrt vízcső, ázás, -csap, - mosdó vagy akár -kádcsere, vagy vizes blokk teljes generálja, hívjon bátran. Mindenre van megoldás!


Feladva: 2016-08-12    [Lakossági szolgáltatás]

Címkék, kulcsszavak: vagyakármosdószökőkútvagyunkMindenrecsapkútottbátranázásKertibelülhívjonvízcsőnonstopórángeneráljaátfúrtbizalommalBudapestteljeslegyen

Forrás: pepitahirdeto.multiapro.com

CNC állásuk van Németországban! Szerződött német partnerünk (NEM Zeitfirma) részére Mannheim közelében keresünk CNC-st aki CNC Abkanter (élhajlítógép) gépen szakrajzról tud nagyon precízen dolgozni. A feladat a CNC élhajlítógép (Trumpf) beállítása és kezelése. A munkához legalább A2-B1 némettudás szükséges. Hosszú távú munkalehetőség! (A család pár hónap utáni kiköltözését a munkáltató segíti és támogatja.) Próbamunka ideje alatt a szállás ingyen van. Sikeres próbamunka után szerződés a ... további részletek >>

céggel, szállás megoldott, kb. 300€/hó. Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1.) E-mailben: info@nemetmunka.hu 2.) Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3.) Telefonon munkaidőben a magyar 06 1 920 3433, ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9.00-17.00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-10-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: CNCnémetvagyszállásTeamMunkamailbenpróbamunkanemetmunkavanwwwélhajlítógépTelefononmegoldottdolgozni000támogatjarészéreújbólikövetkezőPersonal

Forrás: pepitahirdeto.multiapro.com

Minden típusú hőlégfúvó, bármilyen gyártmányú hőlégfúvó és mindenfajta fűtőanyagú hőlégfúvó javítása. Olcsó hőlégfúvót keres? www.olcso.holegfuvok.com


Feladva: 2015-05-06    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: hőlégfúvómindenfajtacomgyártmányúholegfuvokbármilyenolcsotípusúwwwMindenkeresHalásztelekhőlégfúvótszervizOlcsójavításafűtőanyagú

Forrás: pepitahirdeto.multiapro.com

Magas nedvszívó hatással rendelkező 130 gr-os felmosófej, zöld-fehér színben. Összetételének köszönhetően kevesebb vegyszert igényel, mégis könnyedén megbirkózik a szennyeződésekkel. Takarékos egyben hatásos is. www.szympyhygi.hu/micromix-zold-fe her-felmosofej-130g-t446987


Feladva: 2017-04-16    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: feherzoldmicromixfelmosófej130ghatássalmégisnedvszívóigényelMagasvegyszertajánlószympyhygikevesebbHirdetőwwwköszönhetőenPepitahatásosegyben

Forrás: pepitahirdeto.multiapro.com

Újdonság Magyarországon a porcelán urna, mely gránit, márvány mintával, többféle színben választható és amire az Elhunyt porcelánképe kerül. Az urna elhelyezhető kültéren, bírja az időjárás viszontagságait, de egy otthoni házi oltár dísze is lehet. Az urna üreges, talpán van a hamvak elhelyezésére szolgáló nyílás, amit a hamvak elhelyezése után ragasztással kell rögzíteni. A teljes választék megtekinthető a www.sirkokep.hu oldalon.


Feladva: 2016-07-14    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: urnahamvakbírjakellmárványüregeskültérenragasztássalgránitelhelyezhetőutánmelylehetkerülelhelyezéseporcelándíszeoldalonporcelánképeoltáramit

Forrás: pepitahirdeto.multiapro.com

Átalakítható kárpitozott autós gyerekágyak. Traktor gyerekágy, autó gyerekágy, vonat gyerekágy, dömper gyerekágy, pickup gyerekágy www.atalakulok.hu/traktor-autos-gy erek-agy


Feladva: 2016-11-12    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: gyerekágyTraktorautóssepalapickupdömpervonatautógyerekágyakkárpitozottÁtalakítható

Forrás: pepitahirdeto.multiapro.com

Tulajdonságok: - LED televízió, 40 cm (15,6”) képátlóval - USB bemenet - HD DVB-T/C közvetítés USB feljátszása - Időeltolódás funkció (Timeshift) - Multimédiás fájlok lejátszása pendrájvról - Támogatott formátumok: DivX, XviD, MP3, WMA, JPEG - Dinamikus kontraszt: 8.000:1 - Fényerő: 300 cd/m2 - Visszahatási ütemidő: 5 ms - HD READY (1366 x 768) - Beépített HD DVB-T/C (MPEG4, MPEG2) tuner - PAL, SECAM BG/DK/I/NICAM, AV bemenet i NTSC 4,43 - Képfelbontás: WXGA 1366 x 768 Px - ... további részletek >>

Látószög: 150°/150° - Elektronikus műsorkalauz (EPG) - Teletext - Több nyelvű menü - Digitális fésűs szűrő (DCF) - ZOOM - Ekvalizer - Kikapcsolás-időzítő - Automatikus kikapcsolás - Gyermekóvintézkedés - Hotel üzemmód - Kimeneti teljesítmény: 2x 3 W - VESA méretben (100 x 100 mm) - Csatlakoztatható: HDMI, SCART, AV bemenet, VGA, PC Audio bemenet, USB, CI slot - Fogyasztása készültségi üzemmódban: 20 W / 0,5 W - A készülék méretei (sz x ma x mé): 376 x 240 x 38 mm - Méretek állvánnyal (sz x ma x mé): 376 x 274 x 120 mm - Tömege (készülék/csomagolás): 1,3/2,5 kg Ugrás a televízióhoz: www.aqua.hu/sencor-sle-1660m4-156-hd-ready-led-tv-303503.html


Feladva: 2017-07-15    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: bemenetUSBledready1660m4768sleDVB3761366sencorkikapcsolás100készülék150LátószögTimeshiftKimenetiMPEG4Pepita274fésűsWMAfunkcióüzemmód

Forrás: pepitahirdeto.multiapro.com

Weboldalak üzemeltetőjeként és keresőmarketingesként biztosan kijelenthetem, hogy az internetre tartalmakat elhelyezők döntő többsége egyáltalán nem foglalkozik azzal, hogy amit készít, az megjelenjen - például a Google - keresésekben! Végeztem egy saját felmérést, ami alapján úgy tűnik, van egy általános elképzelés arról, hogy ez a kereshetőség vagy: - magától megtörténik - nem a tartalom készítőjének a feladata - a szolgáltató dolga a kereshetőség biztosítása A válaszok alapján ... további részletek >>

megdöbbentem, de ezek után egyáltalán nem csodálkozom sokak internetes eredménytelenségén... Nem szeretnék játékrontó lenni, tehát a Pepita Hirdető szabad felületei változatlanul elérhetőek lesznek még a játszadozóknak is. Azoknak azonban, akik már a játszadozáson túl vannak, jó pár lehetőséget kínálhatok ingyenesen is és több-kevesebb befektetéssel egyaránt. A legkomolyabbaknak maximum 30.000 Ft éves költséggel! Automatákkal nem, automataként viselkedőkkel szintén nem, viszont azokkal, akik jó kereshetőséget szeretnének webtartalmaiknak szívesen beszélgetek, levelezek! Fentiek alapján ez NEM FELHÍVÁS hirdetés feladására, az legyen tudatos és tervezett inkább...


Feladva: 2017-05-30    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: NEMalapjánhogyegyakikegyáltalánHirdetőPepitavagykereshetőségtudatospárdolgainternetrewebtartalmaiknakelérhetőekáltalánosbetűkkelévesinternetes

Forrás: pepitahirdeto.multiapro.com

Saját részre keresek, reális áron, kizárólag Simson Star-t! Olyant keresek, amit még érdemes felújítani! Fellelt is érdekel. Pest megye környékéről is! 0670-650-31-68


Feladva: 2018-01-05    [Autó - Motor - Jármű]

Címkék, kulcsszavak: keresekStarSimsonfelújítanirészreérdemesSajátmégBudapestamithasznált6500670OlyantkörnyékérőlmegyePestkizárólagérdekeláronFelleltreális

Forrás: pepitahirdeto.multiapro.com

Elege van a magas közös költségből? Szeretné csökkenteni kiadásait? Válassza az AXA Trend Kft. szolgáltatását! Professzionális társasházkezelés; közös képviselet; társasházak és lakásszövetkezetek jogi képviselete; könyvelés; könyvvizsgálat! Amennyiben az Ön társasháza – közgyűlési határozat alapján – szerződést köt az AXA Trend Kft. társasházkezelővel, a társasház közös képviseletére, akár 10%-al csökkenthetjük a közös költséget.


Feladva: 2015-10-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: közösKftTrendAXA8211társasházkezelésProfesszionálistársasháztársasházaszolgáltatásáttársasházkezelővelAmennyibenVálasszakönyvvizsgálatkiadásaitSzeretné

Forrás: pepitahirdeto.multiapro.com

Massive Tools Magyarország legnépszerűbb ipari felsőmarókés családja. Több mint 20 éve a hazai piacon. Ár/Minőség, legjobb. www.felsomarokes.hu és www.botex.ro Telefon: 70/3788393 További import termékeink: Csiszolószivacsok, szorítók, körfűrészlapok...


Feladva: 2017-05-22    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: botexfelsőmarókéswwwToolsMassiveiparifelsomarokeslegnépszerűbblegjobbMagyarországMinőségcsiszolószivacsokpiacontermékünkhazaiBudakesziimportéve

Forrás: pepitahirdeto.multiapro.com

A zöldárpa hatása annak köszönhető, hogy a legfontosabb tápanyagokat ideális arányban tartalmazza. Összetevői szinte azonnal felszívódnak a szervezetben, azaz rögtön hasznosulni tudnak. Az árpafű a Föld talán legegészségesebb növénye, amit nagyon ajánlott fogyasztani azoknak is, akik plusz kilóktól szeretnének megszabadulni. Mivel benne minden létfontosságú tápanyag megtalálható, a diétázók úgy táplálhatják szervezetüket, hogy közben egyetlen felesleges kalóriát sem visznek be! Nagyszerű ... további részletek >>

gyulladáscsökkentő és vérképzéshez is kitűnő. Mire jó a zöldárpa por? Még többet megtudhat róla weboldalunkon! www.zoldarpa.buzafule.net/zoldarpa


Feladva: 2017-12-07    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: zöldárpahatásahogyÖsszetevőiköszönhetőmindenpornagyonszervezetbenegyetlenannakbenneamitfelszívódnakközbenMivelMirenövényeazonnalKittikitűnő

Forrás: pepitahirdeto.multiapro.com

VENDÉGLÁTÓS állásaink Németországban: szakács, felszolgáló, szobalány, főzőasszony. SZAKÁCS végzettséggel és valamennyi némettudással, szállással és ellátással. 1800-2400€ Bruttó. FELSZOLGÁLÓ (végzettség nélkül is) Wirshausba (kocsma) 900€ nettó + borravaló (kb 1600-1800€ nettó lesz a vége), szállással és ellátással. (valamennyi némettudással-A1-től) 35 éves korig. SZOBALÁNY és konyhai kisegítő (50-50%) egy kis Panzióba ( 8 szoba van) 1000-1200 € nettó, ... további részletek >>

szállással és ellátással. (B1 némettudástól) BeiKoch – segédszakács, KUKTA- (főzőasszonyt- főzni tudó személyt keresünk) vendéglőbe valamennyi némettudással, szállással és ellátással. 1000-1200€ nettó. További infók a www.nemetmunka.hu/gastro.html weboldalunkon, ahol regisztrációs lehetőség is van. Érdeklődni munkaidőben a +36 1 920 3433 vagy a +49 8641 6949 000 vezetékes számokon lehet. Várjuk jelentkezését! Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban)


Feladva: 2017-03-26    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 8364ellátássalszállássalnettónémetnémettudássalvalamennyi1000állásainkSZOBALÁNYVENDÉGLÁTÓSFELSZOLGÁLÓTeamMunka1800SZAKÁCSvan1200számokonkonyhai

Forrás: pepitahirdeto.multiapro.com

🍀Figyelem! Figyelem!🍀 Nyitási akcióként szeretnénk megajándékozni minden kedves REGISZTRÁLT ÜGYFELÜNKET ”1” Ft-os áron választható termékekkel. Ajándék választásának feltétele: 30 000 Ft és 60 000 Ft feletti termékek megrendelése! Az ajándékok a kosárban a meghatározott összeghatár után tekinthetőek meg!🤔🤔🤔


Feladva: 2016-11-09    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 129300000PROFI127808Figyelem8221VargatermékekREGISZTRÁLTIstvánfelettikedvesSZERSZÁMPLACCmindenmegMINTfeltételemegajándékoznitekinthetőekMÁS

Forrás: pepitahirdeto.multiapro.com

Automata mosógépek, mosogatógépek, hűtőgépek, varrógépek, mikrosütők, porszívók és egyéb háztartási gépek helyszíni és szervizes javítása 1 év garanciával.


Feladva: 2015-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: FerencCsókajavításagépekháztartásiszervizeshpmosógépekhospitalszervizesAutomataelektrohelyszíniltpwwwMarcalváros840Győr350egyébTelporszívók

Forrás: pepitahirdeto.multiapro.com

Típus: Kompakt Érzékelő: 20 Mp CMOS LCD: 3.2”, 1.620.000 pont, Fix, érintőképernyő Videó: 1920×1080 (60p kép/mp) Áramforrás: Li akku + töltő (Alaptartozék) Memória: SD-XC, SD-HC, SD Optikai zoom: 25× (24 - 600 mm) optikai stab. Magyar menü, CMOS érzékelő, LCD touch, Wifi Megtekinthető: www.digifenykep.hu/canon/kompakt-p owershot-sorozat


Feladva: 2017-05-22    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: LCDérzékelőezustCMOSg9xpowershotcanonoptikaiPepitaMegtekinthetőzoomérintőképernyőWifiMemóriaFixtouchAlaptartozékponttöltő000akku6208221

Forrás: pepitahirdeto.multiapro.com

Grundig Vch 9131 2-in-1 14.4V típusú akkumulátoros porszívó. - Nagy teljesítményű és hosszú élettartamú 14,4 V-os NiMH újratölthető akkumulátor - Nagy teljesítményű elektromos kefe - Működési idő: Kb 25perc - Portartály: 500ml - Hatékony szűrőrendszer ciklontechnológiával és mosható HEPA szűrővel - Kivehető morzsaporszívó - Számlával, fél év jótállással és 14 napos pénz visszafizetési garanciával. Ingyenes házhoz szállítással megrendelhető az alábbi linken: ... további részletek >>


Feladva: 2017-09-18    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: akkumulátorosporszívó9131teljesítményűVchNagyGrundigporszivokIngyenesKivehetőakkusMűködésiházhozszűrővelkefetípusúszállítássalHEPAelektromoswww

Forrás: pepitahirdeto.multiapro.com

ELMŰ Regisztrált Villanyszerelő éjjel nappal Cégek Intézmények Társasházak és a Lakosság szolgálatában Sürgősségi hibaelhárítás Budapesten 2 órán belül Budapesttől max 50 Km-es körzetben 4 órán belül Számla-Garancia - Szakvélemény egy helyen Nonstop Hibabejelentés : 06/30-951-3828


Feladva: 2017-11-19    [Lakossági szolgáltatás]

Címkék, kulcsszavak: VillanyszerelőRegisztráltbelülóránNonstophibaelhárításELMŰSzámlaTársasházakIntézményekCégek3828körzetbennappal951maxéjjelHibabejelentésBudapesten

Forrás: pepitahirdeto.multiapro.com

Minden típusú automata váltó javítása, felújítása korrekt árakon, garanciával, kifogástalan minőségben! Vállaljuk automata sebességváltók tuningját, verseny célú átépítését, megerősítését is. Csak minőségi, megbízható anyagok felhasználásával dolgozunk! Több éve jelen vagyunk a versenysportban, jelentős tapasztalatokat gyűjtöttünk. Várjuk céges megrendelők megkeresését is! Rendszeres megrendelés esetén jelentős kedvezményeket biztosítunk a munkadíjból. További információ: Facebook: Mopar Garage


Feladva: 2016-10-21    [Autó - Motor - Jármű]

Címkék, kulcsszavak: automatajelentősváltóTovábbiVállaljukVárjukEgermegbízhatómunkadíjbólminőségbengyűjtöttünkCsabaminőségibiztosítunkkifogástalantapasztalatokatHorváth

Forrás: pepitahirdeto.multiapro.com

Költöztetés bútorszállítás Szigetköz teljes területén Költözni szeretne vagy csak egy bútordarabot elszállítatni, nos, mindkét esetben tudunk segíteni, hívjon szállítást vállalunk helyben és országosan hívjon minket bizalommal. Igény szerint tudunk biztosítani rakodószemélyzetet is, de igénybe veheti csak kizárólagosan szállítási szolgáltatásunkat is.


Feladva: 2017-01-01    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: csakterületénteljestudunkSzigetközbútorszállításKöltöztetéshívjonegyországosanvagyvehetihelybenszeretneigénybevállalunkKöltöznirakodószemélyzetet

Forrás: pepitahirdeto.multiapro.com

Berni, ez a 7 év körüli,puli nagyságú, egy kis kozmetika után minden bizonnyal nagyon széppé váló, kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a ... további részletek >>

jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagyutánSÜRGŐSgazdinakNAGYONkutyaegygazdaörökbeGYEPMESTERIkifizetniebizonnyalüzenetetnemsürgősenBekerülésükaltathatómindenhagyjeredeti

Forrás: pepitahirdeto.multiapro.com

Tavasszal és nyáron szeretnénk a kertet is élettelivé varázsolni, melyhez jól jön néhány virágos növény! A gyönyörű kékeslilás színben tündöklő törpe levendula sokak kedvence, hiszen kis méretével és illatos virágzatával a kis kertekben is mutatós! A 15-20 cm-re növő példányt nemcsak szabadföldbe, hanem akár cserépbe teraszra vagy erkélyre is ültethetjük, ezzel a panellakás is szebb lesz! Megrendelhető az Üdekert Cserje Webáruházban! www.udekert.hu/product_info.php/pr oducts_id/11912


Feladva: 2017-03-10    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: udekertCserjelevendulatörpevagykiscserépbenyáronillatosnövényakárTavasszalméretévelMegrendelhetővirágoshanemHajdúböszörményhiszenlesznéhány

Forrás: pepitahirdeto.multiapro.com

Bizonyára Ön is megbízható, jó műszaki állapotban lévő autóval szeretne közlekedni. Ehhez szükséges a rendszeres karbantartás,autóhűtő javítás, ellenőrzés és gyakran némi szak-tanácsadás autóhűtője optimális üzemeltetésével kapcsolatban. Bízza autóhűtőjét olyan szakemberekre akik az Ön biztonságán kívül az elégedettségére is pályáznak és szem előtt tartják, hogy legközelebb is minket - a minőséget - válassza! Várjuk régi és új ügyfeleinket: Érdről és a környező településekről műhelyünkbe.


Feladva: 2017-05-02    [Autó - Motor - Jármű]

Címkék, kulcsszavak: javításautóhűtőkapcsolatbanÉrdrőlkarbantartásszemBizonyáraüzemeltetésévelügyfeleinketrendszerespályáznakBrigittaoptimálisrégiszükségeselégedettségére

Forrás: pepitahirdeto.multiapro.com

Csapatom bővítéséhez keresek munkatársakat. Munka és termékreklámozás. Minden támogatást megadok, hogy sikeres légy! Ha érdekel írj emailt!


Feladva: 2017-11-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyHajosmegadokIstvannetámogatástBahnhofstraMindentermékreklámozásMunkaemailtmunkatársakatírjkeresekérdekelbővítéséhezlégyCsapatomsikeres

Forrás: pepitahirdeto.multiapro.com

Duna House, Magyarország legnagyobb ingatlanközvetítői hálózata ingatlan-tanácsadói területre várja dinamikus, aktív, kitűnően kommunikáló, sikerorientált leendő munkatársait, akik számára fontos a kiemelkedő kereseti-, a folyamatos fejlődési lehetőség és a jó csapat. A Duna House kiemelkedő infrastruktúrával, folyamatos képzésekkel, karrierprogrammal és profi háttérével kiegészülve hosszú távon segíti tanácsadóit. Tanulj egy új szakmát nálunk, nyiss magad előtt új távlatokat! Amennyiben a ... további részletek >>

lehetőség felkeltette érdeklődésed, küldd el fényképes önéletrajzod a frank.andrea@dh.hu e-mail címre


Feladva: 2017-12-11    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: HouseDunaingatlanfolyamatoskiemelkedőlehetőségsegítilegnagyobbAmennyibenkommunikálótávonMagyarországcímretávlatokatkitűnőenhosszúPontmailcsapat

Forrás: pepitahirdeto.multiapro.com

Olcsó bérautónk sokkal tisztább és biztonságosabb, mint a tömegközlekedés MÁV, Volán, BKK, BKV igénybevétele. Autókölcsönzõnk májusi akciójában Renault Clio bérautónkat napi csak 3.000,- Forintért adjuk az átvételtõl számítva 24 órára. Bérautónk www.pluszautorent.hu autókölcsönzés oldalon. Automataváltós olcsó bérautók. Autókölcsönzõnket megbízhatóság, pontosság, jellemzi. Opel Ford Suzuki, Renault, Skoda, Chevrolet bérautók jó áron. Tel: +3630 9488730 www.plusautorent.hu Car hire ... további részletek >>

in Budapest. Válasszon a tiszta, jó, szervizelt, karbantartott olcsó bérautókból. Hosszú autóbérlés esetén akár 30% kedvezmény is igénybe vehetõ. Rövidebb bérlésnél is lehet 10%, és 20% akciós árat igénybe venni. Autóbérlés Budapesten, Pest megyében és a Ferihegyi Liszt Ferenc Nemzetközi repülõtérre kiszállítással. Válasszon bérautóink közül amelyek, 3, 4, 5, 6, 7 személyes, klímás, automata vagy kézi váltós, személyautó vagy kis tehergépkocsi, Kicsi economy, nagy luxus bérautók kölcsönzése. Bérelhetõ autótípusok Opel Corsa C 1.2, a hölgyek kedvenc bérautója. Kicsi helyre is könnyû parkolni vele. Suzuki Ignis 1.3, erõs fürge, pörgõs bérautó. Opel Vectra B 1.6 automata váltós, nagy 4 ajtós kölcsönautó. Ford Focus C-MAX 1.6 HDI Dízel fokozatmentes automataváltós CVT, egyterû. Nagyon alacsony a fogyasztása. Autókölcsönzõ Magyarországon kiszállítással. Suzuki Swift 1.3, a MI autónk a magyarok kedvence. A legolcsóbb bérautó klíma nélkül. Renault Clio 1.4, erõs 74 kw-os motorral.Renault Scenic1.6 Automataváltós egyterû bérautó. Kombi van. Opel Vectra C 2.2 nagy 114 kw szedan, erõ és biztonság jellemzi. Gépjármûkölcsönzés 1992-tõl. Chevrolet Aveo 1.2 kicsi gazdaságos, ezüst bérautó. 5 személyes. Skoda Fabia 1.2 Benzin Gáz LPG üzemû, hatchback 5 ajtós. Személyautó bérbeadás. Opel Vivaro 1.9 dízel 6 személyes kisteherautó. Az ülések gyorsan, könnyedén kiszedhetõek, így a rakodó tér kétszeresére növelhetõ. B személygépkocsi jogosítvánnyal vezethetõ. Renault Espace 2.2 dízel automata váltós 7 személyes bérautó. Klíma, cd tár, navigáció stb. A felsorolás nem teljes kérem, nézze meg a www.plusautorent.hu autókölcsönzõ weboldalunkat is.


Feladva: 2017-12-09    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 245251RenaultOpelbérautóautókölcsönzszemélyesolcsóSuzukiAutomataváltóskiszállítássalwwwAutóbérlésbérautókváltósnagyautomatakicsidízelChevrolet

Forrás: pepitahirdeto.multiapro.com

Bontási és kőműves munkákkal foglalkozom. Felújítandó lakások és más helységekben, továbbá családi házakban stb... Falak, burkolatok nyílászárók kibontásával panel lakásokban is. Fűtés és gépészet megszüntetése radiátorok és csövek lebontása. Kádak, zuhanytálcák megszüntetése. Szaniterek és csaptelepek leszerelése. Fém szerkezetek bontása és épület bontás. Válaszfalak építése és vakolása aljzatbetonozás. Kisebb javító és helyreállító munkálatokat is elvégzem. Budapesten és környékén.


Feladva: 2016-11-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megszüntetésebontáskőművesleszereléseXIXlakásokbanGáborKisebbmáscsaptelepekXVIIIpanelNovákaljzatbetonozáslakásokSzaniterekXVIIkibontásávalXVI

Forrás: pepitahirdeto.multiapro.com

Minden nap 1x, ha belépsz a weboldalra, 200 TP Tőzsdearanypontot írunk jóvá. Pénzt kereshetsz: Rendszeres használattal (pl.: 3 nap belépése után, extra kuponkód, + kitüntetés) Tőzsdei tartalom elolvasásával, (KuponKód feltöltéssel, vagy automatikusan) Tanulással, videó megnézésével, online, illetve személyes rendezvényeinken, tanfolyamainkon való részvétellel. Promóciókban való segítséggel Facebook - Like & Megosztási aktivitással Meghívási aktivitással (Erre több lehetőség is van)


Feladva: 2015-01-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: valónapKuponKódaktivitássalszemélyestartalomMeghívásiTőzsdearanypontotilletveTőzsdeiMegosztási200onlinekitüntetésLikeweboldalramegnézésévelextra

Forrás: pepitahirdeto.multiapro.com

Festmény a léleknek, a lélek festőjétől. Tisza-Kalmár György festménye A festmény címe: Távolban Méret: 18 x 24 cm Anyag: olaj vásznon A ragyogó fehér gyöngyház és a kék különböző árnyalatai adnak erős expresszív hatást a képnek. A festék néhol vastagon került a vászonra, a felületnek gazdag képi struktúrát kölcsönözve. Amennyiben különleges alkotást szeretne, ez a festmény kis mérete ellenére a részletek gazdagságával nagy élményt nyújt. ... további részletek >>

www.tisza-kalmar.hu/index.php/galeria/40-kis-festmenyek/113-olaj-festmeny-1 A festményt személyesen át lehet venni Egyházashetyén (Vas megye, Sárvár közelében), vagy futárszolgálat kézbesíti a megadott címre.


Feladva: 2016-09-15    [Régiség - Művészet]

Címkék, kulcsszavak: festmenyolajkisfestményeGyörgyKalmártiszawwwragyogófutárszolgálatAmennyibenléleknekképneknyújtvásznonvagykölcsönözveEgyházashetyehatástélményt

Forrás: pepitahirdeto.multiapro.com

Főbb kínálatunk: OMNITRONIC / PSSO dj – stúdió – hangtechnika ::: EUROLTE / FUTURELIGHT látvány – fénytechnika ::: DIMAVERY hangszerek ::: ALUTRUSS traverz ::: OMNILUX fényforrások ::: ROADINGER rack gyártás ::: EUROPALMS műnövények – dekoráció. Nálunk közel 10.000 termék közül válogathat. A megfelelő termékek kiválasztását fotók, videók, részletes termék leírások és pontos méretek segítik. Tekintse meg kínálatunkat... www.showtechnic.hu


Feladva: 2016-12-04    [Zene - Hangszer]

Címkék, kulcsszavak: showtechnictermék2003HUNGARYrackOMNILUXpontosPSSO000traverzleírásokOMNITRONICközelALUTRUSSkínálatunkNálunkhangszerekrészletesFőbbdekorációker

Forrás: pepitahirdeto.multiapro.com

Minőségi hőpapírok széles választékban a legkisebbtől a legnagyobb méretig. Palettánkon biztosan megtalálja pénztárgépéhez, vagy nyomtatójához a megfelelőt. Tekintse meg kínálatunkat honlapunkon!


Feladva: 2016-01-04    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: választékbantekercsmegfelelőtszélesnyomtatónyomtatójáhozhőpapírokHőpapírvagyMinőségipénztárgépéhezkermegtaláljaXIIIbiztosanBudapestPalettánkonKft

Forrás: pepitahirdeto.multiapro.com

Egerszalók Gyógy- és Wellnessfürdő, Strandfürdő, Demjéni Termál-völgy. Egerszalóki panziók, hotelek. Mi bemutatjuk, hogy hol és melyik hotelben, panzióban érdemes megszállni Egerszalókon, Demjénben.


Feladva: 2015-08-25    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: EgerszalókhotelbenDemjénimelyikStrandfürdőholWellnessfürdőhogyGyógybemutatjukegerszalokinfogézaDemjénbenwwwbannerEgerszalókonhotelekszálláshelyei

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés Budapest minden kerületébe és Pest megye több településére is lehetséges nálunk! 10 éves tapasztalattal várjuk hívását, ha sitt szállítást, zöldhulaldék vagy háztartási szemét elszállítását szeretné hatékonyan megoldani! A konténer rendelés szemét és sitt számára nálunk 1 perc alatt lebonyolítható! Telefonon, emailen és a weboldalunkon található űrlapon keresztül is leadhatja rendelését! 1 munkanapon belül leszállítjuk a hulladékgyűjtőt az Ön által megjelölt címre! Kisebb ... további részletek >>

felújításokhoz, kerti munkákhoz és építkezésekhez, bontásokhoz is van megfelelő méretű konténerünk! Konténer rendelés Budapest!


Feladva: 2017-08-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: rendelésKonténernálunkBudapestsittszemétstoptalálhatókonténerünkmegoldaniévesmegjelöltnonweboldalunkonméretűhatékonyanlehetségesáltalemailenvan

Forrás: pepitahirdeto.multiapro.com

Amennyiben Önnek, vagy a cégének jogi problémája az alábbiak valamelyikével összefügg, keressen bizalommal! Gazdasági jog: - gazdasági társaságok alapítása, működésükkel kapcsolatos ügyek, egyéb cégjogi kérdések - cégek szerződéses vitái, cégek közötti kártérítéses ügyek - csőd, felszámolás Munkajog: - munkaviszonnyal kapcsolatos ügyek Polgári jog: - szerződésekkel kapcsolatos ügyek - szerződéskötés, azok teljesítésével kapcsolatos problémák, szerződések megszüntetése stb... - ... további részletek >>

ingatlan adásvételi szerződések - öröklés - tulajdonjog - kártérítés - élettársi kapcsolatokkal összefüggő kérdések, vagyoni viszonyok Családjog: - válás - gyermek elhelyezés - házassági vagyonjog Büntetőjog: - gazdasági, illetve vagyon elleni bűncselekmények Sportjog: - átigazolási és fegyelmi ügyek, ezekhez kapcsolódó speciális munkajogi kérdések, hivatásos és amatőr szerződések - sportszervezetek alapításával, működésével kapcsolatos ügyek - szponzorálási és arculat-átviteli szerződések


Feladva: 2017-07-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ügyekkapcsolatosszerződésekkérdésekgazdaságijogbizalommalcégekszerződéseselhelyezésvalamelyikévelezekhezadásvételiHirdetőátviteliházasságialábbiak

Forrás: pepitahirdeto.multiapro.com

Új Kocsik Érkeztek!!! Most Több Darabból Választhat! Téliesített, Kiváló Állapotban Lévő Büfékocsi Berendezéssel Együtt Kiadó! Rendelkezik a szükséges szakhatósági engedélyekkel, személyautóval, B-s jogosítvánnyal kényelmesen vontatható, azonnal munkára fogható! A bérléshez 1 havi bérleti díjnak megfelelő kaució szükséges! Külföldi használat esetén a bérleti díj havi 400,- Euró, a kaució pedig Magyarországtól való távolságtól függ! Egész Szezonra Történő Bérlés, és előre fizetés esetén ... további részletek >>

díjkedvezményt biztosítunk! Büfékocsi Kölcsönző Eger, A Legjobb Feltételekkel!!! Nyitva: H-P: 08-16:30; SZ: 08-12; V: Zárva Kérem a fenti időpontokban érdeklődjenek!!! Kérem tekintse meg honlapunkat!


Feladva: 2016-10-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BüfékocsibérletiKölcsönzőKéremszükségeseseténkaucióBérléshaviEgerEgészÁllapotbanmegkényelmesenfüggKiválótekintsehasználatjogosítvánnyalKülföldi

Forrás: pepitahirdeto.multiapro.com

A magyar fejlesztésű és gyártású KREA gravitációs kéményrendszer a családi házak ideális kéménye. A kéménybe beköthető bármikor szilárd tüzelésű (cserép) kályha, kandalló, vagy akár kazán. Alkalmas atmoszférikus gázkészülékek füstgáz elvezetésére is, de megfelelő kiegészítőkkel egyszerűen és olcsón alkalmassá tehető turbós, ezen belül kondenzációs kazánok füstgáz elvezetésére égéslevegő ellátással együtt. Kedvező ár, hosszú élettartam, Kivitelezése egyszerű, akár saját kezűleg is elvégezhető. A ... további részletek >>

termékre 30 év garanciát vállalunk. A műszaki dokumentációk megtalálhatóak a Szegedi Székhelyünk és a Dunántúli Telephelyünk honlapjain! Országos házhoz szállítás : 12 000 Ft. Magyar Kéménygyártó Kft. Tüzeléstechnikai szaküzlet 8638 Balatonlelle, Kossuth Lajos utca 50/A Nyitva : H-P 8.00-16.00-ig. Tel.: 0630/8492544 www.kemenygyarto-balatonlelle.hu www.kemenygyarto.hu


Feladva: 2016-08-19    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: balatonlellekemenygyartoelvezetéséreKREAwwwfüstgázakárMagyardokumentációkAlkalmasélettartamkéményeTel000ezeneladóműszakikazánhosszúideálisKft

Forrás: pepitahirdeto.multiapro.com

-AKCIÓS SERTÉSHÚS ÁRAK !- Sertéscomb ár : 890 Ft/kg Sertéslapocka ár : 880 Ft/kg Sertéskaraj ár : 890 Ft/kg Sertésoldalas ár : 880 Ft/kg Sertésdagadó ár : 880 Ft/kg Sertéstarja ár : 880 Ft/kg Sertéscsülök ár : 690 Ft/kg Budapest 1113.Bocskai út 42 sz. --- Telefon:061/3611-609 --- Web: www.lazarhus.hu Email: lazarhusmintabolt@gmail.com< /a>


Feladva: 2016-08-16    [
Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: 880BudapestÁRAKSERTÉSHÚSAKCIÓS890Email690lazarhusSertéscsülökwwwÉlelmiszerWebSertéstarjaHús609SertésdagadóLázár3611SertésoldalasBudapesten

Forrás: pepitahirdeto.multiapro.com

Víz, gáz és duguláselhárítás Budapest és környékén. Mi a Fűtésszerelő Mesternél úgy kívánjuk végezni tevékenységünket, hogy boldogan és büszkén tekinthessünk vissza elégedet ügyfeleink hosszú sorára. Több, mint 20 éve a szakmában vagyunk és már mindenféle meghibásodással találkoztunk ennyi idő alatt. Tudjuk honnan szerezzük be a legjobb alkatrészeket, tudjuk milyen típushibákkal találkozhatunk. Egy szóval: fel vagyunk készülve mindenre. Szakembereinktől ugyanezt várjuk el. Kizárólag magasan ... további részletek >>

képzett, sok éves tapasztalattal rendelkezdő munkatársakkal dolgozunk és felkutattuk a legjobb minőségű alkatrészeket, hogy a piacon elérhető legjobb minőségű szolgáltatást tudjuk biztosítani. Ennek köszönhetjük, hogy több tízezer elégedett ügyfelet tudhatunk ma magunk mögött. Ha elvégeztük a munkát, akkor bátran biztosítjuk a garanciát, mert tudjuk, hogy nem lehet semmi baja. Ha ön is szeretné biztonságba érezni magát nincs más dolga, mint tárcsázni a +36 (20) 238 57 20 telefonszámot és segítséget kérni. Akár azonnali kiszállással megoldjuk bármilyen meghibásodást is tapasztalt.


Feladva: 2017-07-23    [Lakossági szolgáltatás]

Címkék, kulcsszavak: hogytudjuklegjobbgázVízalkatrészekettöbbvagyunkBudapestmintminőségűduguláselhárításképzettbüszkénmegoldjuktudhatunkEgymáselérhetőmindenféle

Forrás: pepitahirdeto.multiapro.com

Szeretne gyorsan weblapot? Kínálatunkban előzetesen megtekinthető, kattintható kész weblapok közül válogathat. Jelenleg 50 különböző kész weblap közül tud választani. De van itt még valami ... Bevezető akciónk keretében most reklám és látogató növelő szolgáltatást is biztosítunk minden olyan weblap megrendelőnknek, aki lakosságnak szolgáltat, vagy értékesít és a rendelésével eléri a 20.000 Ft-ot akár egy összegben, akár a második negyedéves díj befizetése után.


Feladva: 2017-10-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: mégakárweboldalaweblapnincsÖnnekközülkészakiSzeretnekeretébenkülönbözőmegrendelőnknekakciónkösszegbenJelenlegBevezetőegyválogathatolyanvalami

Forrás: pepitahirdeto.multiapro.com

Szeretnél egy szép tetoválást? Vagy egy régebbit javíttatnál ki? Igen? Akkor válaszd a Zen Tattoot Győrben!


Feladva: 2017-06-15    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: GyőrZenegyvagytetoválástszépGyőrbenSzeretnélTattootBarbaraválaszfotórólAkkorRajzolásjavíttatnálPortrérégebbitTetoválás

Forrás: pepitahirdeto.multiapro.com

Prezídium az igényes, és biztonságos hevederzár. Minden ajtóra felszerelhető, Rotó, Abus, vagy Mauer betéttel szereljük, árusítjuk. Egyedi méretben is kapható. A cilinderbetétet speciális felfogatása miatt törés és maghúzás ellen is védett. A zár a rudazatot mind a két irányban 110mm hosszon kitolja. Gordiusz pajzzsal dupla védelem (www.gordiuszpajzs.hu).


Feladva: 2015-10-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: hevederzárGordiuszbiztonságospajzzsalellenszereljükigényesmaghúzásbetéttelPrezídiumkitoljatörésMauerhosszonBudapestmiattvagy110mmPéterAbuskét

Forrás: pepitahirdeto.multiapro.com

Mindennemű régiség felvásárlása azonnali készpénz fizetéssel: antik bútor, festmény, szőnyeg, szobor (fa, bronz), óra,(kar, asztali és fali álló), ezüst tárgy, (gyertyatartó, cukordoboz, tálca, evőeszköz, hiányos is) porcelán (Herendi, Zsolnay, Meissen) arany ékszer (fél drága, drágaköves, törtarany is), csillár (asztali, álló, fali lámpa) zongora, régi tv, rádió, bélyeg, kitüntetés, képeslap, írógép, varrógép! Lakásokat, házakat hagyatékkal együtt is megvásárolunk! Cim: BP. 1137. SZENT ... további részletek >>

ISTVÁN KRT. 12 ARANY-EZÜST VÉTEL: NE ADJA EL ÉKSZEREIT TÖRT ARANY ÁRBAN, MERT MI FAZONARANYKÉNT MAGASABB ÁRON MEGVÁSÁROLJUK ÖNTŐL, TOVÁBBÁ ÜZLETÜNK VILÁGPIACI ÁR FÖLÖTT VÁSÁROL TÖRT ARANYAT, BEFEKTETÉSI ÉRMÉT, FOGARANYAT, ILLETVE BÁRMILYEN ARANYAT, KARÁTSZÁMTÓL ÉS MENNYISÉGTŐL FÜGGETLENÜL!!! BUDAPESTEN ÉS VIDÉKEN IS. A KISZÁLLÁS DÍJTALAN. Tel.: 06702862076,


Feladva: 2017-09-22    [Régiség - Művészet]

Címkék, kulcsszavak: ARANYTÖRTARANYATfaliállóEZÜSTasztaliantikVIDÉKEN1137cukordobozbélyegfizetésselMERTdrágaBUDAPESTENCimgyertyatartóVÁSÁROLrádiókészpénzÁRBAN

Forrás: pepitahirdeto.multiapro.com

Otthonról is végezhető munkát keresel, de nem tudod fog-e menni? Egy hónap elég lenne, hogy kipróbáld magad? Mit szólnál egy harminc napos ingyenes próbához? Ráadásul egy automata eszköz elvégzi a munka nehezét helyetted. Megkeresi azokat, akiket érdekel az ajánlatod, és bemutatja nekik. Ne töprengj, hanem vágj bele most azonnal. Csatlakozz, és már kezdheted is. Még regisztrációs díjat sem kell fizetned. A cég napi fogyasztási cikkekkel foglalkozik, tehát biztos a kereslet. A jutalékod miatt ... további részletek >>

sem kell aggódnod, mert megkapod forintban. A videókból mindent megtudhatsz. Mutasd meg ismerőseidnek, milyen remek lehetőséget találtál, még mielőtt ők mutatják neked ugyanezt. Katt ide és nézd meg a videókat! => http://bit.ly/tesikered


Feladva: 2017-10-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: megegysemkellcégszólnálmilyenhanemnemmunkanézdfizetnedMitismerőseidnektöprengjkereselmiattelvégziidedíjatmagadMutasdnekikmunkáteszköz

Forrás: pepitahirdeto.multiapro.com

Barbi, ez a 1,5 év körüli,közepes nagyságú szuka kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: 06 ... további részletek >>

70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagyörökbeBarbikutyagazdaGYEPMESTERISÜRGŐSgazdinakNAGYONaltathatóhagyjeredetijövendőbelijelentkezésétjelentkezéseazonnalÓzdtürelmesadhatók

Forrás: pepitahirdeto.multiapro.com

Elégedetlen a könyvelőjével? Új vállalkozást tervez? Adótanácsadásra van szüksége? Ne késlekedjen, keressen bennünket! Szombathely belvárosában több mint 15 éves szakmai tapasztalattal, valamint ügyvédi és könyvvizsgálói háttér biztosításával várjuk leendő megrendelőink jelentkezését Szombathely agglomerációs körzetéből is. Ügyfeleink igénye esetén a könyvelési anyagok a vállalkozás telephelyén történő átadása lehetséges. Teljes körű számviteli szolgáltatás ellátását vállaljuk egyéni ... további részletek >>

vállalkozók, Kkt-k, Bt-k, Kft-k, Rt-k, részére.


Feladva: 2016-10-05    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzombathelyszolgáltatásszámvitelikörűTeljesKftegyénimintkönyvelőjévelvállalkozásleendőtöbbvállaljukElégedetlenanyagokvárjukbelvárosábanellátását

Forrás: pepitahirdeto.multiapro.com

Mérleges adagoló gép eladó, az Ön igényei szerint! Poros, szemcsés vagy kisebb darabos áru (morzsa, száraztészta, magvak, stb.) adagolására, csomagolására alkalmas adagoló gép eladó. www.gepetgyartok.hu/adagolo1.htm Írja meg igényeit, és kérjen árajánlatot e-mailben! Elérhetőség: Kálmán László 6791 Szeged, Negyvennyolcas u. 49. Tel.: 30/604-5453 www.gepetgyartok.hu


Feladva: 2016-07-11    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: gépadagolóSzegedLászlóeladóKálmángepetgyartokwwwhtmmorzsa6791adagolo1árudaraboskisebbElérhetőségvagymailbenalkalmasszemcsésárajánlatot5453

Forrás: pepitahirdeto.multiapro.com

Már 24 féle hangulat-színváltós nyaklánc közül választhat a legjobb áron a Lili Bizsu Webáruházban: www.lilibizsu.hu/lista/58835b20cxx 3c-HANGULAT-SZINVALTOS Házhoz szállítás már 650 Ft-tól, akár ingyenesen is


Feladva: 2017-10-22    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: színváltóshangulatBizsuLilimárszállításnyakláncHázhozlilibizsuwwwféleWebáruházbanWEBÁRUHÁZnyakláncokingyenesenakárárontóllegjobb650Ftközül

Forrás: pepitahirdeto.multiapro.com

Sírkő és sírkő kellék webáruház. Kizárólag hazai gyártású sírkövek az ország első webáruházában.


Feladva: 2017-07-14    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: sírkőwebáruházwebáruházábanHirdetőelsőPepitaországsírkövekgyártásúhazaiKizárólagkellékajánló

Forrás: pepitahirdeto.multiapro.com

Legújabb digitális festékrétegmérő készülékünk az elmatronic F/NF HANDY. Nagyméretű LCD kijelzője könnyedén leolvasható, sőt a FLIP DISPLAY szolgáltatásnak köszönhetően az LCD kijelzőn megjelenő információk egy gombnyomással 180 fokban megfordíthatóak. Így a mérési eredmények minden esetben kényelmesen olvashatóak. Beépített mérőszonda, automatikus alapanyag felismeréssel. Gyors mérési sebesség, rendkívül egyszerű kalibrálás! 1 évgarancia! Magyar nyelvű használati útmutató! Áfás számla! ... további részletek >>

Szállítás raktárról azonnal! Ár: 49.000.-Ft Bruttó! Honlap: www.elmatronic.webnode.hu/products/elmatronic-f-nf-handy-digitalis-retegmero-keszulek


Feladva: 2017-02-26    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elmatronichandyLCDmérésifestékrétegmérődigitáliskeszulekdigitalisesetbenSzállításkijelzőnsebességkészülékünkmindenszámlaeredményekÁfásköszönhetően

Forrás: pepitahirdeto.multiapro.com

Béreljen riasztó rendszert és 3 év után az öné! Vagy válasszon akciós csomagjaink közül! Telepítéseinket az egész ország területén végezzük!


Feladva: 2016-10-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: riasztóSzolnokközülFerenccsomagjainkSzekeresakciósbefektetésselválasszonkisVagyrendszerönéutánrendszert5322126Béreljenriasztotgyorsan

Forrás: pepitahirdeto.multiapro.com

Interaktív eszperantó tanfolyam, nulláról az eszperantó nyelvvizsgáig – hanganyaggal, gyakorlatokkal, házi feladatokkal. NEM zsákbamacska, próbáld ki az első leckét! . Budapesti Eszperantó Központ, www.eszperanto-online.hu/elso-leck e.htm


Feladva: 2017-03-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: EszperantótanfolyamwwwgyakorlatokkalKözponthanganyaggal8211BudapestinyelvvizsgáigleckétnullárólelsőpróbáldInteraktívzsákbamacskaLászlóNEMSzilvási

Forrás: pepitahirdeto.multiapro.com

A jó weboldal olyan mint maga a cég, első ránézésre a minőséget és magát a minőségi márkát adja vissza a látogatónak. És ezt mi pontosan tudjuk! Weboldal készítés 2 év garanciával! Olvasd el, hogyan dolgozunk, és kérj tőlünk konzultációs időpontot!


Feladva: 2016-09-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: WeboldalgaranciávalkészítésWebstartconsultinghogyanmárkátOlvasdminőségimagátminőségetránézésretudjukelsőidőpontotpontosancégkonzultációseztmaga

Forrás: pepitahirdeto.multiapro.com

Nem árulok zsákbamacskát, sem ”legyél milliomos fél nap alatt” című e-könyveket sem. Egyszerű, bárki által könnyen érthető, INGYENES és fizető oldalakra szeretném a hangsúlyt fektetni. Egészítse ki a fizetését, keressen pénzt az interneten! Maximalizálja a profitot és költse arra amire szeretné! Látogasson el a blogoldalamra!


Feladva: 2017-05-31    [Pénzkeresés - MLM]

Címkék, kulcsszavak: sem8221félpénztkönnyenmilliomoskeressenáltalblogoldalamralegyélfizetésétbárkiLátogassonzsákbamacskátEgészítseEgyszerűszeretnéárulokfektetniNem

Forrás: pepitahirdeto.multiapro.com

Új és használt Xbox és PlayStation játékok a legjobb árakon!


Feladva: 2017-07-12    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: játékokPlayStationXboxhasználtajánlóHirdetőPepitaGamersRoomárakonlegjobb

Forrás: pepitahirdeto.multiapro.com

Születésnap? Évforduló? Esküvő? Sütiben, tortában a Várfok Cuki a nyerő! Sütemények, torták, sós és édes finomságok, fagylaltok, jégkása, üdítő, tea és kávé különlegességek! Előrendelést telefonon is felveszünk!


Feladva: 2017-07-11    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: VárfokjégkásaSütibenfagylaltokEsküvőfinomságokÉvfordulóédesSzületésnapfelveszünksósBudapesttelefonontortákajánlóElőrendeléstSüteményekHirdetőkávé

Forrás: pepitahirdeto.multiapro.com

Android mobilalkalmazás programozókat keresünk Debrecenbe, akik annyira elhivatottak a programozás iránt, hogy már zöldülnek #A4C739 kód szerint és növekszik a robot antennájuk. Ha még nem tartasz itt, akkor is jelentkezz, mert ki tudjuk mutatni jó úton haladsz-e a folyamatban. Elõny, ha már a Google Play-en is van fent app-od, amit magadtól, nem céges nyomásra készítettél. További információ a www.jobs.ozeki.hu/index.php?owpn=5 4 oldalon.


Feladva: 2016-06-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: márnemozekiAndroidKfttartasznyomásraprogramozás245fejlesztőoldalonmégcégeselhivatottakfolyamatbanowpnantennájukannyirahaladszphprobotakik

Forrás: pepitahirdeto.multiapro.com

AcPumPa azonnali országos kiszállítással, Budapesten 1-2 órán belül, vidéken 24 órán belül átvehető. AC pumpa tankon belül, AC pumpa tankon kívül, elektromos üzemanyag szivattyú 5200 autóhoz, és munkagéphez, raktárról non-stop működő webshopunkból. Telefonos érdeklődés napközben 8-18 óra között. „Velünk biztosan újra indul”


Feladva: 2015-05-04    [Autó - Motor - Jármű]

Címkék, kulcsszavak: acpumpabelülAzonnaltankonóránüzemanyagszívattyúbiztosanOrszágosacpumpawebshopelektromosVelünkwwwkívül8222kerwebshopunkbólközöttXVIIImüködő18h

Forrás: pepitahirdeto.multiapro.com

Könyvkötés, könyvjavítás, valódi BŐRKÖTÉS. Egyedi ajándékok készítése. SZAKDOLGOZAT, SOS felár hélkül! Diploma, bekötése előrendeléssel megvárható. Nyomtatás színes lézerrel. Fénymásolás, spirálozás, riccelés, aranyozás, bélyegző, dombornyomó készítés.


Feladva: 2014-03-17    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: NyomtatásKönyvkötésSZAKDOLGOZATkészítéseLászlószínesajándékokKunEgyedimegvárhatóBŐRKÖTÉSkészítéselőrendelésselvalódidombornyomóbekötésekönyvjavítás

Forrás: pepitahirdeto.multiapro.com

Gázmegtakarítás 12-15%. Turbo Booster Gázfogyasztás csökkentő. ÁRA FÉL ÉV ALATT MEGTÉRÜL, utána folyamatos megtakarítás! Hivatalos engedéllyel! Bemérések és beszerelési útmutató a honlapunkon! www.patikamagazin.eu/?modul=oldal& tartalom=1205809


Feladva: 2015-11-05    [Vegyes hirdetések]

Címkék, kulcsszavak: GázmegtakarításfolyamatosBudapestmeregtelenitesutánaNEODYUMwwwMEGTÉRÜLhttpALATThonlapunkonFÉLútmutatóÁRAbeszerelésicsökkentőbemérésekGázfogyasztás

Forrás: pepitahirdeto.multiapro.com

Ha ön egy sok éven át használható és kényelmes garnitúrát szeretne prémium minőségben, jó helyen keresi! Egy szék ára 8000 Ft. Bármennyi készíthető és az asztal mérete és formája is változhat igény szerint, ha egy más garnitúrát szeretne. Új állapotban 2 év garanciát adok rá. Könnyen szállítható, mert egyszerűen szétszerelhető. A garnitúra ára lecsiszolt állapotban, festésre készen értendő, mindenki igényei szerint festheti akár, de megegyezés szerint le is festhetem. Kiszállítás is ... további részletek >>

megoldható.


Feladva: 2017-07-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: szerintegyállapotbanszeretnegarnitúrátáragarnitúramegoldhatókészíthetőfestésresokgaranciátKiszállításBármennyiprolignumfesthetem8000lecsiszoltmás

Forrás: pepitahirdeto.multiapro.com

Szeretne vállalkozóként az USA-ban élni, esetleg családostól letelepedni? Tanácsainkkal ez megoldható! Mi a vállalkozásokért dolgozunk, őket segítjük. Kérjen segítséget. Nem bánja meg! Ajánlati szám: VSZ/00158/16/07


Feladva: 2017-12-01    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzeretneVSZélniUSAőketvállalkozóként00158dolgozunkvállalkozásokértÁllamokbanszámmegoldhatóEgyesültAjánlatiTanácsainkkalmegletelepednibánjaNem

Forrás: pepitahirdeto.multiapro.com

Gordiusz zárvédő pajzs. Saját szabadalom. Amikor az interneten megvehető, majdnem minden zártípushoz a nyitó szerszám, ez a pajzs megbízhatóan véd minden nyitási módszer ellen. Külön zárszerkezet, az ajtó külső oldalára szerelve a zár kulcsnyílásának védelmére szolgál. Variációk száma 6000000. Nem kell pénzt költenie, drága betétekre, amiket utólag kívülről könnyű megrongálni. Házilag is felszerelhető, ha van korszerűtlen, vagy gyenge minőségű hevederzára, páncélajtója.


Feladva: 2015-10-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: pajzsGordiuszmindenzárvédőkellkülsőHázilagszerszámBudapestNemajtómegrongálninyitóPéter6000000zárszerkezetkönnyűzártípushozKnappszámaKülön

Forrás: pepitahirdeto.multiapro.com

Egyedileg válogatott, magas minőségű gyerekruhák piciknek és nagyoknak. Örök méretgaranciával, akár ingyenes szállítással. A Facebookon is megtalálsz, keresd: Ruhacuka


Feladva: 2017-09-29    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: RuhacukaHasználtHirdetőakárajánlásingyenesEgyedilegszállítássalválogatottFacebookonmagasmegtalálszminőségűkeresdwebáruházgyerekruhákpiciknekÖrök

Forrás: pepitahirdeto.multiapro.com

4 izgalmas minta a gyerekszobába, kicsiknek és nagyoknak! Az új Star Wars & Velux Galactic Night Collection tetőtéri ablakokra szerelhető fényzáró rolóit Jedi lovagoknak és a galaktikus kalandoroknak terveztük, mindenki megtalálja köztük a kedvencét. A Star Wars & Velux Galactic Night Collection a tetőtéri ablakok üvegfelületét egy űrbéli kaland hátterévé varázsolja, így a kis hősök éjjel-nappal kedvenceikkel lehetnek. A Star Wars & Velux Galactic Night Collection segít abban, hogy a ... további részletek >>

gyerekszoba kis Jedi lovagja gyorsan álomba szenderüljön és utazását messzi-messzi galaxisokban folytassa. Kérjen árajánlatot online: www.farmtuzep.hu/star-wars-velux-galactic-night-collection


Feladva: 2017-09-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: veluxwarsstarnightgalacticcollectionmesszifényzárótetőtériJedikishogymintakalandgalaxisokbankalandoroknakabbanizgalmasűrbéligalaktikussegít

Forrás: pepitahirdeto.multiapro.com

Azok számára állítottuk össze kezdő csomagjainkat, akik most vágnak bele a kisállat tartásba. A csomag tartalmaz minden, a felelős állattartáshoz szükséges kelléket. A Cavie 60 a Ferplast több éves fejlesztése. Strapabíró, praktikus és rendkívül esztétikus tengerimalac ketrec. Magas peremmel rendelkezik, így a kiszemetelés esélye minimális. Tálcája erős minőségi műanyagból készül, tisztán tartása könnyű. A csomag tartalmazza: -Felszerelt Cavie 60 ketrec /1db 300ml-es csepegésmentes ... további részletek >>

önitató, 1db szénarács/ -Fogkoptató kő /Panzi,55gr/ -Tengerimalac eledel /Panzi, 1000ml/ -Réti széna /350g/-Fenyőforgács /5L/ Színekről érdeklődjön elérhetőségeinken.


Feladva: 2017-09-18    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: tengerimalacketrecCaviePanzicsomag1dbtengerimalacnakkezdocsomagmindenerősállítottukkisallatokpraktikus1000mltartalmazTálcájaszámárawebshopAzok

Forrás: pepitahirdeto.multiapro.com

Rutinos számítógép szerelőt keres? Megtalálta. Számítógép szerviz Budapest egész területén házhoz megy. Amit vállalok: számítógép javítás, szerelés, karbantartás, amennyiben megoldható, bővítés, korszerűsítés. Nem csak asztali számítógépet, hanem laptopot is szervizelek. Ha meglévő gépét szeretné lecserélni, akkor a számítógép vásárlásban is megbízható partnere lehetek. Ne habozzon, tekintse meg weboldalamat a további részletekért és minél hamarabb kérjen ajánlatot.


Feladva: 2016-06-22    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: számítógépszervizBudapestterületénArnoldrészletekértmegyakkorteljesNemtovábbiházhozlecserélnikorszerűsítésweboldalamatszeretnébővítésmegegész

Forrás: pepitahirdeto.multiapro.com

Mit szólnál egy olyan lehetőséghez ahol minden pénteken kapnál fizetést? Ne várj a csodára mert a csoda nem létezik, inkább próbáld ki magad és meglátod milyen gyorsan helyre tudod hozni az anyagi helyzetedet. Jelentkezz itt és kapod utána az információt: www.dolgozzazinterneten.wordpress. com


Feladva: 2017-08-15    [Pénzkeresés - MLM]

Címkék, kulcsszavak: csodáravárjléteziklehetőséghezanyaginemcomolyanhoznicsodawordpressegytudodmertdolgozzazinternetenszólnálhelyrehttpsMitgyorsaninformációtSom

Forrás: pepitahirdeto.multiapro.com

Az utóbbi öt évben, négy kivételével, az összes tanítványom vizsgája sikerült, de korábban se volt rosszabb az arány 98%-nál. Matematika, mechanika, géptan, fizika, anyagtudomány, mechatronika, gazdasági matematika, analízis, sorozatok, differenciál-, integrálszámítás, lineáris programozás, differenciálegyenletek, mátrix, optimumszámítás, operációkutatás, valószínűségszámítás, oktatása korrepetálása 20 éves gyakorlattal egyetemistáknak, és középiskolásoknak.


Feladva: 2017-09-22    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: matematikamechatronikaanyagtudományfizikagéptanmechanikavalószínűségszámításHirdetőkorábbanoperációkutatásPepitagazdaságisikerültoptimumszámításvizsgája

Forrás: pepitahirdeto.multiapro.com

A lícium gyümölcs, másnéven farkasbogyó létfontosságú tápanyagokkal van tele. Szervezetünk számára kitűnő forrása vitaminoknak, ásványi anyagoknak, sejtvédő antioxidánsoknak és az emésztést segítő rostoknak. A lícium, azaz a lycium barbarum összetevői természetes formában vannak jelen, így könnyen felszívódnak a szervezetben. Gyermekeknél hozzájárulnak az egészséges fejlődéshez, felnőtteknél vitalizáló, krónikus betegségeket megelőző és kezelő hatásuk kiemelkedő. A lícium gyümölcs segítségével ... további részletek >>

közérzetünk, szellemi és sportteljesítményünk is javítható, fogyókúránk hatékonysága pedig megsokszorozható. www.lycium-barbarum.gojibogyo.net/lycium-barbarum


Feladva: 2017-07-24    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: líciumgyümölcsösszetevőibarbarumlyciumjavíthatósegítőtelebetegségeketígysportteljesítményünkemésztéstvankrónikusjelenszellemiantioxidánsoknakvannak

Forrás: pepitahirdeto.multiapro.com

Németországba keresünk fizikai betanított munkára férfi, női dolgozókat. Német nyelvtudás szükséges, jó kereseti lehetőség. Fényképes önéletrajzát várjuk i jckft.hr@gmail.com címre.


Feladva: 2016-02-24    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: betanítottfizikaivárjukmunkáramunkaönéletrajzátNémetországiFényképeslehetőségkeresünkkeresetiNémetországbaszükségesZalaegerszegnyelvtudásKftcímre

Forrás: pepitahirdeto.multiapro.com

Lófejes kulcstartó, nyaklánc, övcsat eladó. Érdeklődj telefonon: 30 640 5940, vagy postázni is tudjuk. www.hunbolt.hu/spd/2411/Lofej-patk oval-kulcstarto-3-x-4-cm


Feladva: 2016-11-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: eladónyaklánckulcstartóLófejes640telefononÉrdeklődjövcsattudjukpostázniBudapestvagyMargó5940

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! A Szuvorov Kft. édesipari termékek importálásával és forgalmazásával foglalkozik. Szeretnénk, hogy minél több helyen jelenjenek meg termékeink, ezért várjuk viszonteladók jelentkezését! Szerződött partnereinknek akár kizárólagos forgalmazási jogot tudunk biztosítani, terület megjelöléssel! Az ország távolabbi pontjain található kiskereskedelmi egységek számára, (megrendelt mennyiségtől függően) ingyenesen szállíttatjuk ki megrendeléseiket. Termékeink ... további részletek >>

megtekinthetőek a honlapunkon.


Feladva: 2016-10-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TermékeinkSzuvorovtalálhatóUramakárminélpontjainHölgyempartnereinknekhogymegrendeléseikettávolabbiTiszteltSzerződöttSzeretnénkszállíttatjukország

Forrás: pepitahirdeto.multiapro.com

Horvátországi ingatlanok. REN Ingatlanközvetítő (15 éve partnerünk) ajánlatából helyeztük el az oldalon. A linkeken, az oldalukra jutva sok ház, villa, lakás, és isztriai ház közt válogathat… www.kekadria.hu/ingatlan/hingatlan 1.html


Feladva: 2017-10-05    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: ingatlanokHorvátországiKékAdriaházpartnerünkisztriaiévelakásIngatlanközvetítővillaRENsokjutvaoldalukralinkekenoldalakon8230oldaloneladókiadó

Forrás: pepitahirdeto.multiapro.com

Komáromi János (Málca, 1890. december 22. – Budapest, 1937. október 7.) író, újságíró. Több tucat elbeszélés és regény szerzője. Sorozatcím: Komáromi János munkái gyűjteményes kiadás IV. Kiadó: Genius Könyvkiadó Rt. Kiadás éve: 1930 Kiadás helye: Budapest Kötés típusa: egészvászon Terjedelem: 233 Nyelv: magyar Méret: Szélesség: 13.00cm, Magasság: 19.00cm Kategória: Irodalom szépirodalom regény, novella, elbeszélés Dedikált, aláírt könyvek Antik könyvek ... további részletek >>


Feladva: 2017-04-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: KiadásBudapestgenius1930DedikáltelbeszélésnapokszepregénykirJánosKomáromi00cmkönyvekSzélességHirdetőaláírtTöbbMéretPepitaéveújságíróíró

Forrás: pepitahirdeto.multiapro.com

Cégünk, a SkandiVisual egy építészeti és látványtervezési kreatív stúdió. 3D Illusztrációinkkal mindig az egyediségre, és különlegességre törekszünk, mert hiszünk abban, hogy egy jó ötlet megérdemli a megfelelő előadásmódot. Különböző módokon segíthetjük a projektek marketingjét: fotórealisztikus építészeti látványtervek, belsőépítészeti látványtervek, körpanoráma készítés, fotómontázs, 3D illusztráció alaprajzokhoz, 3D modellezés 2D rajzok alapján, családi ház léptékű építészeti tervezés és ... további részletek >>

tanácsadás. Keressen fel minket, és mi megelevenítjük az elképzeléseit! www.skandivisual.hu


Feladva: 2016-11-30    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: építészetiskandivisualtanácsadástervezéslátványtervekegyKülönbözőkülönlegességrefotómontázselőadásmódotegyediségrekészítésmegfelelőmindigkörpanorámaház

Forrás: pepitahirdeto.multiapro.com

Fogyni szeretnél? Hogyan tudnál a leghatékonyabban lefogyni úgy, hogy a kilók ne kússzanak vissza? A weboldalon megismerheted azokat a technikákat, amelyek segítenek a fogyást akadályozó lelki okok megszüntetésre. Bízom abban, hogy Te is könnyen megtalálhatod azt, ami segíthet végre beindítani a fogyást. A lelki okok megszüntetésére és a stressz oldására nagyon egyszerű módszereket találsz. www.blog.topponleszel.com/fogyokur a-2


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: okoklelkifogyásthogyakadályozóamitechnikákatnagyonHogyanaztazokatoldásáraszeretnélmegtalálhatodmegismerhetedstresszFogynikönnyenfogyokuraTréner

Forrás: pepitahirdeto.multiapro.com

Vendégházunk 4 személyes apartmanjában és vendégszobáinkban kényelmes szállást biztosítunk kedves vendégeinknek. Levelezős diákokat,munkavállalókat,átutazókat is szívesen fogadunk. Vállalatoknak, munkavállalóknak hosszabb távra jelentős kedvezménnyel. 3500,-Ft/fő/éj-től. SZÉP KÁRTYA elfogadás. 3 éjszakán túli foglalás esetén akár 3290,-Ft-tól Az ár függ az eltöltött éjszakák és a személyek számától. www.aratovendeghaz.atw.hu tel:+36704593419


Feladva: 2017-09-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: eltöltöttapartmanjábanSZÉPátutazókatfüggszemélyestőlmunkavállalókattólVendégházunk350036704593419diákokat3290PécskedvezménnyeltelLevelezősakár

Forrás: pepitahirdeto.multiapro.com

Bútort, elektronikai terméket, építőanyagot vásárolt, szeretné minél hamarabb használni, de sokára szállítanák ki? Új lakásba vagy irodába költözne? Ne keressen tovább! Bízza rám a szállítást! Cégek, magánszemélyek részére: korrekt szállítási díjakkal, pontosan, gyorsan, megbízhatóan nyújtom szolgáltatásaimat belföldön és külföldön egyaránt. Raktér méret: 4,1x2,1x2,25 m. Raksúly: 1,5 tonna. Raktározási lehetőség Budapest területén, 1 - 500 m2-ig (kamion beállás megoldott). Kapcsolat: Tel.: ... további részletek >>

20/539-6001 E-mail: info@lajostrans.hu Weboldal: www.lajostrans.hu


Feladva: 2016-10-26    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 1x2Lajos6001rámRaktározásihamarabbkedvezőmegbízhatóan539BízzaRaksúlyminéláruterítésgyorsanTeltovább25mszeretnéfuvarozáspontosanKapcsolatami

Forrás: pepitahirdeto.multiapro.com

Felejtse el üzletében az üresen tátongó felületeket! Arra törekszik, hogy ruhaüzletéből kihozza a maximumot? Egy nagy alapterületen elhelyezkedő boltot is be lehet úgy rendezni, hogy az előnytelen legyen, de egy kicsi boltocska is lehet sikeres és vendégcsalogató. Mi a titok? Először is nem árt okosan megválogatni az üzletberendezést. Ahol nem férnek el a hatalmas polcok vagy széles állványok, ott más, praktikusabb megoldásokra van szükség. Gondolt már arra, hogy a különféle fali ... további részletek >>

rendszerekkel mennyi helyet spórolhat? Próbálja ki ezeket a praktikus polcrendszereket és meg fogja látni, hogy nem létezhet nélkülük üzletberendezés. Miért előnyös ilyen fali rendszereket választani? Ezek a rendszerek a legkézenfekvőbb felületeket, a falakat használják ki. Akár egészen a padlótól a mennyezetig a teljes falat lefedheti egy sínes panellal vagy fali oszlopos rendszerrel, és máris megvan hová pakolhatja az eladásra szánt áruit. Tekintse meg kínálatunkat, és válassza azt a fali rendszert, ami a legjobban illik üzletéhez és elképzeléseihez! Különféle oszlopos vagy sínes panelek és fali rendszerek közül válogathat, amikkel helyet spórolhat és kihozhatja a maximumot üzletéből!


Feladva: 2017-07-01    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falihogyrendszerekvagyegynemmaximumotsínesarrafelületeketoszloposmegspórolhatKülönfélelehethelyetpraktikusabbüresenpadlótólelőnyösokosanami

Forrás: pepitahirdeto.multiapro.com

Falszigetelés - Acéllemezes falszigetelés - Falszigetelés injektálással, - Dryzone-os injektálással - Magasnyomású injektálással - Háttérinjektálással - Tömbinjektálással A falszigetelés összes technológiájával állunk 20 éve a lakosság, illetve az önök szolgálatában.


Feladva: 2017-05-07    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: falszigetelésinjektálássaltechnológiájávalellenösszesfalakvizesTömbinjektálássalutólagosanHáttérinjektálássalinjektálásszolgálatábanönökMagasnyomásúéve

Forrás: pepitahirdeto.multiapro.com

Ruhajavító üzletbe képzett varrónőt keresünk, felsőruházat és általános varrási munkák elvégzésére. Érdeklődni a 06 30 222 2912 vagy a 06 30 222 2912 -es telefonon lehet Munkaidő: Kedd - Péntek -ig Web: www.altalanosruhaszerviz.freewb.hu


Feladva: 2017-10-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkvarrónőt2912222üzletbeRuhajavítótelefononképzettfreewbvagyaltalanosruhaszervizÉrdeklődniLaszlohttpelvégzéséreBerkesWebmunkáksürgősen

Forrás: pepitahirdeto.multiapro.com

Hetente, vagy havonta kereshetsz! Egy csomag ára 0.50 $ és kereshetsz 6,000 $-t, plusz 2,066 pozíciót kapsz, amivel újra keresel! Xprofit. A győzelem egy fenntartható egyenes vonalú mátrix! Amikor kifutsz 2,066 pozícióval jössz vissza újra! Korlátlan , csomag vásárlás. A csomagokat óránként adják hozzá a rendszerhez, hogy minden tag számára tisztességes legyen. 5 $-t utaljatok be minimum indulás előtt! Automatikusan lesz minden! Több számla is megengedett. Pif áthelyezési lehetőség. ... további részletek >>

Processzorok: Bitcoin, Payer, AdvCash, Payza


Feladva: 2017-11-23    [Pénzkeresés - MLM]

Címkék, kulcsszavak: xprofitcsomagwwwújraegyminden066winkereshetszmegengedettegyenestisztességesáraKorlátlanszámlafenntarthatószámárahavontahttpsTöbbtagvagy

Forrás: pepitahirdeto.multiapro.com

Balaton, Balatonfenyves, közvetlen vízparti szállás, üdülés, horgászat. Az udvarból a Balatonba léphet... csak 1 lépés a Balaton! Strandolás, horgászat helyben. Biztonságos, családias, gyermekbarát környezet. Ingyenes stég, csónak, vízibicikli, kerékpár használat. Bográcsozási lehetőség. SZÉP-KÁRTYA elfogadás! Nézze meg a honlapot és kérjen ajánlatot! NE FELEDJE: ... csak a halak vannak közelebb a Balatonhoz...


Feladva: 2016-09-25    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: csakhorgászatBalatonBalatonfenyvesilépésüdüléslehetőségBiztonságosvízpartiBográcsozásihelybenFELEDJEközvetlenhasználatajánlatotBalatonfenyveskerékpár

Forrás: pepitahirdeto.multiapro.com

Miért válassza a mi utazási irodánkat? Mert... - 80 utazási iroda ajánlatait találja nálunk! Foglaljon egy helyen azonos feltételekkel Mert... - 27 éves vállalkozás vagyunk! Megbízható, 100% magyar tulajdonban Mert... - Tapasztalt kollégák segítenek a választásban. Gyors és szakszerű ügyintézés Mert... - Online foglalhat, minden kötelezettség nélkül Folyamatosan frissülő akciós ajánlataink: www.telen-nyaron.hu/utazas/utazaso k/promo/akcios-utak.html


Feladva: 2017-07-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: MertutazásitelenirodatulajdonbanutazasFoglaljonfoglalhatPepitamagyarnyaronnálunkOnlineMinute100találjaLastMegbízhatówwwajánlataitügyintézés

Forrás: pepitahirdeto.multiapro.com

Szakkísérői vizsga túlméretes szállítmányokhoz! 138.000 Ft/fő teljes áron, részletfizetési lehetőséggel! Jelentkezési feltételek: ”C” kategóriára érvényes vezetői engedély valamint legalább 5 év gépjármű vezetési gyakorlat, bármely nemzetközi kategóriában. Várjuk jelentkezését! Tel: 0620-248-4700; 0620-248-68-18; www.fuvinfoiroda.hu/tanfolyamok/eg yeb-kepzesek/szakkiseroi-tulmeretes -szallitmanyokhoz


Feladva: 2017-04-03    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: május8221túlméretesvizsgaJelentkezésiSzakkísérői2480000620jelentkezésétextranemzetköziVárjukmostbármelyfeltételekhétfőszállítmányokhozgyakorlat

Forrás: pepitahirdeto.multiapro.com

Tökéletesen tisztítja a többféle felületet. Univerzális alkalmazású: fürdőszoba, konyha, terasz és erkély. Használja fazekakhoz, odaégett maradékokhoz, mosogatókhoz, üvegekhez, porcelánhoz. Erős és biztonságos - a biológiailag lebomló. Nagyon szennyezett, pl. kenőanyagokkal szennyezett kezet is lehet vele mosni 500 g-os kiszerelésben. ERŐS ÉS BIZTONSÁGOS - KÉZKÍMÉLŐ - KÖRNYEZETBARÁT Azért is foglalkozom vele, mert én is használom a saját háztartásomban. Emellett keresek pénzt is vele, ... további részletek >>

mert megismertetem mindazokkal, akiket szintén érdekel...


Feladva: 2017-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: veleBIZTONSÁGOSERŐSUniverzálisszennyezettmertkonyhapasztabiológiailagfürdőszobapénztlebonthatóporcelánhozalkalmazásúkeresekkiszerelésbenzöld500

Forrás: pepitahirdeto.multiapro.com

Egy gyulladáscsökkentő gyógyszer sokat segíthet, ám ártalmaitól, káros mellékhatásairól sem szabad megfeledkezni! Sokan már csak akkor foglalkoznak ezekkel, amikor túl késő. Legyünk előrelátóak, hiszen van megoldás gyógyszerek nélkül élni! A természetes gyulladáscsökkentők közül mind több szakember ajánlja figyelmünkbe a fekete berkenye előnyeit. Ez az eredetileg Észak-Amerikában honos gyógynövény étrendkiegészítőként ma már az egyik legnépszerűbb erre a célra. Mint vény nélkül kapható ... további részletek >>

gyulladáscsökkentő, csupa természetes hatóanyaggal segít legyőzni a gyulladásos folyamatokat, melyek megelőzésében is hatásos. www.aronia.berkenye.com/gyulladascsokkento/


Feladva: 2017-06-20    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: gyulladáscsökkentőnélkülgyógyszerektermészetesmárétrendkiegészítőkéntszabadtöbbKittielőrelátóakgyógynövénysemhatásosszakemberberkenyébőlkaphatókéső

Forrás: pepitahirdeto.multiapro.com

Használt üzletberendezések eladók. Fali elem: 21.500.-/fm Gondola: 32.000.-/fm Szigetszentmiklósi raktárkészletről. Érd: 06-70-528-1162 ; 06-70-775-5205 Email: i roda@polcozzunk.eu


Feladva: 2017-07-04    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: raktárkészletrőlPolcozzunkSzigetszentmiklósiüzletberendezés000PolcrendszerGondolairoda@polcozzunk500Emailelem5205Fali775eladók1162üzletberendezések

Forrás: pepitahirdeto.multiapro.com

Kedves Vendégek! Sok szeretettel várjuk Önöket a Büki Gyógyfürdő bejáratától 250 m-re található apartmanházainkban!


Feladva: 2016-08-17    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SzállásÖnöketvárjukszeretettelSokVendégekapartmanházainkbanKedvestalálhatóBükfürdő250ApartmanbejáratátólMolnárGyógyfürdőBükfürdőnBüki

Forrás: pepitahirdeto.multiapro.com

Pest megyéből taxi transzferek igen kedvezően Liszt Ferenc (Ferihegy) reptérre. Aktuális ajánlatokért telefonáljon (06 70 2387924), látogassa meg honlapunkat.


Feladva: 2015-06-02    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: taxiFerencLisztlátogassatranszferek2387924telefonáljonmegyébőlajánlatokértPestAktuálishathazireptérreajánlatokFerihegytranszferreptérihonlapunkat

Forrás: pepitahirdeto.multiapro.com

Több millió elégedett vevő! Már 3 nap alatt érzed a hatását. Természetes összetevők!


Feladva: 2017-03-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásátHatékonyérzedalattnapMárvevőelégedettmillióTöbbösszetevőkErzsebetTermészetesgombaölő

Forrás: pepitahirdeto.multiapro.com

A pikkelysömör sajnos gyógyíthatatlan. A hibás gének kijavítására tesznek ugyan erőfeszítéseket a gyógyszerkutatások, azonban a mindenki számára elérhető gyógymód még várat magára... A betegség tüneteit mindezek ellenére igen hatásosan kezeli az a bevizsgált készítmény, mely az alábbi linken keresztül megtekinthető!


Feladva: 2015-11-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: pikkelysömörtüneteitméghibáskezelielérhetőgyógyíthatatlanhatásosanszámárasajnosigenmindenkiellenéreazonbanmegtekinthetőBudapestmindezekkeresztül

Forrás: pepitahirdeto.multiapro.com

Magyar termék, gondozásmentes zárt rendszer. Magas indítóáram, 1 év garancia. 12V 45Ah 360A: 12.000,-Ft 55Ah 450A: 15.000,-Ft 72Ah 680A: 18.000,-Ft 100Ah 800A: 24.500,-Ft 155Ah 900A: 35.000,-Ft Szállítás: Országosan - Futárral 1 munkanap Személyesen: H-P: 08.00-17.00 Szombat: 08.00-12.00 Vasárnap: Zárva


Feladva: 2017-09-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 000munkanap72AhgondozásmentesFutárral450AtermékOrszágosan55AhMagyarSzállítás360ADebrecen45Ahajánló900A12VHirdető155AhgaranciaZárvaPepita

Forrás: pepitahirdeto.multiapro.com

INGYENES Elme Tréner szoftver! Toppon Leszel! Egy nagyszerű eszköz az önfejlesztéshez, ami segít a tudatalattid hatékony átprogramozásában. Változtatni sohasem késő, kezd el most, ezzel az ingyenes szoftverrel! Bővebb információ a weboldalon, ahol például láthatsz egy nagyon jó videót, ami bemutatja azt a folyamatot, hogy mi játszódik le az agyadban, amikor szabotálod a sikereidet!: www.topponleszel.com/tudatalatti-u zenetek-mukodese


Feladva: 2017-04-03    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: ingyenesszoftverTrénerElmeszoftverrelsegítönfejlesztőamiezzelönfejlesztéshezmosteszközkezdnagyszerűcomkésőEgytopponleszelsohasemLeszelhttp

Forrás: pepitahirdeto.multiapro.com

Angol nyelvtanítás, korrepetálás, felkészítés nyelvvizsgára, állásinterjúra, közép és emelt szintű érettségire Szolnok belvárosában diplomás nyelvtanárral.


Feladva: 2017-09-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nyelvtanításAngolSzolnokbelvárosábanbarnaérettségireszintűemeltközépállásinterjúranyelvvizsgárafelkészítésnyelvtanárralkorrepetálásdiplomás

Forrás: pepitahirdeto.multiapro.com

Szálláshelyek és szállásfoglalás Erdélyben. Foglalja le már most erdélyi szálláshelyét, nyaralásához. Erdelybe.hu és szallas-erdely.hu oldalainkon válogatott erdélyi szálláshelyeket találhat. Szálláshelyeinknen már többezer elégedett vendégünk megfordult. Az erdélyi szálláshelyek közül csak a legjobbakat válogattuk ki Önnek, hogy egyszerű legyen a választás.


Feladva: 2017-02-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekerdélyimárErdélybentöbbezerszálláshelyétÖnnekmostválogattukSzálláshelyeinknenFoglaljalegjobbakattalálhatcsakszálláshelyeketszállásfoglalás

Forrás: pepitahirdeto.multiapro.com

Vattacukor készítő gépek - Új/Gyáriak (USA Design) - átlátszó plexi szélvédő burával, (Professional candy floss machine) + kétkerekű kocsival szerelten (kordé), vagy asztali változatban ELADÓK - MEGRENDELHETŐK! A Vattacukor gépek ELEKTROMOS (Electric) és GÁZOS (PB Gas) fűtéssel választhatóak! Kiemelkedően profi gasztronómiai használat, és gyári design! E-mail címre tájékoztatót, és képeket küldök! Az értékesítés Pro-Forma számlával történik! ... további részletek >>


Feladva: 2017-04-30    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: ELADÓKdesigngépekVattacukorMEGRENDELHETŐKProcandyprofiWAYértékesítésProfessionalKiemelkedőenGOLDENváltozatbanküldökburávalválaszthatóakasztaliGas

Forrás: pepitahirdeto.multiapro.com

A Tamarinlax lekvár fő összetevői magán a gyümölcsön kívül a szennalevél por, melyet évezredek óta használnak hashajtásra és méregtelenítésre. Segítségével fokozható a bélműködés, ezzel elősegíthető a széklet mielőbbi ürülése, ezzel együtt a görcsök és a haspuffadás megszűnése. A Tamarinlax lekvár puhítja a székletet, nemcsak székrekedés esetén hasznos, de alkalmazása javasolt műtétek, végbéltükrözés előtt, illetve kúraszerű fogyasztásával hatékonyan megoldható a rendszeres időközönként ... további részletek >>

elvégzett méregtelenítés is. A Tamarin lekvár összetevői és hashajtó hatása bővebben: www.tamarin-lekvar.szekrekedesellen.com/tamarin-hashajto


Feladva: 2018-01-15    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: lekvárösszetevőiezzelhatásahashajtóTamarinlaxTamarinhasznosszekrekedesellenmegoldhatóótaeseténbővebbenürülésehatékonyanévezredekszékrekedésmielőbbi

Forrás: pepitahirdeto.multiapro.com

Hozzávalók a tésztához: 2 tojás 1 bögre cukor 200 g tehéntúró 1 kiskanál szódabikarbóna 1/2 kiskanál só 2 bögre liszt kókuszreszelék (a díszítéshez) Hozzávalók a krémhez: 3 tojássárgája 6 evőkanál cukor 5 evőkanál liszt 7 dl tej vaníliaaroma 200 g vaj Verjük fel a tojást a cukorral, majd adjuk hozzá a tehéntúrót, a szódabikarbónát, a sót és egy bögre lisztet, keverjük össze habverővel vagy kézi robotgéppel. Adjunk hozzá még egy bögre lisztet és keverjük össze. Tegyük ... további részletek >>

hűtőszekrénybe 60 percre a tésztát. Készítsük el a krémet: Keverjük ki a tojássárgáját a cukorral majd tegyük bele a lisztet és a tejet, kavarjuk össze habverővel vagy robotgéppel, lassú tűzön kezdjük főzni. Közben folyamatosan kavargassuk, amikor elkezd főni vegyük le a tűzhelyről és ízesítsük vaníliaaromával, hagyjuk hűlni. A vajat alaposan habosítsuk fel és keverjük hozzá a krémet. Vegyük ki a hűtőből a tésztát és osszuk 6 egyenlő részre, nyújtsunk belőle 6 lapot. Előmelegített sütőben, vajjal kikent tepsi hátulján süssük mindegyik lapot pár percig, amíg egy kis színt kapnak. A tortalapokat kenjük meg a krémmel és tegyük őket egymásra, szórjuk meg kókuszreszelékkel. Hagyjuk állni pár órát, majd szeleteljük. Jó étvágyat! www.webcukraszda.hu/bogres-raffaello-torta/


Feladva: 2017-04-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: keverjükbögrelisztettegyükmajdegyhozzáösszemegliszttésztáthagyjukevőkanálcukorVegyükkrémetcukorralrobotgéppelHozzávalókvagytortahabverővel

Forrás: pepitahirdeto.multiapro.com

Könyvelés - Cégalapítás - Székhelyszolgálat Hosszított esti és hétvégi elérhetőséggel állunk Ügyfeleink rendelkezésére. Jelenlegi és leendő partnereinkkel a kölcsönös és feltétlen bizalmon alapuló baráti és üzleti kapcsolatra törekszünk, hiszen ebben a szakmában ez elengedhetetlen. Kft, Bt könyvelése 7.000 Ft-tól Egyéni vállalkozó könyvelése 6.500 Ft-tól Székhelyszolgálat 4500 Ft-tól Cégalapítás 19.990 Ft-tól Célunk, hogy az Ön számára is hasznos segítség lehessünk ... további részletek >>

mindennapjaihoz. Reméljük, hamarosan Önt is ügyfeleink körében üdvözölhetjük, s egyúttal várjuk mielőbbi jelentkezését. Részletes információ weboldalunkon!


Feladva: 2016-10-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: tólmindenMostügyfeleinkCégalapításSzékhelyszolgálatingyenKönyveléskönyveléseÜgyfelünknekegyúttalbarátiszámáraelérhetőséggelEgyéniüdvözölhetjükalapuló

Forrás: pepitahirdeto.multiapro.com

A Johnson & Johnson új egynapos viselésű 1-Day Acuvue Moist kontaktlencse tervezésénél az elsődleges cél a szem frissen és nedvesen tartása volt egész napon át. A 1-Day Acuvue Moist kontaktlencse kiváló nedvesítést, ezáltal a hosszan tartó kényelem szabadságát nyújtja Önnek. Minden napra új kontaktlencse a maximális higiéniáért és kényelmes kontaktlencse viselésért. Az egyedülálló LACREON technológiával készült kontaktlencse alapanyaga egy olyan nedvesített alkotórészt tartalmaz, amely ... további részletek >>

teljes egészében a kontaktlencsében marad a nap végére is, amikor szemei elfáradtak, és és extra nedvesítésre van szükségük. A 1-Day Acuvue Moist kontaktlencse UV védelemmel is el van látva szemei épségének megőrzéséért. A kontaktlencsék UV-szűrő képessége több mint 70%-os az UV-A, és 95%-os az UV-B sugarak tekintetében. A 1-Day Acuvue kontaktlencsék felhelyezése és kivétele rendkívül könnyű. Bővebben: www.lencsebolt.hu/termek.php?id=31


Feladva: 2017-11-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kontaktlencseAcuvueDayMoistszemeijohnsonvankontaktlencséknapranaponvégéreegyegynaposMindenlátvaegészphpnapalapanyagaÖnnekvolttermekmarad

Forrás: pepitahirdeto.multiapro.com

Gonzó még csak 6-7 hó körüli kisfiú, Aki már most nagy bajban van! A kutya egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie ... további részletek >>

Érdeklődni lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagymegkutyacsakGonzóegyvangazdaörökbebajbanGYEPMESTERIFogaddSÜRGŐSgazdinakNAGYONaltathatómárhagyjeredetikisjövendőbelijelentkezését

Forrás: pepitahirdeto.multiapro.com

Mindenki számára egyszerűen és gyorsan kezelhető, folyamatosan a hatályos jogszabályok szerint fejlesztett számlázó program, készletnyilvántartó program és házipénztár szoftver. A programok DEMO változata díjmentesen kipróbálható! Díjmentes belföldi szállítás akár másnapra, letöltés esetén munkaidőben akár 1 órán belüli használatba vétel. CD-s változatban is igényelhető, több száz referenciával, ügyfélszolgálattal, NAV igazolással. www.naturasoft.hu/szamlazo_program .php


Feladva: 2016-08-17    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: programszámlázónaturasoftakáregyszerűenszállításváltozatbanBudapestbelföldiszamlazofejlesztettvételDíjmentesszerinthasználatbakipróbálhatówwwbelüli

Forrás: pepitahirdeto.multiapro.com

Angol online tanfolyam kezdőknek és újrakezdőknek, ha nincs időd nyelviskolába járni itt a helyed! Most 20 ingyenes ONLINE leckével próbáld ki magad és fejleszd tudásodat. Képek, videók és különböző feladatok segítenek az angol nyelv elsajátításában. Tesztek és gyakorlási lehetőség INGYEN. Tanulj otthon, a saját időbeosztásod szerint! Webcímünk: www.tanoda.shp.hu


Feladva: 2016-10-29    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: angolONLINEkezdőknekotthonpróbáldWebcímünkújrakezdőkneknyelvleckévelszerintidőbeosztásodtanfolyamsegítenekingyenessajátOrszágosfeladatokMostTünde

Forrás: pepitahirdeto.multiapro.com

Kézzel készített férfi és gyermek csokornyakkendők nagy választékban. Fényes, matt, virágos, kockás, pöttyös, vintázs kivitelben.


Feladva: 2017-08-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: kivitelbenférfivintázskészítettpöttyösKézzelkockásajánlóvirágosHirdetőmattPepitaFényesCsokornyakkendőboltválasztékbannagycsokornyakkendőkgyermek

Forrás: pepitahirdeto.multiapro.com

Szeretettel várunk minden négylábú barátunkat! Egyszerre 3 kistestű és 1 nagytestű kutya gondozását, foglalkoztatását és elszállásolását tudjuk vállalni.


Feladva: 2017-09-23    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: vállalninégylábúCSIMAbarátunkatTANYAEgyszerreKutyapanziókistestűPepitanagytestűHirdetőkutyaajánlógondozásátVérteskethelyfoglalkoztatásátSzeretettel

Forrás: pepitahirdeto.multiapro.com

A bevásárlóközpontok, plázák, mallok világszerte méltán népszerűek... Olyan igényt elégítenek ki, amivel mindenki nyer! Magyarországon is jelentősen növekedik az e-kereskedelem. Számtalan webáruházat találhatunk, jót is és kevésbé jót is... Azoknak a kereskedőknek figyelmére mindenképpen számítunk, akik már megtapasztalták a saját webhelyeiken nem csak az éppen hatályos jogszabályoknak kell megfelelni, hanem folyamatosan karban kell tartani a webhelyet, annak az elérhetőségét, különben a ... további részletek >>

látogatottság, vele együtt az üzleti eredmény is elmarad. Azok figyelmére is számítunk, akik (esetleg földrajzi adottságaik miatt?) fejlődésre csak az interneten keresztül számíthatnak. Internetes kereskedelemről van szó, pláza szerű webes környezetben! Nem feltétlenül mindenki alkalmas azonnal árusítani termékét, interneten forgalmazható szolgáltatását. Ismerjük meg egymást! Ön tudni szeretné, hogy miképp lehet kereskedő webplázánkban, mi pedig azt, hogy Ön milyen gyakorlattal (ismeretekkel) rendelkezik már az internetes kereskedelemben, milyen árucikkeket, termékcsoportokat forgalmazna. Ezen a helyen biztonságosan üzenetet küldhet, egy rövid bemutatkozást, cégismertetőt kérünk! Ha van webhelye, kérjük írja meg webcímét is! Minden olvasónak köszönet az érdeklődésért, az üzenetekre a legrövidebb időn belül válaszolunk!


Feladva: 2017-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: márNemhogyjótvaninternetenakikesetlegmilyenplázaszámítunkfigyelméreinternetesmegkellMagyarországonmindenkicsakkérjükegymástüzletinyeridőn

Forrás: pepitahirdeto.multiapro.com

Weboldalak tervezését és teljes körű kivitelezését vállaljuk. Forduljon hozzánk bizalommal, és vegye igénybe szolgáltatásainkat: - Statikus és dinamikus weboldalak programozása, igény szerinti funkciók programozása (Bemutatkozó honlapok, webáruházak, egyedi ötlet alapú weboldal igény szerinti funkciókkal) - Egyedi webdesign, webgrafika, céges arculat, reklámgrafika Erősségeink: marketingközpontú gondolkodásmód, kreativitás, agilitás. Programozás - Könczöl Dávid ... további részletek >>

konczol.david@webstark.hu Grafika - Biró Virág biro.virag@webstark.hu Tekintse meg referenciáinkat weboldalunkon: www.webstark.hu/#references


Feladva: 2017-03-09    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: programozásaEgyediweboldalakszerintiigénywebstarkkonczolkreativitáskörűvirag@webstarkdinamikusgondolkodásmódteljesbiroStatikusmarketingközpontúVirág

Forrás: pepitahirdeto.multiapro.com

Régi és új üzemanyag tankok teljes körű javítása, homok szórás, rozsda mentesítés, vágás, hegesztés, belső üzemanyag álló bevonat készítése, külső festés, fényezés, feliratok, csíkok készítése, bicikli fényezés. Motor, autó, kamion, hajó vagy más üzemanyag tank, hozza el megjavítjuk. Felnik fényezését is vállaljuk. Látogasson el honlapunkra!


Feladva: 2017-02-27    [Autó - Motor - Jármű]

Címkék, kulcsszavak: üzemanyagfényezéskészítésetankfestésjavításavagykülsőhonlapunkrakörűhajóbevonatLátogassonteljeskamionállóvállaljuktankokautóbelsőfényezését

Forrás: pepitahirdeto.multiapro.com

Ha szikrázik, füstöl, zizeg, ott bizony elektromos probléma van. Mi a legjobb, amit tehet? Áramtalanítsa a lakást és azonnal hívjon minket! NEM VILÁGÍT A LÁMPA? A legvalószínűbb, hogy kiégett az izzó, ezért cserélje ki típusban és teljesítményben megfelelőre. Ha ezt követően sem működik hívjon minket.


Feladva: 2017-10-16    [Lakossági szolgáltatás]

Címkék, kulcsszavak: minkethívjonlegjobbsemCsászihogyvankövetőenGyorsszolgálatlegvalószínűbbproblémaeztVillanyszerelőLÁMPAelektromosmegfelelőreVILÁGÍTbizonyményben

Forrás: pepitahirdeto.multiapro.com

Fedezd fel a profi V-Cube versenykockák izgalmas világát! Az egyedülálló technológiának köszönhetően nagyon könnyedén és precízen forognak, ami élvezetes játékot és gyorsabb kirakást eredményez. A V-Cube kockák kiváló anyagminőséggel rendelkeznek, karbantartást nem igényelnek, rengeteg versenyző használja őket. A lekerekített forma jobban illeszkedik a kézbe, dönts rekordot vele! Részletes leírás: www.gemklub.hu/v-cube-6x6-versenyk ocka-feher-lekerekitett.html


Feladva: 2017-11-24    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: cubelekerekitettversenykocka6x6veleizgalmasigényelnekhtmlélvezetesrekordotversenykockáknemamidöntsprofikarbantartástfeherforognakkézbefelőket

Forrás: pepitahirdeto.multiapro.com

Fashion Plus divatos női ruha webáruház, naponta bővülő divatos női ruha kínálattal, és akciókkal ajándékozza meg látogatóit. Napi Fashion Plus divat tippek a divatos női ruha webáruház kínálatát felsorakoztatva kiegészítőkkel és szép divatfotókkal, a legjobb divat tippeket nyújtja a divat és női ruhák szerelmeseinek. Női ruhák és alap darabok, pulóverek, pólók, divatos nadrágok, divatos szoknyák, kabátok és kiegészítők bő választéka!


Feladva: 2016-10-29    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: NőidivatosruhadivatPlusFashionruhákwebáruházdarabokkiegészítőkkelajándékozzaalapfelsorakoztatvaakciókkalkínálatátválasztékakínálattalkiegészítők

Forrás: pepitahirdeto.multiapro.com

Magyarország első találka alapú (pay per date) és fokozottan biztonságos társkereső szolgáltatása! Csak akkor kell fizetni, ha összejön a randi, de lehet akár teljesen ingyen is! Nálunk nincsenek kamu profilok! Nincsenek zaklató levelek! Ne ülj otthon a képernyő előtt! Próbálj ki valami újat! www.beengedlek.hu


Feladva: 2016-11-06    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: levelekzaklatóNincsenekbeengedlekprofilokkamuotthonlehetdateüljrandiperösszejönpayfizetnialapúkelltalálkaakkorújatelsőCsakvalamiNálunk

Forrás: pepitahirdeto.multiapro.com

Örökre búcsút vehet a súlyos patron és toner kiadásoktól, aki képes újratölteni azokat. Lehet akár tintasugaras, vagy lézernyomtató, esetleg fénymásoló. A módszerben segítünk. Vásároljon egy liter nyomtatótintát, vagy töltse újra drága tonerjét, akár 1.000 Ft alatti palackozott tonerporral!


Feladva: 2015-03-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: vagytoneregyakártintaestonerVásároljonkiadásoktólezerTintapatronsegítünkmódszerbenpatronfénymásolósúlyostonerjétlézernyomtatóvehetdrágabúcsút

Forrás: pepitahirdeto.multiapro.com

Hatékony folteltávolítás kedvező áron. Csepke folteltávolító spray www.mososzerbolt.hu/id/00207_Csepk e_folteltavolito_spray_500_ml__ - Hazai mosószer és tisztítószer webáruház.


Feladva: 2016-01-27    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: sprayfolteltávolítóCsepkeHazaiáronKftkedvezőFuturefolteltávolításCudyHatékonywebáruháztisztítószermosószer

Forrás: pepitahirdeto.multiapro.com

Az AR-5316-os A3-as másológép 1 db 250 lapos papírfiókkal és 1 db 100 lapos oldalsó adagolóval rendelkezik. Egyszerű, könnyen kezelhető berendezés. A másológép lézernyomtatóként is használható a beépített LPT és USB portjain keresztül. Windows 10 operációs rendszerrel nem kompatibilis. www.fullc.hu/sharp/webaruhaz.php?S HARP-AR-5316-hasznalt-masologep&ope n=&id=465&kat=24&menu=w


Feladva: 2017-09-18    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: 5316SHARPmásológéplaposHirdetőkeresztülEgyszerűPepitaportjainrendelkezikhasználtphpUSBadagolóvalwebaruhazLPToldalsófullcbeépítettmenuwww100

Forrás: pepitahirdeto.multiapro.com

Ingatlan értékbecslés az Ön településén is, független értékbecslőktől. Hivatalos és magán ügyben egyaránt. Bírósági - Adóhatósági - hagyatéki - vagyonmegosztási - válási és bármilyen más ügyben. Keressen bennünket + 36702408616 telefonszámunkon, vagy írjon a info@ertekbecslot.hu címünkre. Olcsón - gyorsan és szakszerűen készítjük el megrendelt értékbecslését. www.ertekbecslot.hu/bemutatkozunk. html


Feladva: 2017-12-01    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ügybenfüggetlenértékbecslésIngatlanírjonhagyatékiertekbecslotBudapestvagyAdóhatóságiwwwirodatelefonszámunkonBíróságiértékbecslésétÉrtékbecslőegyaránt

Forrás: pepitahirdeto.multiapro.com

Alsóörsi kiadó szálláshelyek fényképes gyűjtőoldala. Panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Több mint 100 fényképpel a szálláshelyekről és a településről! - SZÉP kártyát elfogadó szálláshelyek Alsóörsön - Egész évben nyitvatartó (kidó) szálláshelyek - Weboldal: www.zimmerinfo.hu/alsoors/hu.htm


Feladva: 2017-11-08    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfonélkülvillákAlsóörsöndíjhtmvendégházakelfogadóközvetítésialsoorsPanziókkártyátszálláshelynélgyűjtőoldalaSZÉPlehetőséghttp

Forrás: pepitahirdeto.multiapro.com

Profi Őrzés Többéves szakmai tapasztalattal, jól képzett szakemberekkel. Biztonságtechnika · Magánnyomozás · Komplex biztonságtechnika · Őrzés-védelem A Justice Security olyan tanácsadó és szolgáltató vagyonvédelmi cég, mely igyekszik teljes körű szolgáltatást nyújtani, ha vagyonvédelemről van szó.


Feladva: 2017-07-14    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: Őrzés183szakmaibiztonságtechnikacégszódíjnyertesszolgáltatószakemberekkelvantanácsadóképzettvagyonvédelemrőlolyanjólnyújtaniSecuritytapasztalattal

Forrás: pepitahirdeto.multiapro.com

Minden gépjárműre, személyautóra, kisteherautóra, kamionra traktorra, buszra készítünk méret pontos üléshuzatot. Legalább 100 fajta anyag minta közül választhat. UV álló anyagok, gyári kárpit anyagok, utángyártott anyagok, elasztikus anyagok, szövetek, között válogathat. A különböző színű, mintájú, vagy minőségű anyagok összevariálásának csak az ön fantáziája szabhat határt. Vásárolhat nálunk trikó üléshuzatokat, valamint univerzális üléshuzatokat is. Várjuk szeretettel. Tekintse ... további részletek >>

meg weboldalunkat: huzatkiraly.hu Bán&Vincze BT Kecskemét, Jókai utca 41 Telefon: 0630/911-1277 - 0630/4853749


Feladva: 2016-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: anyagokVinczeBán0630üléshuzatokatKecskemétkárpitvalamintpontosminőségűüléshuzatgyáritrikóméretvagyMéretpontoshuzatkiralyállónálunkkészítünk

Forrás: pepitahirdeto.multiapro.com

Ha szeretnél magadnak jövedelem kiegészítést, 100% online munkával, ehhez tudok ajánlani és megoldást adni, úgy hogy érdekelni fog! www.dollar-persely.iwk.hu


Feladva: 2017-05-18    [Pénzkeresés - MLM]

Címkék, kulcsszavak: megoldástSzakálajánlaniElviraiwktudokfelhívhatodperselyehhezfigyelmétdollarmunkávalmásokhttponlineamirefog100ötletérdekelnikiegészítéstEgy

Forrás: pepitahirdeto.multiapro.com

Szünetmentes tápegység Kemot tiszta szinuszos Felhasználás terület: a teljesítmény figyelembevételével: - hűtők - hő központok - keringtető szivattyúk - búvárszivattyúk, villanymotorok www.elektroexpressz.hu/spl/499141/ UPS-SZUNETMENTES-TAPEGYSEG


Feladva: 2017-01-22    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: SZUNETMENTESelektroexpresszszinuszostisztatápegységteljesítménysplterületFelhasználáshttpsvillanymotorokbúvárszivattyúkKemotszivattyúkkeringtető300W

Forrás: pepitahirdeto.multiapro.com

Gyerekeknek, fiataloknak kreatív díszpárnák. Csiga díszpárna, teknős díszpárna, katica díszpárna, pillangó díszpárna, egér díszpárna, kutya díszpárna és még sok más... www.atalakulok.hu/termekkategoria/ diszparnak


Feladva: 2016-11-12    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: díszpárnadíszpárnákmásokkreatívsokanfiataloknakmégGyerekekneksepalakutyaállatosegérpillangókaticateknőscsiga

Forrás: pepitahirdeto.multiapro.com

Moteck SW 280 kétszárnyas kapunyitó szett: 83500 Ft Országos házhoz szállítás, 1 év garancia! Magyar nyelvű telepítési és programozási útmutatóval! Szeretné kézben tartani a kényelmet? Ha IGEN! Akkor Önnek találták ki az elektromos kapunyitószettet! Egy távirányítóval megoldja a kapunyitást, sőt a kerti világítást is kapcsolhatja a távirányító segítségével! A Moteck SW-280 egy igen kedvező árú, extra sallangoktól mentes, kiváló ár/érték arányú, több éve forgalmazott kapunyitó szett ... további részletek >>

márka. Természetesen az nem akadály, ha Önnek egy régi kertkapuja van: a motor felszerelhető régi, új, egy-, vagy kétszárnyú kapura is, illetve tolókapuk esetén szinte a legtöbb, már működő kapura is. A kapunyitó szettek felszerelése tehát nem kíván különösebb átalakítást a meglévő kapurendszerén! Egyszerű telepítés, komolyabb szakértelmet nem igényel a felszerelése! Megrendelés, további technikai információk weboldalunkon: www.boltcenter.hu


Feladva: 2016-09-20    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: kapunyitóegynemszettÖnnekfelszerelésekétszárnyúkapuraigenrégi280MoteckMegrendeléskényelmetkülönösebbmentesházhoztolókapukvilágítástakadálysőt

Forrás: pepitahirdeto.multiapro.com

Ha Ön is szereti az izgalmas mozgalmas filmeket, megdöbbentő videókat, retró, vagy mai zenét halgat szívesen, akkor ezzel a YouTube válogatással további keresés nélkül ingyen megteheti.


Feladva: 2014-12-01    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: hathazizenétzenékmegtehetimaivideókingyenvagyFilmeknélkülretrókeresésvideókattovábbimegdöbbentőyoutubeválogatássalfilmeketezzelmozgalmasakkor

Forrás: pepitahirdeto.multiapro.com

99,8%-os tisztaságú vízmentes izopropanol általános tisztításra. Kitűnően alkalmas lejátszófejek tisztítására, fluxok, alacsony zsírtartalmú olajok, poláris szennyeződések, és ásványi eredetű szennyeződések eltávolítására. A legtöbb flux higítására is használható. • nem ózonkárosító • műanyag felületen is használható • gyorsan párolog • nincs maradványanyag • nem korrozív


Feladva: 2017-01-22    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 8226szennyeződésekhasználhatónemeltávolításáraalkalmasnincsIzopropilKitűnőenpárologeredetűtisztításragyorsanásványiáltalánospolárisizopropanolflux

Forrás: pepitahirdeto.multiapro.com

Budapestiek figyelem! Ha szeretne egy csendes kisvárosban élni, vagy nyaralót venni, itt a lehetőség! Gyomaendrődön, a vizek városában, 20 m-re a holtághoz közel - ami intenzíven telepített (harcsák, amurok, pontyok és más ragadozó halak vannak) 80 nm-es ház eladó. Az ingatlan a 60-as években épült, vegyes a falazata tégla, illetve vályog 50 cm-es falvastagsággal. Nyáron hűvös, télen meleg... Nem repedezett, penészes, 2006-ban nyílászáró csere, burkolás, festés és háromfázisú áram ... további részletek >>

lett bevezetve. Az udvari rész 1400 nm, melyben sok gyümölcsfa, alsó épület, garázs található. Családoknak is ajánlom, CSOK igénybe vehető. Az ingatlan per és teher mentes. Nos kíváncsiak, hogy mennyi az ára? Bútorral is eladó 10 millió forint, bútor nélkül 9 millió forint. Komoly érdeklődés esetén az árból engedek!


Feladva: 2017-09-11    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóvárosábanvizekingatlanházmennyi2006holtághozárbólajánlomilletvekisvárosbanudvarihalakbútorralhogypenészes20mengedekcsaládoknaktéglaegy

Forrás: pepitahirdeto.multiapro.com

Áruházunk felületén kizárólag minőségi, eredeti termékek közül válogathat. Minden terméket számlával, használati útmutatóval, garanciával forgalmazunk. Termékeinkről vásárlás előtt minden esetben kérhet tájékoztatást, a használat során felmerülő kérdéseire is szívesen válaszolunk. 23 év kereskedői-szakmai tapasztalattal rendelkezünk, bármikor elérhetőek vagyunk! Termékeinket az üzletünkben, Szentesen a sétálóutcában is megvásárolhatja. Megtisztelő figyelmét köszönve kívánunk további ... további részletek >>

kellemes napot.


Feladva: 2017-01-11    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: edenyboltmindenkereskedőielőttsétálóutcábantermékekválaszolunkvásárlásSzenteseneredetiszívesenTermékeinkrőlüzletünkbenminőségikérdéseirenapotkellemes

Forrás: pepitahirdeto.multiapro.com

Addig dobolunk, amíg ez a lakás megtalálja új tulajdonosát! Dob utcában, csendes, félemeleti, 59 nm-es, 2 szobás, igényesen felújított, cirkós, könnyen 3 szobássá alakítható, befektetésnek is kiváló lakás eladó!!! A fotók önmagukért beszélnek! Nézze meg ma, megvásárolni ráér holnap:-) Fotókat küldök!


Feladva: 2017-07-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: DobeladólakásutcábanmegvásárolniszobássámegtaláljamegkönnyenamígNézzecirkósdobolunkbeszélnekfelújítottAddigönmagukértigényesenBudapestfotók

Forrás: pepitahirdeto.multiapro.com

Zárnyitás, ajtónyitás teljesen roncsolás mentesen manipulációs zárnyitás technikával. Több mint 20 év zárnyitás területén szerzett szakmai tapasztalatunk alapján, nem csak a becsapódott ajtókat tudjuk roncsolás mentsen kinyitni, hanem azokat is, amelyek kulcsra vannak zárva. Speciális német és amerikai szerszámok segítségével a manipulációs zárnyitás, azaz a finomnyitás technikát alkalmazva a kéttollas (Mottura, Cisa, CR, S.A.B. Viro, Dierre Atra stb) és cilinderes zárak belső záró elemeit addig ... további részletek >>

mozgatjuk, amíg mindegyik a megfelelő pozícióba kerül, és úgy kinyílik a zárszerkezet mintha a saját kulcsát használtuk volna. Ebből következően a zárnyitás során semmiképpen nem tud megsérülni sem az ajtó sem pedig a zárszerkezetek, így továbbra is tudja azokat használni zárcsere nélkül is.


Feladva: 2017-11-23    [Lakossági szolgáltatás]

Címkék, kulcsszavak: zárnyitásnemazokatajtónyitásBudapestmanipulációssemroncsoláselemeitbecsapódotthasználnikéttollasteljesenzárszerkezetzárvazárócsaksemmiképpenbelső

Forrás: pepitahirdeto.multiapro.com

A bárányhimlő felnőttkorban súlyos szövődményeket okozhat, terhes nőkre nézve pedig különösen veszélyes, mert maradandó károsodást okozhat a magzatnak. A bárányhimlő lefolyása után a szervezet immunis lesz a vírusra, így aki egyszer már elkapta, többet nem fog szenvedni a betegségtől. Főként a téli és a tavaszi hónapokban terjed, lappangási ideje 2-3 hét, ezután jelentkeznek a bőrön a piros pöttyök. Mit tegyünk bárányhimlő ellen? Bárányhimlő ellen sokféle gyógymód létezik, általában csak a ... további részletek >>

tüneteket kell kezelni, azaz a viszketést csillapítani, mert az elvakart hólyagok heget hagyhatnak maguk után.


Feladva: 2016-10-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BárányhimlőutánmertellenokozhatterjedfelnőttkorbanazazmártegyünkkárosodásthónapokbanKittikezelniegyszerMitmaradandótavasziKellérkellakitéli

Forrás: pepitahirdeto.multiapro.com

Motoros mintás hátizsákok többféle mintával a retro pannónia logóstól a humoros feliratosig. Motoros férfiaknak és motoros nőknek egyaránt kiváló ajándék lehet minden alkalomra. Két rekeszes (egy nagy és egy zseb elől), könnyű poliészter hátizsák, fülhallgató kivezetéssel, állítható vállpánttal. Ha egyéni mintát szeretnél nyomatni, írj! Hossz / cm 40.00 Szélesség / cm 28.00 www.rockpont.polomania.hu/termekek /reszletek/151497_humoros_feliratu_ hatizsak_a_sor_kapcsan-online_rende les


Feladva: 2018-01-04    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: motorosegyhátizsáknőknekmintátmintásegyéniRockPontnagyférfiaknakvállpánttalrekeszesfeliratosigállíthatóKéthumoroskivezetésselalkalomralogóstól

Forrás: pepitahirdeto.multiapro.com

A szájvíz szájfertőzés gyógyítására segítséget nyújthat a tünetek enyhítésében, a gyulladás mérséklésében és a baktériumok elpusztításában. A szájfertőzés gyerekeknél is gyakran jelentkezik, hiszen ők kevésbé tudnak figyelmet fordítani a szájhigiéniára és gyakran a szájukba veszik a kezüket, ami tele van baktériumokkal. A szájfertőzések kezelése történhet helyileg és belsőlegesen is. Általában részét képezi az antibiotikum kúra, de ezt gyakran kenőcsök formájában rendeli el az orvos. ... további részletek >>

Előfordulhat, hogy a szájfertőzés egy alapbetegség kísérőtünete, ilyenkor kezelése a kiváltó ok megszüntetésével történik.


Feladva: 2018-01-11    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: szájfertőzésgyakrankezelésebelsőlegesengyógymódmegszüntetésévelszájhigiéniárarendeligyulladáshelyilegSokfajtakiváltófordítaniformájábanenyhítésébenezt

Forrás: pepitahirdeto.multiapro.com

Látogasson el hozzánk, ha különleges alkalomra való gyertyát keres! Akár belföldről, akár külföldről érkező igény esetén -nagy volumenű munkák tekintetében - alvállalkozóként is szívesen közreműködünk! Legyen szó akár rusztikus, akár adventi gyertya, vagy egyéb más gyertya készítésről, szívesen várjuk megkeresését! Örömünkre szolgál, hogy olyan termékek, gyertyák gyártását végezzük, melyek a hangulatteremtés szimbólumai!


Feladva: 2017-03-28    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: adventigyertyaBarbaraKismindenes

Forrás: pepitahirdeto.multiapro.com

Festmény a léleknek, a lélek festőjétől. A festmény címe: Átjáró (Tisza-Kalmár György) Méret: 50x50 cm Anyag: olaj rétegelt falemezen A gyönyörű meleg barna színek kavalkádja és az arany lemez tompa csillogása átjárót nyit egy másik világba. Megnyitva az elmét a szellem szabad szárnyalását segíti elő. A fénykép nem tudja visszaadni azt a finom felületi gazdaságot, az árnyalatok sokszínűségét, ahogy egymást fedik a lazúr színek. A festmény érdekessége a kézzel festett fakeret, amely ... további részletek >>

önmagában is egy művészi alkotás, tovább emelve a festmény értékét. www.tisza-kalmar.hu/index.php/galeria/26-absztrakt-festmenyek/27-gallery-3 A festményt személyesen át lehet venni Egyházashetyén (Vas megye, Sárvár közelében), vagy futárszolgálat kézbesíti a megadott címre.


Feladva: 2016-09-14    [Régiség - Művészet]

Címkék, kulcsszavak: KalmárfestményeolajfestőKortársfestőjétőllélekléleknekFestményEgyházashetyeGyörgy

Forrás: pepitahirdeto.multiapro.com

Eladó 2 emeleti (!!!) napfényes, déli fekvésű gázkonvektoros lakás. A lakás körbe lakott, ezért minden oldalról fűtött falak veszik körbe, a rezsi minimális. A szoba hagyományos parkettás, a többi helység járólapos. parkra néző, nincs utcazaj, por. A lépcsőház kulturált a bejárati ajtó, lépcsőház ablakok kivannak cserélve hőszigeteltre. Külön WC, fürdőszoba! A konyha az előtérből nyílik nem a szobán át kell megközelíteni, mint a legtöbb garzonban. Ingatlan ügynökök, hirdető cégek kíméljenek! ... további részletek >>

Érdeklődni: +36 30 575 3168, +36 70 588 8033


Feladva: 2017-10-07    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: Eladólépcsőházlakáskörbehőszigeteltredéli588nézőmintveszikcserélvenapfényes3168parkramegközelítenifalakkivannakemeleti575járólaposkelltöbbi

Forrás: pepitahirdeto.multiapro.com

Segítünk megvédeni mindent, ami Önnek fontos. Otthona, munkahelye biztonságát a távfelügyelet garantálja. Kiépítjük biztonsági rendszerét, távfelügyeletbe kapcsoljuk, és bármilyen riasztás esetén akár 5 percen belül a helyszínen a segítség. Mi nem jobbak, hanem másabbak vagyunk a konkurenciánál a professzionális vagyonvédelem területén!


Feladva: 2017-07-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: nemrendszerétmindentsegítségbiztonságimegvédenihelyszínenKiépítjükterületénSegítünkbelülgarantáljavagyonvédelemajánlópercentávfelügyeletHirdetőakár

Forrás: pepitahirdeto.multiapro.com

Ingatlant kínál, keres, cserélne, bérelne? Nézze meg a mi kínálatunkat! Eladó házak, lakások, irodák, nyaralók, telkek, panziók, üzletek, villák és sok más ingatlan a weboldalon. Országos hirdetési lehetőség, miután regisztrált nálunk, az oldal kezelése és a hirdetések feladása nagyon egyszerű - és ingyenes. Látogasson el Ön is az oldalunkra, és nézze meg a kínálatunkat!


Feladva: 2018-01-04    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kínálatunkatmegnézzenyaralókingyenesIstvánhirdetésiirodákegyszerűTormaOrszágoslakásoknagyontólweboldalonházakfeladásaIngatlanokingatlanEladó

Forrás: pepitahirdeto.multiapro.com

Modern és klasszikus olasz gyerekbútorok prémium kivitelben. Számtalan színből és elemből válogathat. Látogasson el üzletünkbe. 1093 Budapest Közraktár utca 20./a Telefon: 061-215-33-74


Feladva: 2017-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: olaszwwwBudapest1093klasszikusmatracfutarüzletünkbeModernLátogassonBútoráruházlineaflexbutorválogathatLineaflexwebelembőlgyerekbútor215színből061

Forrás: pepitahirdeto.multiapro.com

Ennyiért még szórólapot sem kap! Kezdő weboldalaknak, weboldalakon, webáruházakban megjelenő akcióknak és internetes figyelemfelhívásoknak kifejezetten ideális! Egyszerűen használható kezelőfelületen beállítható, módosítható, ha kell...


Feladva: 2017-06-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: 000szórólapotfigyelemfelhívásoknakméginternetesEnnyiértakcióknakajánlókellmegjelenőHirdetőmódosíthatówebáruházakbanPepitabeállíthatóweboldalakonért

Forrás: pepitahirdeto.multiapro.com

A torokgyulladás a torok égő, kaparó érzésével, nyelési nehézséggel jelentkezik. Ezt gyakran kíséri köhögési inger, hőemelkedés, de kisgyermekeknél akár láz is kialakulhat mellette. A torokgyulladás többnyire vírusos eredetű, a kórokozó kimutatása gyorsteszttel és tenyésztéssel is történhet. A mandulagyulladás és a torokgyulladás kezelése heveny esetekben megkívánja az antibiotikumok szedését. Ez a terápia teljes gyógyulást hoz, de mellette érdemes olyan étrendet is folytatni, ami kíméli a torok ... további részletek >>

nyálkahártyáját. Torokgyulladás és mandulagyulladás kezelése weboldalunkon!


Feladva: 2017-02-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: TorokgyulladásmandulagyulladásmellettetorokkezelésekaparótenyésztésselhőemelkedéshozégőgyorsteszttelingergyógyulástKittikimutatásanyálkahártyájátami

Forrás: pepitahirdeto.multiapro.com

Az Erő forrás alternatív gyógyászatban Előző életes utaztatásra (Reinkarnációs utazás) lehet jelentkezni. Megtudhatja hogyan élt, viselkedett, mit gondolt és érzett dolgaival kapcsolatban. Felhozhat jelenleg elfeledett emlékeket, kapcsolat rendszereire is válaszokat kaphat...


Feladva: 2017-10-12    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: ErőéletesElőzőéltalternatívemlékekethogyanforráselfeledettMegtudhatjajelenlegjelentkezniSzigetszentmiklósFelhozhatlehetforraskapcsolatbanutazás

Forrás: pepitahirdeto.multiapro.com

Hatékony német tanulás otthon, a Te beosztásodhoz igazítva, ingyen!


Feladva: 2016-12-18    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: németHatékonyZsuzsaKulcsárTanfolyamOnlineingyenigazítvabeosztásodhozotthontanulás

Forrás: pepitahirdeto.multiapro.com

Boti, ez a 1,5 év körüli,közepes nagyságú kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: 06 ... további részletek >>

70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagyörökbeSÜRGŐSgazdinakkutyamentsdgazdaGYEPMESTERIFogaddkellutánkörüliüzenetetnemBekerülésükNAGYONaltathatóBotihagyjeredetijövendőbeli

Forrás: pepitahirdeto.multiapro.com

Azért, mert a Gano Excel mellett már 4 éve elköteleztem magam, és amit életem egy jó lépésének tartok. Azért, hogy lecserélhesd a hagyományos kávéd egy egészséges és finom kávéra, amelytől jelentősen javul az energiád és a közérzeted. Azért, ganodermát, a spirulinát, és a Cordycepst tartalmaznak termékeink, és ezek jótékony hatására bármikor szükséged lehet. Egészség és szépség egy helyen! Azért, mert nekem már jövedelmem van ebből a „munkából”, és segíthetek Neked is ... további részletek >>

abban, hogy Te is tisztes jövedelemre tegyél szert. Persze csak akkor vagyok jó választás a számodra, ha neked is fontos a szabadság, az anyagi függetlenség és az egészség.


Feladva: 2017-08-16    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AzértegyegészségmárnekedhogymertExcelválasszakkorspirulináthagyományosmunkábólGanoszépségengemcsakganodermátlecserélhesd8222Tatabányalehet

Forrás: pepitahirdeto.multiapro.com

Marcali szálláshelyek fényképes gyűjtőoldala. Kiadó panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Szép kártya elfogadó szálláshelyek - Egész évben nyitva tartó szálláshelyek Marcaliban. - Weblap: www.zimmerinfo.hu/marcali/hu.htm


Feladva: 2017-07-20    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: marcaliszálláshelyekzimmerinfoKiadóhtmelfogadóárajánlatokkalkártyaapartmanokSzépnyaralóházakwwwnélkülvillákhttpdíjvendégházakWeblapközvetítési

Forrás: pepitahirdeto.multiapro.com

Fogyókúra vagy életmódváltás? Melyik illik hozzád? Ha felesleges kilóid vannak, akkor ne sokat habozz. Egy trendi fogyókúra másképpen, ahogyan még nem ismered. Hatásos, nem hízol vissza és segítséget kapsz a kúra használatához. Sok száz ember sikere nem véletlen. Neked is sikerülni fog. Tudj meg többet és lépj kapcsolatba velünk még ma. Azt kapod végeredményként, ami neked számít. Top forma túlsúly nélkül!


Feladva: 2016-10-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: nemmégtúlsúlyfogyókúranekednélkülszázmásképpenkapcsolatbaillikSokformalépjMelyikhasználatáhozToptrenditöbbetéletmódváltáskúraszámítEgyfog

Forrás: pepitahirdeto.multiapro.com

A Négy Évszak Magánóvoda szeretetteljes környezetet biztosít a bölcsőde és az általános iskola kapuja közötti úton. Szeretettel várjuk gyermekét a belváros szívében, a bankok és minisztériumok negyedében. Csoportjainkba az év közben is folyamatos a 2,5 és 7 év közötti korú gyermekek felvétele, amíg a szabad férőhelyek megengedik. Óvodánk három csoporttal működik, államilag regisztrált, OM azonosítóval rendelkezik: OM 202810. Jöjjön el, ismerjen meg minket...


Feladva: 2016-09-11    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: MagánóvodaközöttiközbenmegkapujaÓvodánkBudapestCsoportjainkbaismerjeniskolamegengedikPicurkanegyedébenJöjjönáltalánosférőhelyekBelvárosban202810

Forrás: pepitahirdeto.multiapro.com

Szia! Szeretném a nyáron nagyon kedvelt automata váltós, klímás bérautóimat bemutatni. A www.plusautorent.hu oldalon Opel, Suzuki, Renault, Ford Cvt automatic bérautóim megtekinthetőek akár 30% mennyiségi kedvezménnyel kiadók, bérelhetők. Autókölcsönzéssel 1992-tõl foglalkozom. 100% megbízhatóság, 24 év tapasztalat az autókölcsönzésben. Bérautóimat kiszállítom a bérlőnek a címére. Tel: +3630 9488730 Hello! I would like the summer is very popular with automatic transmission, air ... további részletek >>

conditioned rent a car present. The www.plusautorent.hu page Opel, Suzuki, Renault, Ford CVT automatic rent a car viewed by up to 30% volume discount publishers hired. Car rental deal since 1992. 100% reliability, 24 years of experience in car rental. I rental cars deliver the address of the tenant. Tel: +3630 9488730 Rent a car in Hungary, Budapest Hallo! Ich möchte den Sommer sehr beliebt ist mit Automatik-Getriebe, Klimaanlage Mietwagen vorhanden. Die www.plusautorent.hu Seite Opel, Suzuki, Renault


Feladva: 2017-12-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: carthe245RenaultSuzukirentalOpelRentplusautorentautomaticwwwBudapestBérautóimat9488730CVT3630100FordTel1992tenantHellovorhandensince

Forrás: pepitahirdeto.multiapro.com

Ne szalassza el a lehetőséget, hogy részese legyen az egyik legnagyobb szállítási vállalatcsoportnak, amely 100 évre tervez es amely részvényeinek értéke állandóan nőni fog! A SkyWay részvények tulajdonlása jólétet biztosít majd Önnek és családjának! Tehát nem érdemes sokat késlekedni a befektetéssel! A Sky Way részvényeit 2018-ben viszi a tőzsdére 1 $ db áron!! A befektetésednek köszönhetően már a közeljövőben a részvényeid hozamából élhetsz.


Feladva: 2017-09-23    [Pénzkeresés - MLM]

Címkék, kulcsszavak: amelyrészvényeidélhetszhozamábólhogyrészvényeitmajdlehetőségetWaybiztosíttervezközeljövőbenszalasszaSkyjólétetévremárÁgibefektetéssel100sokat

Forrás: pepitahirdeto.multiapro.com

A noni termékek A-, B-, C- és E-vitaminokat, nátriumot, magnéziumot, káliumot, vasat és sok antioxidánst tartalmaznak. Minden korosztály számára fontos tápanyagok ezek, melyekhez a gyümölcsből természetes formában juthatunk hozzá. A noni ital sokféle hatását nemcsak a polinéz törzsi gyógyítók tapasztalatai alapján ismerjük, de ma már a tudományos alapokon végzett vizsgálatok eredményei is sokat mondanak ennek a gyümölcsnek az előnyeiről. Több mint 100 bioaktív hatóanyagával már a sejtektől ... további részletek >>

segíti egészségünk megőrzését, immunerősítő és gyulladásgátló hatással is rendelkezik. Noni rendelés webshopunkban!


Feladva: 2017-07-26    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Nonimárgyógyítókjuicegyümölcsbőlsegítimondanakvasattörzsimelyekhezsejtektőlsokatkáliumotpolinézwebshopunkbanezekeredményeimagnéziumotnemcsak100

Forrás: pepitahirdeto.multiapro.com

Az EveNue a budapesti jelmezkölcsönző, ahol a változatos jelmezek között válogathatsz. Itt megtalálod a stílusodnak és alkalomnak megfelelő jelmezt! Farsangi jelmez, Halloween jelmez, party kellék, Star Wars jelmez, Darth Vader jelmez, kalóz jelmez, cica jelmez, boszorkány jelmez, pókember jelmez...


Feladva: 2016-10-05    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: jelmezjelmezkölcsönzőEveNuekellékpartycicamegfelelőbudapestikalózalkalomnakVaderstílusodnakVIIDarthmegtalálodBudapestWarsIttStarválogathatsz

Forrás: pepitahirdeto.multiapro.com

Vezetőket és munkatársakat keresek online munkához. Számodra mi a legfontosabb: - egészség? - pénz? - szabadidő? - anyagi függetlenség? Nem kell választanod, mert kitartó munkával mindegyik elérhető . Csatlakozz a Moringa Life csapatához. Velünk és egy automatizált rendszer segítségével építsd fel saját üzleted.


Feladva: 2017-06-15    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekVezetőketfelAlizelérhetőpénzépítsdKádármindegyikegészségsegítségévelmunkávallegfontosabbrendszerkitartóSzámodraautomatizáltmertcomegy

Forrás: pepitahirdeto.multiapro.com

Újra indul a családi házakra kiírt Napelem + infra fűtés 50%-s vissza nem térítendő állami támogatással program! Napelem szerelés kulcsra készen. Felmérés ingyenes, tervezés, árajánlat, engedélyeztetés, kivitelezés. Villanyszámla 0 Ft-os csekk és ha ezt kombináljuk infra fűtéssel, akkor a fűtése is ingyen lesz! A kora tavasztól késő őszig megtermelt többletáramot a szolgáltató télen visszaadja és a beruházás 5 év múlva megtérül. Utána ingyen áram évtizedekig.


Feladva: 2017-10-26    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: Napelemtérítendőnemvisszainfraingyentámogatássalengedélyeztetésállamimúlvainfrafutesleszárajánlatberuházásfűtéserendszertervezésvisszaadjaakkor

Forrás: pepitahirdeto.multiapro.com

Balatonföldvár és vonzáskörzetében lévő, kiadó szálláshelyek fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Több mint 1500 fényképpel a szálláshelyekről és a településekről! - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó balatoni szállások, szálláshelyek. - Egész évben nyitva tartó szálláshelyek ... további részletek >>

Balatonföldváron. - Weblap: www.zimmerinfo.hu/foldvar/hu.htm


Feladva: 2017-12-13    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekkiadózimmerinfoBalatonföldvárkártyadíjBalatonföldváronvillákSZÉPközvetítésipanzióktelepülésekrőlszálláshelynélnyitvatartóvendégházakévben

Forrás: pepitahirdeto.multiapro.com

Olcsó árak! Huawei Mate, Honor, Asus Zenfone, Asus Pegasus, Lenovo A, Lenovo Vibe, LeTv Le Eco, Mezu M, UleFone, UMI, Vernee Thor, Vernee Apollo, VKworld T1, VKworld G1, VKworld T3, Xiaomi Note, Xiaomi Redmi, Xiaomi MI. Minden egy helyen, minden a legjobb helyen.


Feladva: 2017-11-07    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: XiaomiVKworldLenovoAsusVerneemindenhelyenárakegyEcoOlcsóLeTvajánlásRedmiVibeHirdetőNotePepitaPegasusmobilApolloKínaiZenfoneThorHonor

Forrás: pepitahirdeto.multiapro.com

Vásároljon most kedvező áron. Minőségi háztartási termékek és konyharobotok! Miért érdemes itt vásárolni? · 14 napig visszaküldhető · Eredeti német termékek · Online fizetési lehetőség Modellek: Modern, Minimál, Klasszikus, Loft Konyhafelszerelések: www.klarstein.hu/Konyhafelszerel-s /Konyhai-seg-t-k/


Feladva: 2017-10-01    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: 183KenyersutogeptermékekfizetésiMiért8206OnlinekonyharobotokklarsteinszállítássalháztartásiwwwingyenesMinőségiKenyérsütőinkAkárnémetáronLoftitt

Forrás: pepitahirdeto.multiapro.com

Szerezzen izometriás csőszerelő képesítést, mely külföldön (pl. Németországban vagy Hollandiában) is egyre keresettebb fémipari hiányszakma. Tanfolyamunk távoktatásos, tananyagunkat ipari területen dolgozó cégek segítségével alakítottuk. További információk honlapunkon: www.cort-oktatas.hu/izometrias-cso szerelo-tanfolyam Telefon: 70/287-5525 E-mail: info@cort-oktatas.hu Nyilvántartási szám: 01169-2010 Tanfolyam végén akkreditált szakmai tanúsítvány több nyelven!


Feladva: 2017-10-18    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: Tanfolyamcsoszerelocortoktatasizometriásterületen2010Németországbanizometriasipari01169külföldöntananyagunkatszámmelyhttptávoktatásosNyilvántartási

Forrás: pepitahirdeto.multiapro.com

LEGYEN A TE TORTÁD IS EGYEDI! TortaFoto.eu - A weboldal ostya és cukorlap nyomtatással foglalkozik! Tortadíszítés, szülinapi torta, fényképes torták a saját fotóddal! Szállítás országosan!


Feladva: 2017-02-14    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TortaFotoSzállításostyafotóddalweboldalsajáttortákEGYEDIfényképesTORTÁDtortaLEGYENszülinapiOrszágosTortadíszítésfoglalkoziknyomtatássalországosan

Forrás: pepitahirdeto.multiapro.com

A fitt emberek webáruháza. Eredeti Body&Fit termékek Magyarországon. Étrend kiegészítő, sporttáplálkozási, diétás termékek. Fehérjék, aminosavak, protein szeletek, diétás édességek. Nézze meg weboldalunkat és adja le megrendelését.


Feladva: 2017-07-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: termékekFitBodydiétáshungaryproteinwebáruházabodyfitaminosavakemberekwwwFehérjékfittmegrendelésétBudapestadjasporttáplálkozásiweboldalunkatmeg

Forrás: pepitahirdeto.multiapro.com

Nálunk a kár nem kár! Óde-Car - 19 éves tapasztalat - biztosítási ügyintézés - ingyenes kölcsönautó - minőségi munka, minőségi anyagokkal - rövid határidő - garancia - fejlett technológia - családias légkör - márkafüggetlenség - szaktanácsadás - megbízhatóság Óde-Car Kft. 1117 Budapest, Budafoki út 70. 06-20-9374-593 06-70-666-7777 o decarkft@gmail.com www.karosszeriatjavit.hu


Feladva: 2016-04-27    [Autó - Motor - Jármű]

Címkék, kulcsszavak: CarÓdebiztosításiBudapestKftkárminőségiügyintézésfejletttapasztalat1117garanciakarosszeriatjavitéveshatáridőwwwrövidcomnemanyagokkalNálunk

Forrás: pepitahirdeto.multiapro.com

Folyamatos bélyeg vásár - Garantáltan a leírt állapotban! Folyamatosan színvonalas tételsorra licitálhat, mindezt otthonról, kényelmesen. Évtizedes tapasztalat - Online árverés kéthetente Aloldalaink: Eladóknak | Webshop | Aukciók


Feladva: 2017-07-12    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: vásárbélyegFolyamatosEladóknaktételsorraPepitaAloldalainkszínvonalaskéthetenteFolyamatosanárverésállapotbanOnlineleírttapasztalatGarantáltanÉvtizedes

Forrás: pepitahirdeto.multiapro.com

Kimerít a mindennapos rohanás? Vagy fásulttá tesznek a szürke hétköznapok? Már régen érezted szeretve magadat? Ha olyan masszázsra vágysz, ahol érzed, hogy szeretettel vagy érintve, akkor jó helyen jársz :) Ebben az órahosszában a figyelmem csak a tiéd, aminek hatására teljesen kipihentnek, ellazultnak fogod érezni magadat. A relaxált állapot már önmagában is beindítja a szervezet regeneráló folyamatait, aminek hatására gyógyulások mennek végbe a legkülönbözőbb területeken. Ezt ... további részletek >>

még fokozhatjuk azzal, hogy a kezelés elején immunerősítő energiákat indítok el, ami a masszírozás ideje alatt végig dolgozik a test izmaiban, sejtjeiben. Aki erre vágyik, szívesen jön vissza újra és újra és újra ... Ha kipróbálnád Te is, szeretettel várlak Kecskeméten a Széchenyivárosban csendes környezetben. www.egeszseg-wellness.hu/masszazsok


Feladva: 2017-07-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: újravagymárszeretettelmagadathatásárahogyaminekvégigfogodKutiazzalakkorvisszafolyamataithétköznapokalattellazultnakmasszázsfokozhatjukérintve

Forrás: pepitahirdeto.multiapro.com

Ha gyűjtöd a hanglemezt, ajánlom figyelmedbe a Rock LP oldalt. Rock, Pop, Disco, Soul, Funky, Jazz, Blues... Kedvező árfekvésben.


Feladva: 2016-07-18    [Zene - Hangszer]

Címkék, kulcsszavak: RockBluesgyűjtödJazzBudakesziFunkyTiborSoulBotkaDiscoVinylPopBakelitHanglemezoldaltfigyelmedbeárfekvésbenajánlomKedvezőhanglemezt

Forrás: pepitahirdeto.multiapro.com

A Nash H-Gun botzsákban egyszerre 3 darab 360-as bojlis/pontyozó horgászbotot tárolhatunk. Az extrán párnázott belsőnek köszönhetően botjaink és orsóink is tökéletes biztonságban vannak. 12 hónap garancia, számlaadás. A kiszállítás ingyenes! Webshopunkban azonnal megrendelhető: www.globalstore.hu/shop/nash-h-gun-12ft-3-rod-holldal-botzsak/ További jellemzők: - Nagyméretű külső cipzáras zseb, mely merítőszák vagy ernyő tárolására alkalmas. - Külső cipzáras zseb, melyben például ... további részletek >>

leszúrók tárolhatók. - Erős anyagokból készült, megerősített dupla varrásokkal, megbízható hosszú életű cipzárakkal. - Párnázott fogantyú, állítható vállpánt. - Alumínium merevítő a megfelelő stabilitás miatt.


Feladva: 2017-10-04    [Sport - Kemping - Túra]

Címkék, kulcsszavak: zsebcipzárasKülsőgunPárnázottnashmerítőszákpontyozócipzárakkalshopHorgászbotleszúrókvannakmelybojliséletűglobalstorepéldáulbiztonságbanmiatt

Forrás: pepitahirdeto.multiapro.com

Ékszerek, kifutó termékek 100 Ft-ért, akár 90-95 %-os kedvezménnyel a Lili Bizsu webáruházban! www.lilibizsu.hu/modules.php?name= lista&id=59a07a381ca4x-100-FORINTOS -EKSZEREK Emellett több mint 1000 féle ékszer és divatkiegészítő egy helyen, akár ingyen házhoz szállítással!


Feladva: 2018-01-11    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: akárBizsuLiliékszerkifutóházhozEmellettÉkszerekingyenlilibizsuWEBÁRUHÁZwwwakcióhelyenwebáruházbanegydivatkiegészítőkedvezménnyelféleért1000

Forrás: pepitahirdeto.multiapro.com

A bizsubolt webáruházban számos divatékszert, bizsut megtalálsz. Megtalálható nálunk a bizsuk széles választéka, úgy mint fülbevaló, karkötő, nyaklánc, gyűrű,zsinóros karkötő, barátság karkötő- és nyaklánc. A kislányokról sem feledkeztünk meg, taláható divatékszer webáruházunkban gyerek nyaklánc, gyűrű és karkötő. Megtalálható még nálunk saját készítésű, egyedi, kézműves ékszerek.


Feladva: 2018-01-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: karkötőnyakláncgyűrűnálunkmégMegtalálhatówebáruházbanfülbevalóbizsuboltmintékszerekCsávolygyerekúgykézművesAnitawebáruházunkbanválasztékaegyedi

Forrás: pepitahirdeto.multiapro.com

Neked már fizetett valaki azért, hogy kávét iszol? És szeretnéd, hogy fizessenek? Ha igen, jelentkezz a weboldalon: www.fekete.egeszsegeskave.hu/uzlet i_lehetoseg


Feladva: 2013-07-07    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyszeretnédpénztlehetosegiszolKeressuzletikávétKávézolegeszsegeskaveazértfeketevalakihttpfizetettweboldalonmárjelentkezzNekedigenErzsébet

Forrás: pepitahirdeto.multiapro.com

Egyedi, minőségi, széleskörűen testre szabható kutyaházak többféle méretben és kivitelben. Egyéni elképzelések megvalósítása. Szigetelt, akár fűtött kutyaházak gyártása... Számos választható extra felszereléssel!


Feladva: 2017-07-06    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: kutyaházakgyártásaminőségiEgyediszabhatótestrefűtöttszéleskörűenakárSzigeteltmegvalósításaajánlóelképzelésekHirdetőfelszerelésselEgyéniPepitaextra

Forrás: pepitahirdeto.multiapro.com

Bosch kondenzációs kazán csere! Vállaljuk régi gázkészülékek cseréjét az új jogszabályok szerint Bosch kondenzációs gázkazánra. Ha megbízható, gazdaságos és a lehetőségekhez képest a legolcsóbb cirkót szeretne, akkor a Bosch (Junkers) Condens 2500, vagy a Condens 3000 a legjobb választás! Megbízható, stabil működés, rengeteg kiegészítő lehetőség, pl. szolár bővíthetőség, remek szerviz háttér! Akár 1-2 napon belül meg tudjuk oldani a kazáncserét! Tudunk segíteni a kémény bélelésben is!


Feladva: 2016-05-07    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BoschJunkersMegbízhatószervizcsereCondensBudapestkondenzációsmegszerintrengetegbelüljogszabályokműködésakkornaponcseréjétstabilszeretneAkár

Forrás: pepitahirdeto.multiapro.com

Az ország egész területén állunk rendelkezésükre! Küldje el hozzánk javítandó laptopját. Nincs kedve sok kilométert utazni a legközelebbi szervizig, otthagyni a gépet, majd újra visszamenni érte? Lehet egyszerűbben és kényelmesebben is javíttatni a laptopot. Rendeljen futárt hibás laptopjáért, amikor Önnek jó, ahova Önnek kényelmes. Az ország egész területén állunk rendelkezésükre!Futárszolgálattal az ország bármely településéről el tudja elküldeni részünkre a javítandó laptopot Küldje ... további részletek >>

el szervizünknek javításra! Milyen laptop hibákat javítunk? Lassú, problémás laptop javítása. Túlmelegedő, lefagyó laptopok javítása. Hardver problémák elhárítása. Laptop bővítés, korszerűsítés. Vonalas telefonszámunk: +36-1-709-10-86 Mobil telefonszámunk: +36-20-265-75-30


Feladva: 2017-11-26    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: LaptopországrendelkezésükrejavításaKüldjetelefonszámunkállunklaptopotterületénjavítandóegészÖnnekLaptopszervizcenterHardverfutártszervizünknek265

Forrás: pepitahirdeto.multiapro.com

A lakásfelújítás stressz mentes lebonyolításáért hívjon minket, bontástól a kulcsátadásig, nálunk minden egy kézben.


Feladva: 2017-03-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: lakásfelújításkulcsátadásigBudapestenbontástólminkethívjonlebonyolításáértmentesstresszkézbenegyBudapestmindenÁdámnálunkHomenszki

Forrás: pepitahirdeto.multiapro.com

Örömmel adom tudtodra, kedves verskedvelő olvasóm, hogy az 1 kép 1 vers oldalamon található verseim első négy kötete megjelent. (2.350 Ft/kötet + 1.000 Ft szállítási költség) Országosan megrendelhető. Várom megrendelését! Facebook-on is: facebook.com/versakephez


Feladva: 2015-09-30    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: verseskönyvekköteteverskedvelőhttpnégykedvesWebáruházelsőtudtodramegrendelésétverseimadomVáromtalálhatóÖrömmelköltségoldalamonDunakeszivers

Forrás: pepitahirdeto.multiapro.com

A száj fertőtlenítő propolisz fogkrém használata természetes módját jelenti a rendszeres fogápolásnak. Vele javíthatjuk a fogak és az egész szájüreg egészségét, elejét vehetjük a gyakran a fogak elvesztését okozó ínybetegségnek. A propolisz hatásai a fogakra kórokozó ellenes tulajdonságainak köszönhetőek. A benne lévő flavonoidok gondoskodnak a baktériumok távol tartásától és legyőzéséről, ha azok már megfertőzték a szájüreget. Használata ajánlott azoknak is, akik már ínygyulladással vagy ... további részletek >>

fogínyvérzéssel küzdenek. A száj fertőtlenítő propolisz fogkrém véd a szájpenész és az afták ellen is. www.propolisz.fluormentes.com/propolisz-tinkturat


Feladva: 2017-07-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: propoliszfogkrémfogakHasználatafertőtlenítőszájmárelvesztésétajánlottrendszereslévőjelentibennegyakranmódjátszájüregetköszönhetőekvehetjükelejét

Forrás: pepitahirdeto.multiapro.com

Értékesítőket és Hálózatépítőket keresek az ország minden területéről! Olyanok jelentkezését várom akik szeretnének elérni valamit az életükben és vannak céljaik! Lehetsz: - munkanélküli - gyesen, gyeden lévő anyuka - 18 életévét betöltött diák - nyugdíjas - vállalkozó - vagy aki jövedelmét szeretné kiegészíteni Aki komolyan foglalkozik vele rövid időn belül lehet akár Főállás is! Feltétele a munka kezdéshez: - Internet elérhetőség - Jó kommunikációs készség - Akarat - Kitartás - ... további részletek >>

Célok Akinek felkeltettem az érdeklődését és szeretne a munkatársam lenni, írjon!


Feladva: 2017-01-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekHálózatépítőketÉrtékesítőketszeretneAkivállalkozóAkaratcéljaikmindenbelülnyugdíjaskészségvannakországidőnírjondiákkommunikációséletükben

Forrás: pepitahirdeto.multiapro.com

Mobil- és infocuccok akár ingyenes szállítással, garanciával. www.techdiszkont.superwebaruhaz.hu /mobiltelefon-k79599 HP, Acer, ASUS, Samsung, LG, Nokia, Alcatel, Genius, Canyon és egyéb márkák választéka.


Feladva: 2017-03-31    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: techdiszkontMobilASUSMobilboltAcersuperwebaruhazválasztékamárkákwwwegyébgaranciávalCanyonszállítássalGeniusingyenesAlcatelakárNokiainfocuccok

Forrás: pepitahirdeto.multiapro.com

Egyedi tervezésű, fából, kézzel készült, pirográffal (fába égetési módszerrel) gravírozott, tollak, tolltartók, ékszerek, táblák, fali órák, és egyéb kis fa csodák... A termékeket a saját elképzelésed szerinti szöveggel, grafikával és névre szólóan is elkészítjük számodra. Sokféle alkalomra ötletes, és igazán személyhez szóló ajándék.


Feladva: 2017-09-21    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ajándékelkészítjükKedvesegyébpirográffalszólóanórákkészültnévrefalikézzelgrafikávaltáblákszólófábólszöveggelékszerekszemélyheztervezésűszerinti

Forrás: pepitahirdeto.multiapro.com

C#.net programozó állás Debrecenben! Friss diplomásoknak, végzős Programozó és Informatikus hallgatóknak... Feltételek: - Felsőfokú szakirányú végzettség - Minimum középfokú angol nyelvtudás - A programozás szenvedélyes szeretete Részletek: www.jobs.ozeki.hu/index.php?owpn=2 5 Jelentkezés módja: A job@ozek i.hu e-mail címre beküldött fényképes önéletrajzzal és a pozícióhoz kapcsolódó jelentkezési adatlap pontos kitöltésével. Folyamatosan várjuk a jelentkezőket!


Feladva: 2016-03-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: netProgramozójob@ozekiszakirányúpontosmódjaFelsőfokúadatlapOzekiJelentkezésFeltételekjelentkezésifejlesztőszeretetehallgatóknakkapcsolódószenvedélyes

Forrás: pepitahirdeto.multiapro.com

Fülcsi, ez az aranyos, 1 év körüli,közepes nagyságú szuka kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni ... további részletek >>

lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagyFülcsitelepenkutyagazdaörökbeGYEPMESTERISÜRGŐSgazdinakNAGYONaltathatóaranyoshagyjeredetijövendőbelijelentkezésétjelentkezéseazonnalárát

Forrás: pepitahirdeto.multiapro.com

A fogszabályozás kiváló lehetőséget jelent Önnek fogai megszépítésére. Jöjjön el rendelőnkbe és ismerje meg a személyre szabott lehetőségeit egy térítésmentes konzultáció keretében. A konzultációra a +36 30 853 1903 -as számon tud jelentkezni.


Feladva: 2017-02-24    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogszabályozásfogszabalyozascentrumegylehetőségethttplehetőségeitkiválójelentkezniszemélyreszabotttudmegBudapestszámonismerjeBudán1903rendelőnkbe

Forrás: pepitahirdeto.multiapro.com

Kedves Látogató! Holecskó János vagyok, a HJ-Graphics Studio vezetője. Fő tevékenységek: portré, figura rajz és festés, grafikai tervezés, dekorációs falfestés – art&design. Több mint 16 éve rajzolok, festek, foglalkozom elektronikus grafikával, végzettségem szerint keramikus vagyok. Remélem, hogy munkáim elnyerik tetszését. Ha valóban művészi szintű ajándékkal akar kedveskedni szeretteinek, vagy csak vágyik egy szép rajzolt emlékre, keressen bizalommal. Tekintse meg munkáimat!


Feladva: 2015-02-20    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: dekorációsJánosHolecskóvagyokportréfalfestésegytetszésétfoglalkozomvágyiktervezéselnyerikfestekcsakgrafikaimunkáimLátogatómunkáimatrajzolokvagy

Forrás: pepitahirdeto.multiapro.com

Kitartó, lelkes embereket keresek Bio termékek katalógusból történő árusításához. A munka teljes mértékben otthon végezhető, és nagyon egyszerű, mivel AUTOMATIZÁLT WEBOLDAL segítségével történik, költség és kötelezettségmentesen. Gyes mellett, nyugdíj mellett, de akár munka mellett is, minimális időráfordítással növelheted a bevételed. MUNKATÁRSKÉNT stabil jövedelem lehetősége egy nemzetközi üzlet partnereként - Nincs felső korlát. Annyit kereshetsz, amennyit csak szeretnél. - Az EU ... további részletek >>

országaiban is nyitott a lehetőség! Válassz most BIO készítményeket a mesterséges szemét helyett! Nézd meg a KÍNÁLATOT: www.egeszsegbomba.mylifecare.hu 100% elégedettségi garancia! Regisztrációs és tagsági díj helyett ajándékokkal és folyamatos akciókkal várunk Téged: + AJÁNDÉK utalvány + AJÁNDÉK VIP hűségkártya + AJÁNDÉK katalógus + AJÁNDÉK magazin + AJÁNDÉK termék Hozd létre ingyenesen felhasználói Partner fiókodat és rakd kosárba meglepetéseinket! Ha kedvet érzel hozzá, és szívesen keresnél pénzt ilyen formában, akkor részletesen tájékozódhatsz a weboldalon. Jelentkezzél fel hírleveleinkre is! www.egeszsegbomba.mylifecare.hu A felmerülő kérdéseidre szívesen válaszolok az alábbi e-mail címen: szerencseneked@gmail.com


Feladva: 2016-11-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AJÁNDÉKmellettmunkahelyettszívesenBIOmylifecareegeszsegbombahttphírleveleinkreakciókkalnemzetközikeresekhozzámegcímenHozdszeretnélegyszerűfel

Forrás: pepitahirdeto.multiapro.com

Szeretnél sütemény-, torta- vagy bonbonkészítéssel foglalkozni? Mindig is szeretted a különleges desszerteket és oda vagy a főzött, kézműves fagylaltokért? Olyan tanfolyamra jelentkeznél, ahol kulturális környezetben, modern eszközök segítségével tanulhatsz? Jelentkezz Budapesten induló Cukrász OKJ-s tanfolyamunkra! A Cukrász tanfolyam árát, akár részletekben is kifizetheted. A tanfolyam időtartama 9 hónap, így rövid időn belül kezedbe veheted az OKJ-s bizonyítványt. A tanfolyamhoz mindössze ... további részletek >>

alapfokú iskolai végzettség szükséges. Ha érdeklődnél vagy jelentkeznél a Cukrász tanfolyamra, akkor kattints az oldalunkra és töltsd ki az űrlapot: www.tanfolyamokj.hu/cukrasz-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: tanfolyamCukrászokjbudapestenvagytanfolyamokjtanfolyamrajelentkeznélbelülsüteményindulókézművesérdeklődnélidőnSzeretnélJelentkezzhttpsszükséges

Forrás: pepitahirdeto.multiapro.com

Szívből - Jövő című könyvem szívből ajánlom a szépirodalmat, verseket kedvelő kedves olvasóknak. Megrendelni a webáruházban lehet: www.verses.boltaneten.hu/kinalat/1 __aranyosi_ervin_versei


Feladva: 2015-09-19    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: ervinaranyosiszívbőlverseikedvesmegjelentkedvelőversesköteteverseketlegújabbkinalatszépirodalmatboltanetenajánlomverseshttpkönyvemlehetcíműJövő

Forrás: pepitahirdeto.multiapro.com

Folyamatos, megbízható jövedelemre van szükséged, de nem tudsz, vagy nem akarsz munkahelyre bejárni? Egészségi állapotod vagy családi körülményeid miatt nem tudsz folyamatosan dolgozni? Akkor szeretnél pihenni, amikor szükségét érzed, és nem akkor, amikor a főnök engedi? Van egy jó és egy rossz hírem. A jó hír az, hogy tudok ajánlani ilyen lehetőséget. A rossz az, hogy ezért ki kell nyitnod a pénztárcádat. Nem kell mélyen belenyúlni. Pontosabban bizonyos keretek között mindenki maga dönti el, ... további részletek >>

mennyit tud áldozni a későbbi jövedelme érdekében. A bevételed a Nap energiájából fog származni, és ameddig a Nap süt, addig biztosan lesz bevételed. Megér ez neked 600 Ft-ot? Netán többet? Bővebb információt a facebook oldalamon találsz: www.facebook.com/sunmoneyzl


Feladva: 2017-10-22    [Pénzkeresés - MLM]

Címkék, kulcsszavak: NemkellNapegyVantudszhogyrosszamikorbevételedakkorfacebookvagytudpihenniinformációtbejárniLégysüthírmennyitszeretnélBővebbmunkahelyre

Forrás: pepitahirdeto.multiapro.com

Ha szeretné, hogy az elromlott számítógépe, laptopja a lehető legrövidebb időn belül újra hibátlanul működjön, hívja szervizünket! Díjmentesen házhoz megyünk Debrecenen belül! A hét minden napján 0-24h rendelkezésre állási idővel! Szolgáltatásaink: - Helyszíni karbantartás, Hibaelhárítás, tanácsadás, elromlott alkatrész beszerzése, cseréje, javítás - Vírusirtás - Rendszerköltöztetés - Windows újratelepítés (XP,7.8.10) - Számítógép sebesség növelés, rendszer optimalizálás - ... további részletek >>

Vezetékes, vagy vezeték nélküli hálózati eszközök pl. nyomtató hálózatba kötése - Otthoni vagy munkahelyi számítógépes hálózat kiépítése, bővítés - Komplett céges és irodai rendszerek karbantartása - Adatmentés sérült, törölt vagy hibás partíción lévő adatokról - Törölt fájlok visszaállítása - Számítástechnikai - informatikai eszközök és termékek forgalmazása - Weblap és Webshop készítése rövid határidővel


Feladva: 2017-08-24    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: vagyeszközökelromlottSzámítógépbelülTöröltSzolgáltatásainkKomplettházhozWebshopnélküliVírusirtásszámítógépelévőidővelbővítésDíjmentesenWeblaphogy

Forrás: pepitahirdeto.multiapro.com

Velence-korzón Novotny Hajgyógyászat és Biofodrászat szépség szalon! Nemzetközi diplomával rendelkező hajgyógyászunk várja szeretettel. 20 éves tapasztalattal személyre szabottan analizáljuk és megoldjuk problémáját: - hajhullás - roncsolt haj Kezelés színenergiával és biológiailag aktív hatóanyagokkal. Tudományos, orvos-technikai módszerek, mikro-kamerás haj- és fejbőr vizsgálat. Vegyszermentes hajfestés, dauerolás. Kérjen időpontot!


Feladva: 2016-11-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: NovotnyhajVelenceHajgyógyászatbiológiailagévesfejbőrszínenergiávalszeretettelkorzónKezelésvárjakamerásroncsolthajgyógyászunkmikroGabriellahajhullás

Forrás: pepitahirdeto.multiapro.com

Hotelek, panziók, vendégházak, apartmanok, kiadó szobák, fényképekkel, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél. - Egész évben kiadó szállások. - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Kehidakustányban egész évben nyitvatartó termálfürdő, gyógyfürdő, élményfürdő várja vendégeit. - Weblap: www.zimmerinfo.hu/kehidakustany/hu .htm


Feladva: 2017-10-03    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kiadóévbenzimmerinfoegészszállásokapartmanokgyógyfürdőSZÉPvendégházaktermálfürdőhtmpanzióknyitvatartószálláshelynélkehidakustanyHoteleklehetőségwww

Forrás: pepitahirdeto.multiapro.com

Daruzással kapcsolatos munkák végzése. Gép, konténer, építőanyag szállítása, daruzása! Kis helyekre 1 tonnás mini darus autónk van!


Feladva: 2017-01-02    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: darusmunkákminikapcsolatostonnásDaruzássalhelyekreDebrecenKisIstvándaruzásaTóthszállításaKCRépítőanyagDaruzáskonténervanGépautónkvégzése

Forrás: pepitahirdeto.multiapro.com

A Piccolo Café Itália kávézóinak hangulatát hozza el Budapestre. Espresso alapú kávéinkhoz Caffé Danesit, egy méltán híres római kávé különlegességet használunk. Konyhánkat az egyszerűség, az egészséges táplálkozás és az olaszos ízek jellemzik. Paninit, szendvicseket szolgálunk fel kedves vendégeinknek, illetve igen népszerű nálunk az igazi olasz street food, az Emilia-Romagna tartományból származó Piadina (olasz lepénykenyér) is. Kávézónkban a hagyományos és paleo sütemények is kaphatók.


Feladva: 2016-01-02    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: olaszCaféPiccoloBudapestPaninithagyományosrómaiigazihangulatátjellemzikKávézónkbanhíresnálunkkávézóinakízeklepénykenyérméltánnépszerűItáliaegy

Forrás: pepitahirdeto.multiapro.com

Több mint ezer féle divatékszer és kiegészítő, mobil és táblagép kiegészítő, kozmetikai cikkek, ásványok, csillámtetoválás, pénztárca, tetoválás, óra, piercing és még sok minden más a lehető legjobb árakon. Rengeteg állandó és aktuális, egymással összevonható kedvezmény! Törzsvásárlói program és ingyenes kiszállítás! Ez mind és még sok minden más a LILI BIZSU Webáruházban. Ilyen olcsón még nem vásárolt....


Feladva: 2017-02-18    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: mégsokkiegészítőBIZSULILImásmindenlegolcsóbbanRengetegvásároltkozmetikaimindkiegészítőkárakonnemkiszállításÉkszereklegjobbtáblagépingyenesóra

Forrás: pepitahirdeto.multiapro.com

Szobafestésre, felújításra készül? Polisztirol hab lécek, stukkók, díszítőelemek. A könnyű hablécek és mennyezeti díszítőlécek segítségével szép mennyezetet tud kialakítani. Rozetták, álmennyezeti lapok, festhető 3 dimenziós dekorlapok nagy választékban. Kültéri díszlécek között keretező lécek, párkánylécek, osztólécek, szintelválasztók natúr vagy kéregerősített felülettel. Egyedi stukkók gyártásával is felkeresheti cégünket!


Feladva: 2017-10-27    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: PolisztirolKültérilécekstukkókEgyedidíszlécekbeltéritudfelülettelkészülmennyezetetkéregerősítettfelújításraválasztékbanszépvagySzobafestésrenagy

Forrás: pepitahirdeto.multiapro.com

Keszthelyi szálláshelyek fényképes gyűjtőoldala. Kiadó Hotelok panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron! - Több mint 1000 fényképpel a szálláshelyekről és a városról! - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Úszómedencével rendelkező szállások. - Egész évben nyitva tartó szálláshelyek Keszthelyen - Weboldal: ... további részletek >>


Feladva: 2017-11-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szállásokszálláshelyekKiadókeszthelyzimmerinfoTöbbelérhetőségükkelwwwelfogadóKeszthelyiáronárajánlatokkalhttpPihenőkártyalegolcsóbbapartmanokWeboldal

Forrás: pepitahirdeto.multiapro.com

Hölgyeim és Uraim! Engedjék meg hogy bemutatkozzam,Ábrahám Zsolt vagyok Esküvői és Parti Dj. Minőségi szolgáltatást nyújtok elérhető áron számlaképesen, országosan! Céges rendezvényre, Születésnapra, vagy egy fergeteges szilveszteri bulira is szívesen megyek. Elérhetőségem: 0620/274-0390 Az Őszi ár akció elkezdődött! 25%kedvezmény, minden Esküvő árából! Leinformálható nívós referenciával, komplett minőségi hang és fénytechnikával,(RCF hang, ledes lámpák fények, Pioneer Dj pult, Shure ill, ... további részletek >>

Sennheiser mikrofonok. Zenéim a hetvenes évektől napjainkig(retro, pop, rock, rock&roll, alternatív, funky, stb. Magyar és külföldi top slágerek, vagy igény szerint mulatós zenéimre táncolhatnak, IDŐKORLÁT NÉLKÜL akár hajnalig.www.edjbier.hu zsoltbraham@freemail.hu Budapest XXII. ker


Feladva: 2017-10-16    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: CégeshangminőségiBudapestrendezvényreZsoltrockÁbrahámvagynyújtokNÉLKÜLUraimMagyarkedvezményZenéimszilveszteriszolgáltatástIDŐKORLÁTRCFHölgyeim

Forrás: pepitahirdeto.multiapro.com

VÁRPALOTÁN 24.690 m2-es teleken 1.243 m2 összes beépítettségű raktárcsarnok, telephely eladó. A bruttó 1.400 m2-es raktárcsarnok épületen belül van 213 m2 iroda. 8 szintbeli ipari kapu biztosítja az árumozgatást. A területen gépjármű parkolás lehetséges. Parkolóhelyek száma 40 db. Kiemelt befektetési érvek: - Kiváló lokáció, közel a 8-as főúthoz - Tehergépkocsival megközelíthető - További fejlesztési lehetőségek a telek méretéből adódóan Ár: 100,- millió Ft+Áfa


Feladva: 2017-01-07    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: raktárcsarnokVÁRPALOTÁNeladógépjárműmillióépületenközelterületen100lokációVárpalotaárumozgatástadódóan400KiválóFerencbiztosítjaméretébőlbruttó

Forrás: pepitahirdeto.multiapro.com

A kiváló ár/érték arányú szett alkalmas zenehallgatásra, házimozira. A szett tartalma: Frontsugárzó: 806S:20-120W,53-25.000Hz,30x18x18cm,6,3 kg/pár Centersugárzó: 806C:20-100W,53-25.000Hz,18x50x18cm,5,1 kg Háttér sugárzók: 806S:20-120W,53-25.000Hz,30x18x18cm,6,3 kg/pár Házimozi erősítőt kedvezménnyel vásárolhat hangfalszettjeinkhez. A lap alján a Kapcsolódó termékeknél ajánlásként talál több házimozi rádióerősítőt, melyek a szettel való együttes rendelés esetén a megadott árakon ... további részletek >>

vásárolhatók meg. Amennyiben az ajánlottaktól eltérő erősítőt kíván rendelni a szetthez, kérje egyedi ajánlatunkat! Amennyiben kábelt is vásárol a szetthez, azokat a szettel rendelve kedvezőbb áron vásárolhatja meg. A választható kábeleket a lap alján található Kapcsolódó termékek ikonokra kattintva választhatja ki és rendelheti meg! A Taga Harmony európai (német és lengyel) alapítói a 90’-es évek eleje óta dolgoznak a HIFI -és High End audió területén. Azt tapasztalták, hogy sok piacon lévő, kitűnő minőségű termék túl magas árkategóriát képvisel. Ez arra késztette őket, hogy megalkossák saját márkájukat, a Taga Harmonyt. Megelégedve az alacsonyabb gyártói árréssel is kitűnő ár/érték arányú hangszórókat fejlesztettek. Küldetésük és filozófiájuk, hogy olyan termékeket kínáljanak, melyeket a pontosság, a lenyűgöző hanghatás, erős és tökéletesen definiált basszus, valamint szenzációs dinamika jellemez. E cél elérése érdekében profi mérnökök és tervezők - akiknek szenvedélye az alkotás - több száz órát töltenek el minden egyes termék kifejlesztésével. Az ismételt hallgatási tesztek és sokszoros mérések során igyekeznek kiköszöbölni minden lehetséges hiányosságot, hogy a végtermék tökéletes legyen. A folyamatos minőséget a modern gyártósorok és korszerű mérőeszközök biztosítják. Ma már az audió hangszórókon, hangfalszetteken túl erősítőket, multimédiás eszközöket és High End termékeket is kínálnak. www.hangkepstudio.hu/hangfal/hangfalszett-5-0/taga-tav-806s-5-0-hangfalszett


Feladva: 2017-04-12    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: 806ShogyTagahangfalszett000Hzmegpárérték30x18x18cmtöbbkitűnőTAVszettelerősítőtszettKapcsolódó120WtermékeketházimoziaudiószetthezaljánEnd

Forrás: pepitahirdeto.multiapro.com

10 éve működő tánc tanfolyam várja új kis tanítványait! 4-14 éveseknek. Helyszínek: XVI. kerület (Erzsébetligeti Színház, és Mltc Sportklub. XIV. kerületi Németh I. Ált.Isk. Korosztály szerint több csoportban: balett alapok, táncelőkészítő gimnasztika, videoklip táncok,divattáncok, színpadi show táncok, musicalek ... Fellépések, nyári napközis tánctábor. 5200 Ft/hó.


Feladva: 2017-02-17    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: kistánctáncokXVIvideoklipNémeth5200tanítványaitgimnasztikakerületitánctábortáncelőkészítőXIVnapközisvárjaalapokSportklubnyáritanfolyambalett

Forrás: pepitahirdeto.multiapro.com

Rongyszőnyegek: A másra már nem használható, nagyobb darab farmeranyagokból készítjük. A rongyszőnyegek általában a kék különböző árnyalataiban készülnek, de gyártunk fekete, szürke, ritkábban barna színekben is. Az összes rongyszőnyegünk kézi szövésű. 70 cm szélesek és 70 cm-től 6 méteresig mindenféle méretben gyártjuk. Kérésre egyedi méretekben is! Kreatív szőnyegek: Ezeket a szőnyegeinket a farmernadrágok zsebeiből, ülepéből, övrészéből, stb készítjük. Kézzel varrottak, ezért az összes ... további részletek >>

darab teljesen egyedi. A gyakoribb méreteken kívül, megrendelésre egyéb méretekben is elkészítjük őket. Nézze meg a szőnyegeinket! www.oldblue.hu/index.php/szonyegek


Feladva: 2017-04-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: rongyszőnyegekszonyegekszőnyegeinketegyedidarabösszesKreatívméretekbenkészítjükstbnemoldblueméteresigméretekengyártunkövrészébőlmárwwwtőlmásra

Forrás: pepitahirdeto.multiapro.com

Ami egy házhoz kell Ha többet akar tudni, nézzen körül Akció !!!!!!!!! Itt www.vteam.hu www.vteam.hu/Komuves-munka www.vteam.hu/Kerites-epites www.vteam.hu/Lakasfelujitas Lakásfelújítás legkisebbtől a legnagyobbig. Ingyenes árajánlat. Mindenféle, ami egy ház és lakáshoz kell Viacolor- térburkolat Lakásfelújítás burkoló munkák Kerítés építése Gipszkarton Kőműves munkák Dryvitozás homlokzatjavítás Ajtó ablak csere Falazás, vakolás


Feladva: 2015-03-10    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: vteamwwwhttpmunkákKőművesegyamiKerítésLakásfelújításlegnagyobbiglegkisebbtőlkellDryvitozástöbbetlakáshozházhozházkerepitesGipszkartonXXIII

Forrás: pepitahirdeto.multiapro.com

Duguláselhárító csapatunk azonnal áll az Ön rendelkezésére,hétvégén és akár ünnepnapokon is a megfelelő szakértelemmel! Duguláselhárítást elsősorban Budapesten és Pest megyében vállalunk, keressen a megadott elérhetőségeink egyikén. A kiszállási díjakról és a tájékoztató árakról olvassa el Árak oldalunkat is. 2 órán belül – Belvárosban, Zuglóban, Rákospalotán, Újpesten, Szentmihályon, Angyalföldön, Budán – valamint a I. II. III. IV. V. VI. VII. VIII. IX. X. XI. XII. XIII. XIV. XV. ... további részletek >>

XVI. kerületekben. A XVII. XVIII. XIX. XX. XXI. XXII. XXIII. kerületekben és Pest megye területén is 1 órán belül megjelennek szakembereink. www.dugulastelharitunk.hu +36 70 218 2224


Feladva: 2018-01-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: Pestkerületekben8211belülóránÚjpestenZOOmegyeegyikénXIIIünnepnapokonRákospalotánDUGULÁSELHÁRÍTÁSelérhetőségeinkXIIakár2224ZuglóbanmegadottVIII

Forrás: pepitahirdeto.multiapro.com

A méh pempő nemcsak étrendkiegészítőnek kiváló, de a bőr- és hajápoláshoz is az egyik legjobb termék. A méhek állítják elő, hogy ezzel a sűrű, ragacsos anyaggal táplálják királynőjüket. A méh pempő áldásos hatásait az ember már korán felfedezte és alkalmazza ma is szinte valamennyi betegség ellen sikeresen. Hatásait annak köszönhetjük, hogy benne rendkívül sok hasznos anyag található. A létfontosságú tápanyagok mellett számos más értékes összetevőt tartalmaz, többek közt acetilkolint és 10-HDA ... további részletek >>

savat is. Ezek adják intenzív gyulladásgátló antivirális és az agyműködést elősegítő hatásait.


Feladva: 2017-07-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásaithogypempőméhkiválóértékessűrűbenneétrendkiegészítőnekintenzívkoránmásezzelnemcsakadjákmárszámoselőköszönhetjükKittiEzekemberannak

Forrás: pepitahirdeto.multiapro.com

20 éves tapasztalattal vállalunk magas minőségben kárpittisztítást Budapesten. Igény estén az Ön otthonában szakszerűen megtisztítjuk padlószőnyegét, ülőgarnitúráját. Irodai szőnyegek tisztításában nagy gyakorlatunk van. Bármilyen kárpitos felület tisztítását vállaljuk, amit lehet vizes-mosószeres módon tisztítani. A textilek több, mint 90 %-a tisztítható. Nagy rutinunk van folteltávolításban. Leragasztott padlószőnyeg tisztítást német technológiával és gépekkel végezzük. Rágógumit ... további részletek >>

nyom nélkül ki tudunk venni!! Autó kárpittisztítás-t is a megadott helyszínen végezzük el. Irodai székek és ágybetétek tisztítását is vállaljuk. A tisztítást kérheti szerint magas tisztítóhatású BIO minősítésű szerrel is!


Feladva: 2017-01-21    [Lakossági szolgáltatás]

Címkék, kulcsszavak: minőségbenmagasvállalunktapasztalattalévesBudapestJánosUjlakikárpittisztításBudapestenProfikárpittisztítást

Forrás: pepitahirdeto.multiapro.com

Igényes megjelenésű klímás autók sofőrrel kérhetőek. Kiállás Budapesten díjtalan. Autóink rendelhetők már 6.000.-/óra díjtól. Számoljon velünk, részletekért klikkeljen a www.szepauto.5mp.eu oldalra.


Feladva: 2017-03-20    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: KiállásCsaládivelünkkérhetőekpartiSzámoljonsofőrrelCégesdíjtólautókRendezvényóraklímásAutó000megjelenésűoldalraEsküvőmárIgényes5mpRichárd

Forrás: pepitahirdeto.multiapro.com

Fedezd Fel Magadban az Igazi Sikeres Nőt! Nem tudsz megfelelően érvényesülni az Életedben, nem vagy elég Magabiztos, nem tudod, hogyan bánj a Férfiakkal, vagy csak szimplán nem tudod, hogy lehetsz az életed minden területén Sikeres NŐ? Mi megmutatjuk és megtanítjuk, hogy egyediségedben vagy csodálatos! :) Gyere, vágj bele és olyan gyakorlati tanácsokat kapsz szakembereinktől, amikkel megértheted hol a hiba és ki tudod hozni Magadból a MAXIMUMOT Nőként! Most őszi akciónk keretein ... további részletek >>

belül, 50% kedvezménnyel vehetsz részt a kurzuson! Jelentkezz, minél hamarabb le ne maradj Róla! :) Jelentkezz: www.starsofthefuture.hu/jelentkezes Weboldal: www.starsofthefuture.hu/az-igazi-no-trening


Feladva: 2016-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nemvagyigaziSikerestudodJelentkezzNőtMagadbanhogyFelFedezdwwwhttpTheWeboldalvágjkedvezménnyeléletedérvényesülnihibaStarsjelentkezesGyere

Forrás: pepitahirdeto.multiapro.com

Nadrágok, ruhák, szoknyák és kabátok rövidítését, szűkítését, vagy karcsúsítását vállaljuk rövid határidőre, korrekt áron. Cipzárcsere, cipzárjavítás szakszerűen! Cím: Budapest IX. Tompa utca 22. Ruhaszerviz Nyitva: h,sz,p,: 9,15-17,00-ig k,cs,: 10,00-18,00-ig A szombati nyitva tartásról érdemes előzetesen érdeklődni! Tel.: 06-1-215-7047 Várom szeretettel! www.divatruha.hu/index.php?page=ru haszerviz


Feladva: 2016-07-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: RuhaszervízFERENCVÁROSBANNEKEDBudapest251kítésétérdeklődjöncipzárjavításrövidítésétnyitvatartásrólCipzárcserekabátokszombatiáronszoknyákNyitvakorrekt

Forrás: pepitahirdeto.multiapro.com

Dormán László mosógépszerelõ vállalja Whirpool, Ignis, Polar, Energomat, Minimat, Midimat, Energolux, LG, Zanussi, NDK-s WA tipusú, stb. automata mosógépek javítását. MOSÓGÉPSZERVIZ KISPESTEN a kerületben lakóknak, mosógépszerelés munkanapokon, akár 4 órán belül is lehetséges. Mosógépszerelés: Erzsébet, Kõbánya, Pestlõrinc, Pestimre, Csepel, Soroksár, Ferencváros, Józsefváros, Kispest és a XVII. ker.-ben. www.mosogepszereles-javitas.hu


Feladva: 2016-03-14    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 245MosógépszerelésDormánkerLászlówwwZanussirinclakóknakhttpEnergoluxXIXkerületbenbenMidimatPestlBudapestKISPESTENMinimatbányaMOSÓGÉPJAVÍTÁS

Forrás: pepitahirdeto.multiapro.com

Budapesten a XIV kerületi modern irodánkba keresünk lelkes, jól kommunikáló, telefonálni szerető operátorokat. A munka 6 órában végezhető, rugalmas beosztás mellett. Kezdők, tapasztaltak, diákok és gyermekes anyukák jelentkezését is várjuk! Fizetés: bejelentett jövedelem (fix alapbér -és mozgó bér a megkötött szerződések után) Leendő munkatársunk feladatai: - kimenő hívások indítása kizárólag vidéki területek irányába - script alapján beszélgetés irányítása - hívások adminisztrációja ... további részletek >>

Amit kínálunk: - nyugodt, modern munkakörnyezet - profi betanítás (kommunikációs- és értékesítés-technikai és szakmai ismeretek) - stabil háttér, hosszú távú munkalehetőség - összetartó közösség Elvárásaink: - kiváló kommunikációs készség, - felhasználó szintű számítógépes (Microsoft Office) ismeretek, - értékesítésben vagy call centerben szerzett tapasztalat előnyt jelent - lelkes, céltudatos hozzáállás - pozitív gondolkodású személyiség Amennyiben a fenti elvárásoknak megfelel és szeretne kellemes irodai munkakörnyezetben dolgozni, akkor várjuk a fényképes önéletrajzát a varadi.szabolcs@alphaphone.hu e-mail címre.


Feladva: 2017-10-31    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: lelkesmodernhívásokrugalmasvárjukkommunikációsXIVismeretekirodaiösszetartószerződésekSzabolcscéltudatosmunkakörnyezetgyermekescímreOfficeirányába

Forrás: pepitahirdeto.multiapro.com

Varázslatos gyermek ruhák – Vásárolj olcsón otthonról! Új tavaszi,nyári kollekció amivel kislány álmok válhatnak valóra! Gyors szállítás! Új és használt kislány alkalmi és ünneplő ruhák elérhető áron.


Feladva: 2017-04-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: ruhákkislányáronelérhetőhasználtolcsónszállításVásároljGyors8211valóragyermekválhatnakVarázslatosálmokBudapestamivelButikkollekcióManóruha

Forrás: pepitahirdeto.multiapro.com

Energetikai tanúsítvány készítése Kecskeméten és Bács-Kiskun megyében ingatlanok adásvételéhez, illetve bérbeadásához, pályázatokhoz! Rövid határidővel, olcsón!


Feladva: 2015-06-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: tanúsítványEnergetikaikecskemetKiskunBácsKecskemétenolcsónhatáridővelrövidkészítésepályázatokhozbérbeadásáhozilletvevételéheztanusitvanyadáswww

Forrás: pepitahirdeto.multiapro.com

Budafok kertvárosi részén családi házrész korrekt áron eladó. Külön bejárat, önálló épület, jó műszaki állapot. Az eladó részhez kiskert és szuterén is tartozik. - További infó a weboldalon


Feladva: 2017-02-26    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóTovábbiKülönifjtartozikáronköltözhetszuterénkorrektAzonnalkiskertházrészrészhezcsaládirészénállapotkertvárosiműszakiBudafoképületönálló

Forrás: pepitahirdeto.multiapro.com

Pihenjen, üdüljön, kapcsolódjon ki nálunk és szülessen újjá a helyi Zsóry Gyógy-és Strandfürdőben, ami a szó szoros értelmében egy kőhajintásnyira van a Csilike apartmantól. Akcióinkról tájékozódjon a weboldalunkról: www.csilikeapartman.hu


Feladva: 2017-02-28    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: CsilikeáronkőhajintásnyiraszülessenjótegynálunkcsilikeapartmannyáronértelmébenkapcsolódjonwwwTélenszorosüdüljönhttpszóPihenjenweboldalunkrólami

Forrás: pepitahirdeto.multiapro.com

Továbbá gyártunk különböző méretű, huzalvastagságú horganyzott és műanyagos drótfonat, vadvédelmi háló, vadháló, tüskéshuzal, tüskésdrót, szögesdrót, vezérdrót, kerítés háló, kerítésháló, feszítőhuzal, feszítő huzal, kerítésdrót, tüskés szöges vezér drót, vadkerítés, kerítés építés, kerítésépítés, kerítésfonat ,kiskapu, nagykapu, huzalfeszítő csavar, vibropréselt zsalukő, lábazati elem, fémoszlop, faoszlop, natodrót nato drót, fém fa beton kerítés oszlop, kerítéspanel, kerítéselem, kutyakennel, ... további részletek >>

drótháló, drótkerítés, kis nagy vas kapu, kutya kennel, szőlőoszlop, kerítésoszlop, betonoszlop, kutya kenel, szőlőkaró, kutyakenel, szőlő oszlop karó. Vállalunk az ország egész területén vadhálóval, vagy dróthálóval komplett kerítésépítést 1000 Ft/m áron. (Csak drótkerítéseket és vadvédelmi kerítéseket építünk, fakerítést nem!!!)Rengeteg terméket gyártunk és forgalmazunk a kerítésdróton és betonoszlopokon kívül, amit egy hirdetésben nehéz lenne felsorolni, ezért kérem, látogasson el honlapunkra www.kerites.hupont.hu oldalra, vagy telephelyünkre, a KÓTAJI DRÓTFONAT, VADHÁLÓ és BETONOSZLOP CENTRUMBA ahol személyesen akár további kedvezményekre is van lehetőség.


Feladva: 2017-05-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keriteswwwvadvédelmibetonBETONOSZLOPdrótVADHÁLÓDRÓTFONAToszlopgyártunkhálóvagyhupontkutyakerítéseketkerítéspaneltüskéshuzalaholegészkívülfém

Forrás: pepitahirdeto.multiapro.com

Motoros mintákkal - rendelés alapján pólónyomás! Kiváló ajándék minden alaklomra. Retro pannónia logós termékek, humoros feliratú felsőruházati termékek motoros hölgyeknek és uraknak. Motoros hátizsák. Ha nem találod amit keresel, vagy egyéni elképzelésed van, írj! Megoldjuk. www.rockpont.polomania.hu/termekek /reszletek/153622_danuvia_logos_mot oros_polo-_motoros_ajandek-polonyom as


Feladva: 2018-01-04    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: MotorostermékekalapjánvagyfeliratúrendeléskereselhumorosmintákkalamitlogósRockPonttalálodpannónianyomásanemRetropólókhátizsákalaklomraminden

Forrás: pepitahirdeto.multiapro.com

A szem alatti karikák eltüntetése házilag eddig nem volt lehetséges. Exkluzív kezeléseken kellett részt venni annak, aki professzionális módszereket szeretett volna igénybe venni. A Byas azonban ezt otthon is elérhetővé tette bárki számára. A szem alatti sötét karikák eltüntetése mostantól házilag is lehetséges! Ez maximális hatékonyságot garantáló készülék magunkkal is vihető, hogy bárhol járunk, percek alatt üdévé, frissé varázsolhassuk tekintetünket. A magabiztosságba többé nem csúszhat hiba! ... további részletek >>

A szem alatti karikák, táskák és ráncok ellen a Byas Eye Lifter a hyaluronsav erejét veti be.


Feladva: 2017-07-17    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: alattiszemeltüntetésekarikáknemByasráncoklehetségesházilagvennibárholvoltLiftervolnahogyeddigEyesötéttöbbészeretettvihetőKittiszámára

Forrás: pepitahirdeto.multiapro.com

Class GSM Cégünk a Class-Mobil Kft (classgsm.hu) a következőkkel foglalkozik: • Használt és Új mobiltelefonok értékesítése. • Mobiltelefon megvásárlása, felvásárlása készpénzért. • Mobiltelefon csere. Ilyenkor árajánlatot teszünk régi készülékére az aznapi legmagasabb piaci áron, és amennyiben megfelel Önnek a kölcsönösen kialkudott összeg, úgy azt beszámoljuk új készülékének az árába. Amennyiben van otthon a fiókba, már nem használt mobilja, hozza be azt is hozzánk és ... további részletek >>

megvesszük. • Mobiltelefon kiegészítők, tartozékok értékesítése készletről. Amennyiben nincs készletünkön a keresett tartozék úgy azt gyors határidővel megrendeljük Önnek. Néhány kategória: Ütés álló üvegfóliák, kijelző védő fóliák, hálózati mobil és tablet töltők, autós töltők, adatkábelek, nagy választékban kaphatóak védőtokok, ami lehet flippes tok, szilikon tok, tpu tok, bőr tokok, gyári prémium tokoktól egészen a kézműves prémium bőr mobil és tablet tokokig. • Cégektől felvásároljuk leselejtezett mobiltelefon flottájukat. A Class gsm üzlete vasárnap kivételével minden nap szeretettel várja meglévő és új vásárlóit. A következő nyitva tartás szerint: Hétfőtől - péntekig 9 órától 19 óráig, szombaton 9-től 14 óráig. Vasárnap zárva vagyunk. ________________________________________ Hogyan jut el hozzánk? Gyalogosan: Az Újpest központ metrómegállónál kell leszállni. A metró aluljárónál a Trió-Burger közvetlen melletti lépcső-feljárónál kell felmenni a lépcsőn. Így már az Árpád út jobb oldalán (Újpest Városkapu irányában), és ezen tovább haladva megközelítőleg 320 lépés megtétele után (kb: 200 méter) Érkezünk meg a Árpád út – Kemény Gusztáv sarkára. Itt jobbra fordulva, már látható a Class GSM boltja, ami 10-12 méterre van jobb oldalon a saroktól. ________________________________________ Kérdése van? A leggyorsabb egy telefon hívás +36 70 502 5071 Vagy írjon nekünk a kapcsolati űrlapunk segítségével, amely a következő linkre kattintva érhet el: www.classgsm.hu/kapcsolat Tisztelettel a classgsm.hu csapata.


Feladva: 2017-12-05    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: 8226ClassGSMclassgsmÚjpestmobiltelefonAmennyibentokmobilaztvanmárhasználtamitöltőkÖnnekkellközpontértékesítéseÁrpádtablethozzánkbőrúgy

Forrás: pepitahirdeto.multiapro.com

Meglévő hiteleinek törlesztő részletét, akár havi 50%-ra is, tudjuk csökkenteni. Hitelkártyák, személyi hitelek, folyószámla hitelkeret összevonásával. Hitelt szeretne? Regisztráljon! Hitelét jutalékmentesen intézzük! Szűcsné B. Erzsi: 30/841-0329, Szűcs Sándor: 30/841-0330. Mielőtt lépne, feltétlenül keressen bennünket! i nfo.szbe@gmail.com, h itelciti@gmail.com


Feladva: 2016-10-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: Szűcsné841comhitelekbennünketXXIszemélyikeressenBudapestintézzükHitelkártyákfeltétlenErzsébetjutalékmentesencsökkentenilépneCSOKHiteléttudjuk

Forrás: pepitahirdeto.multiapro.com

A Centrál Autószerviz márkától függetlenül vállalja gépjárműve karbantartását, javítását. Törekszünk arra, hogy ügyfeleinkkel közvetlen kapcsolatot alakítsunk ki és elnyerjük bizalmukat minőségi, gyors munkánkkal. Nagy figyelmet fordítunk ügyfeleink által észlelt hibák kielemzésére. Autószerelő műhely - Sopron.


Feladva: 2016-08-10    [Autó - Motor - Jármű]

Címkék, kulcsszavak: AutószervizCentrálSopronTörekszünkműhelygyorsjavításátAutószerelőminőségikarbantartásátkielemzésérebizalmukatgépjárművehibákelnyerjükvállaljaészlelt

Forrás: pepitahirdeto.multiapro.com

Felelős műszaki vezetői közreműködést, építési műszaki ellenőri tevékenységet, elektronikus építési napló vezetését, építési terv alapján költségvetés készítését vállalok, mind magánszemélyek, mind vállalkozások megbízottjaként, Budapesten és környékén magánszemélyek részére is. Csonka János OK-ÉP-2004 Kereskedelmi Szolgáltató Bt. +36 20 398 5284 csonkajanos58@gmail.com


Feladva: 2017-08-31    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: építésiműszakinaplómindJánosCsonkamagánszemélyekcomkészítéskörnyékénvezetésétcsonkajanos58@gmailellenőrBudapesten5284vezetőmegbízottjaként3982004

Forrás: pepitahirdeto.multiapro.com

Alumínium zsalugáterek készítését vállaljuk — A FEMARKZSALU Kft új szolgáltatása: ajtó- és ablakzsaluk készítése alumíniumból. A számos variáció közül ajánljuk a védő zsalugátereket (biztonsági és nem biztonsági) típusban. Kérje ajánlatunkat méret szerint! www.femarkzsalu.hupont.hu/9/alumin ium-zsaluk-keszitese


Feladva: 2017-04-04    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: biztonságiKftFEMARKZSALU8212közülvállaljukszerintvariációkészítésétméretszámoszsalugáterekajánlatunkatalumíniumbólAlumíniumKérjekészítésetípusban

Forrás: pepitahirdeto.multiapro.com

Rajzos, ez a szép,kis-közepes nagyságú 1,5 év körüli kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: ... további részletek >>

06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagySÜRGŐSgazdinakRajzosvárjatelepenkutyagazdaörökbeGYEPMESTERIkellutánközepesüzenetetnemBekerülésükNAGYONaltathatókishagyjeredetiÓzd

Forrás: pepitahirdeto.multiapro.com

Segítünk berendezni, kérje Önnek szóló ajánlatunkat: www.hu-mago.hu/boltok-tervezese-sz erelese Vállaljuk boltok: felmérését, tervezését, látványterv készítését, összeszerelését, bontását. Szolgáltatásaink: » Boltok tervezése, szerelése » Bevásárlókocsi felújítás » Galvanizálás » Raktári állvány építés » Sorompó telepítés Új és használt forgalmazott termékeink megtekintéséhez látogasson el weboldalunkra!


Feladva: 2017-04-17    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 187BoltokszerelésetervezéseösszeszerelésétkérjeállványkészítésétweboldalunkraberendezniRaktárilátványtervlátogassonSegítünkGalvanizálástervezésétmago

Forrás: pepitahirdeto.multiapro.com

Állami támogatás kihelyezésével foglalkozom és mindenféle hitel közvetítésével, valamint biztosításokkal. Ingyenes tanácsadás, igényfelméréssel egybekötve, hogy legalább az információ meglegyen, ami nélkül hozzuk meg sorra a rossz döntéseinket. Kiválasztjuk együtt a legjobb megoldást és elmondom mit hogyan kell csinálni ahhoz, hogy saját otthonod melegét érezd és a saját kertedet szépítsd. Kérjetek visszahívást tőlem itt: www.otthonteremtes-biztonsaggal.webnode.hu vagy itt: ... további részletek >>


Feladva: 2016-11-06    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: hogytámogatásÁllamitanácsadásIngyenesittsajátotthonteremtesegybekötvedöntéseinkethttpigényfelmérésselahhozrossztőlemcsinálniBudapestsorrakell

Forrás: pepitahirdeto.multiapro.com

Bogács üdülőövezetében a Termálfürdőtől, horgásztótól öt perc sétára önálló vendégház kiadó. Pihenjen családjával, barátaival úgy, hogy csak ismerősök vegyék körül! Itt nem kell idegenekhez vagy a tulajdonoshoz alkalmazkodnia. 2014 óta változatlan árakkal várjuk vendégeinket.


Feladva: 2017-01-24    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kiadóvendégházBogácscsaládjávalNórakellPihenjenvendégeinketKozmánénemvárjukBogácsonIttárakkalkörülönállóváltozatlanvegyéksétáraótaismerősök

Forrás: pepitahirdeto.multiapro.com

Vízcsapok javítása, mosogatók, mosdók, WC-kagylók cseréje, WC tartályok javítása, mosogató gépek és mosógépek bekötése! Szifonok, lefolyó vezetékek tisztítása, javítása.


Feladva: 2016-02-09    [Lakossági szolgáltatás]

Címkék, kulcsszavak: javításatisztításamosdókvezetékekMosogatóklefolyóVízcsapokSzifonokBudapestbekötéseIstvánmosógépekSzabógépek2525mosogató252tartályokVÍZSZERELŐ

Forrás: pepitahirdeto.multiapro.com

Hajsütővas, gőzállomás, waffelsütő, gofrisütő, melegszendvicssütő, porszívó, páraelszívó, fagyasztó, hűtő, szárítógép, mosógép, hősugárzó, olajradiátor, olajsütő, kenyérpirító. A tökéletes nászajándékok, karácsonyi ajándékok széles választéka! Személyes átvétel Budapesten. Link: www.stacioshop.hu Facebook: www.facebook.com/stacioshop Tel: 36704551969 E-mail: in fo@stacioshop.hu


Feladva: 2017-05-16    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: stacioshopfacebookwwwátvételhősugárzóinfo@stacioshopHajsütővasSzemélyesmosógépmailajánlóválasztékaszárítógép36704551969HirdetőszéleshűtőTelPepita

Forrás: pepitahirdeto.multiapro.com

A Penda 1997. februárjában a Betéti Társaság-ból Kft.-vé alakult, mely a mai napig is 100%-ban magyar tulajdonban van. A vállalat immár 20 éve a termelőeszköz forgalmazók és felhasználók igényeinek kielégítésére törekszik. Húzó termékeink: rendsodrók, szárzúzók, ekék, traktorok, rendkezelők, kaszák, bálázók, pótkocsik, permetező gépek, vetőgépek. Négy telephelyen, Békéscsabán, Kecskeméten, Kiskunmajsán és Nagykőrösön szerződéses partnereink raktározzák és adják ki áruinkat.


Feladva: 2017-08-31    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: PendaKftekékszárzúzókrendsodrókáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetétitörekszik

Forrás: pepitahirdeto.multiapro.com

Eladó tulajdonostól Bpest. Rákoshegy - Nagyhangácson az Orgoványi utcában 620,2 nm-es, külterületen lévő bekerített kertgazdasági, szántó, gazdasági épület, kivett lakóház, udvar megjelölésű ingatlan és a hozzá tartózó 44,8 nm szolgalmi út. A telken villany és a vezetékes víz bekötve a házba, gáz az utcában, gyűrűs kút, bontandó vagy erősen felújításra szoruló 36 nm-es faház (2 helység, külön WC, tusolós mosdó, veranda és 26 nm-es fedett tároló) van. Csatorna, szennyvíztároló nincs. ... további részletek >>

Személygépkocsi tárolás kerítésen belül megoldható. Utca fronti személykapu, oldalsó gk. bejárat. A terület átminősítése gazdasági területté a Fővárosnál folyamatban van. Befektetésnek is ajánljuk. BKV busszal 10 perc a KöKi . Tájékoztatás csak telefonon! Az ár alkuképes irányár.


Feladva: 2017-10-16    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vanEladógazdaságiutcábanirányárfedettkivettRákoshegyerősenUtcavillanyépületalkuképes26nmBpestfolyamatbanvagymegoldhatótelkenszántótelefonon

Forrás: pepitahirdeto.multiapro.com

Del-Nemetorszagba Stuttgart kornyekere nemet nyelvismerettel munkalehetoseg ferfiaknak es noknek egyarant. Festo mazolo, villanyszerelo, vizvezetek szerelo, hegeszto, lakatos, auto festo, targoncas, gyari munkatars,ipari mechanikus poziciokra. Amit kinalunk: - Szallas a munkaltato altal biztositott - Nemetorszagi bejelentett, hosszutavu munkalehetoseg Ami elvaras: - Kozepszintu nemet nyelvismeret Reszletekert a hívjon a +36706275010, +36706385010 vagy regisztraljon ... további részletek >>

www.nrgkulfoldimunka.hu oldalon es mi visszahivjuk!


Feladva: 2017-12-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: munkalehetosegNemetorszagifestonemetStuttgartregisztraljonvizvezetekKftmechanikusvagyvillanyszerelohosszutavuCompanyipari36706385010mazolobejelentett

Forrás: pepitahirdeto.multiapro.com

A legkedvezőbb áron, elsősorban családokhoz, cégekhez, különféle rendezvényekre, esküvőtől, születésnaptól a házassági évfordulóig, babazsúroktól az érettségi találkozóig, karácsonyi rendezvényektől a szilveszteri műsorokig minden és mindenféle rendezvénnyel állunk a kedves lakosság rendelkezésére. 227 tagunk különféle produkcióval dolgozik. Rendkívül látványos, szép, hangulatos. Akár családi, akár színpadi, 1 fő műsor vezetőtől, akár 100 fős előadó gárdáig mindenféle fajta és típusú ... további részletek >>

rendezvény lebonyolítását vállaljuk.


Feladva: 2017-09-19    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: műsorokműsorfelnőttgyermekBluezenekarokrendelhetőzenészszerintzeneelképzelésegyénielképzelhetetlenpaulelképzelhetőrendelhetőkbármelytáncosokbohócok

Forrás: pepitahirdeto.multiapro.com

Családi ünneped tennéd színesebbé, emelnéd a fényét, díszítenéd szebbé? Szeretnéd, ha méltó, örök emlék lenne, hogy az érzéseid ragyogjanak benne? Írasd hát meg versben, legyen méltó hozzád, mintha az ünnepet be is aranyoznád! Fejezd ki az érzést, emeld tiszta fényét, tedd szebbé szeretted fontos eseményét. Rendelj verset Aranyosi Ervintől! Ára versszakonként (8 sor): 2.000 Ft


Feladva: 2015-09-08    [Vegyes hirdetések]

Címkék, kulcsszavak: szebbéméltófényétAranyosiversetszínesebbéFejezdcombenneRendeljtennédaranyoznádaranyosiervinragyogjanakeseményétünnepedünnepetversekérzéseidhttp

Forrás: pepitahirdeto.multiapro.com

Olcsó, kiadó, azonnal beköltözhető albérletet keresünk sürgősen!!! 2 felnőtt és 1 gyermek részére lenne... Kaució max. 1 hónap legyen! Lakáspályázat is érdekel! Tel.: 30/883-5695 E-mail: voti 75@citromail.


Feladva: 2017-08-18    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: OlcsókeresünkbeköltözhetőhónapazonnalmaxkiadóKaucióvoti75@citromaillenneBudapestmailrészéreAndrás5695gyermekalbérletet883felnőttTelsürgősen

Forrás: pepitahirdeto.multiapro.com

ELADÓ ORION 61CM SZTEREÓ SZÍNES TÁVIRÁNYÍTÓS TXT TV. KITŰNŐ ÁLLAPOTBAN. TF:+36/30/667-6007 VAGY +36/30/667-8487


Feladva: 2017-06-04    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: TÁVIRÁNYÍTÓS61CMORIONELADÓ667TXTSZÍNESSZTEREÓ8487JÓZSF6007VAGYSZÍNESTXTÁLLAPOTBANKITŰNŐ

Forrás: pepitahirdeto.multiapro.com

HELKAMA ITALHŰTŐ 12 HÓ GARANCIÁVAL 5 db polc Űrtartalom: 361 liter 230 V/50 Hz 295 W; 4.65_kWh/nap 0,33 l doboz: 406 db vagy 0,5 l üveg: 217 db vagy 2,0 l üveg: 56 db Magasság: 2055 mm Szélesség: 595 mm Mélység: 710 mm www.hgc.hu/Helkama-italhuto-vilagi to-reklamfelulettel


Feladva: 2017-10-04    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: italhutoHelkamaüvegvagydobozHirdető710napPepitaMélységkWh595295Szélesség2302055literreklamfelulettelMagasság361vilagitoŰrtartalompolc

Forrás: pepitahirdeto.multiapro.com

Parabola antenna szerelés, közösségi antennák, karbantartás és átalakítás, MinDig TV DVB-T Földi digitális antenna, UPC Direct, forgatható parabola antennák szerelése, kábel TV lakáson belüli javítása, elosztása és a jelszint szakszerű erősítése. Elöregedett, tönkrement, nem használt régi tetőantennák, árbocok lebontása. Meglévő antenna házhálózatok javítása, fejlesztése.


Feladva: 2017-05-22    [Lakossági szolgáltatás]

Címkék, kulcsszavak: antennaBerkesSZERVÍzantennákparabolajavítása2912222szerelőLászlóárbócokbelüliDVBtetőantennáklakásonMinDigBudapestrégiKábelátalakításLaszlo

Forrás: pepitahirdeto.multiapro.com

Szeretettel várok minden új és régi vendégemet újonnan nyílt szalonban :) Bejelentkezni ezen a telefonszámon tudtok : +36 70 626 1434


Feladva: 2017-09-28    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: régi1434minden626vároktudtokSzeretetteltelefonszámonBudapestezenÉvaBejelentkezniGázerszalonbanVicuskutyakozmetikanyíltújonnanvendégemet

Forrás: pepitahirdeto.multiapro.com

Kameradepó az IP kamerák, IP kamerarendszerek, éjjel látó színes IP infrakamerák webáruháza! Ön kényelmesen megrendeli az íróasztala mellől, mi rövid határidővel kiszállítjuk! Prémium kategóriájú Full HD IP kamerarendszerek a legjobb áron! Magánszemélyeket, cégeket és kivitelezőket is kiszolgálunk! Nézze meg a weboldalunkat: www.kameradepo.hu/ip-kamerarendsze r.html Kérje kollégánk segítségét: 06-20-5698848 Kameradepó webáruház a gyors, biztonságos megoldás!


Feladva: 2014-02-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: KameradepókamerarendszerekhttpolcsónFullinfrakamerákgyorsweboldalunkatKamerarendszertkategóriájúszíneswebáruházmegPrémiumlátóNézzekiszállítjukéjjel

Forrás: pepitahirdeto.multiapro.com

Magyarország első találka alapú (pay per date) és fokozottan biztonságos társkereső szolgáltatása! Csak akkor kell fizetni, ha összejön a randi! Nálunk nincsenek kamu profilok! Nincsenek zaklató levelek! Ne ülj otthon a képernyő előtt! Próbálj ki valami újat! beengedlek.hu


Feladva: 2017-01-01    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: NincsenekbeengedlekkamudatePróbáljrandiperelőttösszejönpayképernyőfizetnialapúotthonkelltalálkaüljakkorelsőlevelekCsakMagyarországzaklató

Forrás: pepitahirdeto.multiapro.com

Tuti Turi Ptc Kiegészítő jövedelemre van szükséged? Gyere és dolgozz velünk! 2017. Magyarország egyetlen PTC oldala! Ami ingyen is elkezdhető, és csinálható! Napi kereset változó! Jutalék rendszer és más egyéb lehetőségek! Csak rajtad múlik, hogy mennyit akarsz keresni! Az első 2000 Tag, ajándék tagságban részesül! Link... http://tutituriptc.xyz/?ref=ijoco< /a>


Feladva: 2017-05-20    [
Pénzkeresés - MLM]

Címkék, kulcsszavak: PTColdalaijocoegyetlenMagyarország2017ajándékvanlehetőségekAmiTagjövedelemreegyéb2000KiegészítőmáselsőTurirendszerrefkeresniTutiJutalék

Forrás: pepitahirdeto.multiapro.com

A már jól ismert, bevált, és előnyös tulajdonságaival bizonyított OSB lapok mellett 2006-ban megkezdtük a hasonló felhasználási területű, de költséghatékonyabb – olcsóbb – megoldást nyújtó MFP lapok forgalmazását is. Mindkét termékcsoport különböző vastagságban (az MFP nútféderes változatban is) megvásárolható telepi készletünkből. Az MFP lap is rendelkezik magyar ÉMI típusvizsgálati bizonyítvánnyal, hosszanti és keresztirányú szilárdsági értékei könnyedén teljesítik az OSB/3 ... további részletek >>

EN300-as követelményeit. MFP lapok - Árvai Fatelep MályiAz MFP lapok főbb jellemzői: - jól terhelhető - stabilitást nyújt - ellenáll a nedvességnek - megmunkálás és külső megjelenés szempontjából a masszív fához hasonló Az MFP lapok felhasználási területei: - padlókészítés - falborítás - tetőfedés - építési kerítések - csomagolások - fakeret szerkezet borításra a DTU 31.2 szerint engedélyezve - zsaluzatok - faházépítés Kérjen személyre szabott árajánlatot! http://arvaifa.hu/termekek/mfp-es-osb-lapok/


Feladva: 2016-10-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: mfplapokosbfelhasználásiarvaifahasonlójól8211engedélyezvekövetelményeit2006padlókészítésmagyarellenállMindkétszerintEN300mellettterületeinyújt

Forrás: pepitahirdeto.multiapro.com

Modell XO-3001US Állapot Új Anyaga: nemesacél Magas fényű Közepén pörgethető láncbetéttel Szélessége: 49-től 57-ig 6 mm Szélessége: 59-től 72-ig 8 mm Belső része domborított, így viselése nagyon kényelmes Súly: 6.70 gramm www.klugex.ekszer.center/69-nemesa cél-gyűrűk


Feladva: 2017-07-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: nemesacélKözepéntőlSzélességekényelmesKarikagyűrűnagyonfényűviseléseMagasgyűrűkígyAnyagadomborítottÁllapotcenterrésze3001USekszerBelsőModell

Forrás: pepitahirdeto.multiapro.com

Van egy szuper lehetőség! Shoppingoltál már úgy hogy közben pénzt is adtak érte?! A világon Egyedülálló rendszer, extra lehetőség, amelyre jelentkezz most! Várom érdeklődésed, írj mielőbb, mert számít az idő!


Feladva: 2017-11-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: lehetőségegyElviraérdeklődésedadtakSzakálVárompénztshoppingolássalmostközbenProfitáljjelentkezzhogyamelyreúgymáridőextraShoppingoltálszámít

Forrás: pepitahirdeto.multiapro.com

Kútfúrást, víznyelő fúrást vállalok kézzel és géppel. Vállalási területek: Szigetszentmiklós, Szigethalom, Tököl, Halásztelek, Dunaharaszti, egész Csepel-sziget, Délegyháza, Dunavarsány, Zugló, Kispest, Alsónémedi, Pesterzsébet, Újpest, Budakalász, Angyalföld, Kiskunlacháza, Kunszentmiklós, Majosháza, Budapest és környéke. Kedvező áron, minőségi szűrővel. Az ár tartalmazza a hozzávaló anyagokat is. Munkáinkra garanciát vállalunk!


Feladva: 2015-07-21    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SzigetszentmiklóskörnyékénBudapestenanyagokatfúrástKiskunlacházánCsepelhozzávalóvíznyelőAngyalföldönegésztartalmazzaKútfúrástBudakalászonDunaharaszti

Forrás: pepitahirdeto.multiapro.com

Eladó egy 23 négyzetméteres, összkomfortos üzlethelyiség forgalmas, budai metrófeljáróval szemben. Naponta minimum 25–35 ezer ember halad el az üzlet előtt, tehát az extra nagy forgalom garantált. Irányár: 1,5 millió Ft/m2. Az üzletnek jelenleg tartós bérlője van, tehát befektetésnek is jó, mert magas havi jövedelmet eredményez. Ajánlati szám: VSZ/00151/16/07


Feladva: 2017-12-01    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: tehátbudaiVSZüzlethelyiségEladónagymetrófeljáróvalextra00151vanelőttforgalmasbérlőjeüzletszámtartóshaladAjánlatiösszkomfortosjelenlegember

Forrás: pepitahirdeto.multiapro.com

Professzionális, személyre szabott doboktatás, egyéni időbeosztásban! Kezdőknek, haladóknak, korosztálytól függetlenül, minden zenei stílusban! Földesi Dobiskola!


Feladva: 2016-01-26    [Zene - Hangszer]

Címkék, kulcsszavak: egyéniDobiskoladoboktatásFöldesiidőbeosztásbanszabottstílusbanszemélyrezeneiProfesszionálismindenfüggetlenülkorosztálytólhaladóknakKezdőknek

Forrás: pepitahirdeto.multiapro.com

Mi az, amiről nem akarják, hogy tudj? Most kérheted azt a másfél órás VIDEÓt, amiben megismerheted a háttérben megbújó érdekeket. Kattints a honlapra!


Feladva: 2016-04-02    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: eltitkolttudáswwwmásfélelőlhttpaztemberiségidekérhetedKattintsMostérdekekettudjmegbújóhogyháttérbenakarjákmegismerhetednemtudasamibentgy

Forrás: pepitahirdeto.multiapro.com

Vízálló, csúszásmentes meleg burkolatok, fahatású, kőhatású, szövött és minimál design padlók széles választéka. Click és Loose-Lay padlórendszerek. Az anyag rugalmassága miatt minden helységbe alkalmas, akár falra, pultra, bútor homlokzatra is rögzíthető. Mikrofózolt élekkel, sima, előkészített burkolaton egy 1-3mm-es ragasztóágyba helyezve, gyorsan, kosz-és zajmentesen lerakható, padlófűtéshez is! A különböző termékcsaládjainkat és a színválasztékot megtalálja a www.magicfloor.hu oldalon!


Feladva: 2017-03-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: magicfloorburkolatokVízállókoszszövöttrögzíthetőVinyloldalonanyaggyorsankőhatásúhomlokzatraLuxuspadlórendszerekhelyezvefahatásúbútorwwwLayLoose

Forrás: pepitahirdeto.multiapro.com

Az Ozeki IoT szoftvereket és eszközöket gyárt, amely terület robbanásszerűen fejlődik napjainkban. Mit várunk az ideális jelölttõl: - Felsőfokú programozói vagy mérnök informatikus végzettség (Utolsó éves hallgatói státusz, amely nem igényel hallgatói jelenlétet.) - Java nyelvismeret Amiben többet nyújtunk, mint más cég: - Szakmai képzés IoT területen. - Legújabb technológiák és kutatási eredmények használata - Átlagon felüli fizetés az elért eredmények arányában. Jelentkezés ... további részletek >>

módja: A job@ozeki.hu email címünkre küldött önéletrajzzal és jelentkezési adatlappal, vagy a weboldalunkon - www.jobs.ozeki.hu/index.php?owpn=28 Folyamatosan várjuk a jelentkezőket!


Feladva: 2016-07-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: JavaIoTeredményekhallgatói245amelyOzekitechnológiákMitAmibenálláslehetőségmódjavégzettségLegújabbnapjainkbanjelentkezőketnyelvismeretfejlesztvagy

Forrás: pepitahirdeto.multiapro.com

Építésvezetőt keresünk felvételre, az alábbi elvárásokkal. Szakmai önéletrajzokat a hazai@upcmail.hu e-mail címre várjuk. FŐBB FELADATOK, MUNKÁK: Kivitelezési munkák teljes körű helyszíni koordinálása, alvállalkozók munkájának irányítása Ütemtervek készítése, határidők betartása és betartatása Árkalkulációk, anyagrendelések előkészítése, elektronikus építési napló vezetése Minőségi munka megkövetelése és ellenőrzése Minden egyéb építésvezetői feladat AZ ÁLLÁSHOZ TARTOZÓ ELVÁRÁSOK: ... további részletek >>

Legalább 3 éves kivitelezésben történt szakmai gyakorlat (magasépítés) Önálló és felelősségteljes munkavégzés Jó szervező és koordináló képesség Nagy terhelhetőség, rugalmasság Problémamegoldó- és feladat centrikus hozzáállás Jó kommunikációs képesség B kategóriás jogosítvány, saját gépkocsi ÁLLÁS, MUNKA TERÜLETE(I): Építőipar, Kivitelező, General kivitelező MUNKAVÉGZÉS HELYE: Rugalmas munkavégzési hely – Budapest-Pest megye


Feladva: 2017-09-19    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: feladatszakmaiMUNKAmunkákMUNKAVÉGZÉSképességkivitelezőbetartatásaPestteljesellenőrzésealábbiProblémamegoldóbetartása8211történtÁLLÁSmegkövetelése

Forrás: pepitahirdeto.multiapro.com

Szeretné, ha haja egészséges, csillogó és dús lenne? Szeretne kellemes környezetben, igazi szakemberek által gyógyulni, szépülni? Nem elégedett a boltokban kapható hajápoló termékekkel? Szalonunk a következő szolgáltatásokat ajánlja: -Hajgyógyászati kezelések: hajhullás, kopaszodás, korpa, zsírosodás, száraz, vékony, töredezett haj és fejbőr panaszok problémájára. Több mint 20 éves tapasztalattal! Személyre szabott kezelési programok, professzionális gyógyászati anyagok, komfortos érzés ... további részletek >>

kezelés közben! Mikrokamerás hajdiagnosztika, fejbőr és hajvizsgálat -Biofodrászat: Haj-állapotfelmérés speciális kamerával. Az Ön stílusának és hajszerkezetének legmegfelelőbb módszerekkel dolgozunk. Vegyszermentes hajfestés a haj szerkezetét erősítő festékkel, (maximális őszfedéssel) Természetes eredetű styling anyagok (hajhab, zselé, hajlakk), melyek meg is vásárolhatóak! Referenciaszalonunkban speciális, biológiailag aktív növényi hatóanyagokkal dolgozunk! Hajmosás, styling, vágás személyre szabottan, az ön haj-és fejbőrtípusának megfelelően. Ionos hajszárítás, kolloid ásványi anyagokkal történő hajfeltöltés. Vegyszermentes hajfestés, hajszerkezet-visszaépítés, vékonyszálú haj erősítése Egyedülálló, a hajszálak szerkezetébe beépülő biológiailag aktív növényi hatóanyagaink biztosítják, hogy az Ön frizurája nemcsak szép, hanem egészséges is legyen!


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hajBiofodrászatnövényifejbőraktívhajfestésSzeretnebiológiailagVegyszermentesegészségesszemélyrekezelésekstylingHajgyógyászatianyagokdolgozunkNovotni

Forrás: pepitahirdeto.multiapro.com

- Szerszámok - Szerszámgépek - Kötőelemek - Rögzítéstechnika - Kötéstechnika - Hegesztéstechnika - Forrasztástechnika - Munkavédelem - Zárak- Lakatok- vasalatok - Festékek- Vegyiáru - Mérőeszközök - Csiszolástechnika


Feladva: 2016-10-04    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: FestékekSzerszámokvasalatokBudapestLakatokKftZárakBauMunkavédelemBarkerForrasztástechnikaSzakáruházHegesztéstechnikaSzerszámKötéstechnikaIparcikk

Forrás: pepitahirdeto.multiapro.com

Pályázatírás másképpen Biztosan sok helyen olvashatja, hogy ingyenes pályázatírás, ingyenes tanácsadás stb. …. de elege van, hogy a végén MINDIG MINDENT ÖNNEK KELL KITALÁLNIA???? Ráadásul a számla kiállítása után a lehető leghamarabb el is feledkeznek Önről? Ha szeretné, hogy…. - 15 perc „ingyenes tanácsadás” helyett tényleg EGYÜTT GONDOLKOZZANAK ÖNNEL - egyetlen gépbeszerzés helyett KOMPLETTEN, egyben vizsgálnák cégének valódi szükségeit - valóban ... további részletek >>

TEHERMENTESÍTSÉK az összes pályázatírással kapcsolatos papírmunkától - VÉGIGKÍSÉRJÉK az egész pályázati folyamatot az előlegtől a záró-ellenőrzésig - KAPCSOLATI TŐKÉT is kapjon pályázatához, ne csak egy számlát a pályázat megnyerésekor Akkor kérjen időpontot a +36 30 928 3621 telefonszámon (vagy montaltechkft@gmail.com e-mail-en) Zakor Beátától és várjuk Önt budaörsi irodánkban.


Feladva: 2016-09-29    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ingyeneshogytanácsadáshelyettpályázatírás8230zárószeretnéZakorvalóbanÖNNEKmegnyerésekorGONDOLKOZZANAKBiztosanelőlegtőlÖnrőlmailszükségeitMINDENT

Forrás: pepitahirdeto.multiapro.com

Nyugodt természeti környezetben, 2 szintes családi házban 4x4 ágyas szobák kiadók. Minimum 3 éjszakára vagy többre kiadó. A vendégházat egy időben csak egy családnak, illetve társaságnak kiadó. A szállás, legalább három éjszakára és minimum 10 fő részére foglalható. Maximum 16 fő, családoknak és baráti köröknek ideális. Minden szobában TV, WIFI. Konyha és fürdőszoba közös használatú. Nagy, parkosított udvar, ahol bográcsozni- nyársalni lehet. Parkolás zárt udvaron. Felnőtt: 2700 Ft/fő/éj + ... további részletek >>

IFA 280 Ft/fő/éj Gyerek: 0-17 éves korig 2700 Ft/fő/éj Fűtési szezonban minimum 3 éjszakára és minimum 10 főnek kiadó a vendégház. Fűtési szezonban Felnőtt: 4700 Ft/fő/éj +IFA 280 Ft/fő/éj Fűtési Szezonban Gyerek: 4700 Ft/fő/éj Eger 18 km-re, Mezőkövesd 12 km-re van Bogácshoz. Lehetőségek: Gyógyvizes strandolás, horgászás, túrázás, este a pincesori borozók, amikben hajnalig lehet szórakozni. OTP, MKB, K&H Szép kártya elfogadó hely. Érkezés: 14 órától Távozás: 10 óráig. A vendégházban lakik a tulajdonos is. www.fpvendeghaz.fw.hu piroska60@freemail.hu 06303756031 Egész évben szeretettel várom vendégeimet!


Feladva: 2017-06-07    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: minimuméjszakáraSzezonbanFűtésikiadóFarkas4700FtGyerek2700Ftegy280FtIFAFelnőttlehetBogácsvendégházPiroskaMezőkövesdMindenEgészÉrkezésfőnek

Forrás: pepitahirdeto.multiapro.com

Autómentés a nap 24 órájában az év minden napján belföldön minden gépjármű-kategóriában. • Rendelkezésre állás: 0-24 óráig! • Autómentő kiállási ideje Budapesten: 30-40 perc • Autómentő kiállási ideje vidékre/külföldre: azonnali indulással, a lehető legrövidebb időn belül!


Feladva: 2016-01-23    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 8226Autómentés6499188TelIstvánMészárosmindenidejekiállásiAutómentőnapbelülidőnpercDunakeszilegrövidebbBudapestenautószállításlehetőóráigNon

Forrás: pepitahirdeto.multiapro.com

Egri összkomfortos belvárosi szálláshelyünk, amely csendes, családias zöld övezetben található. Nagyon kevés egri szálláshely adottsága, hogy egy adott foglalt időpontban csak egy családnak vagy baráti társaságnak adjuk ki. A két apartman két különálló udvarban található és egyenként 4+2 személy befogadására alkalmas. Korszerűsített, teljesen felszerelt apartmanok. Egyik apartmanunk a tavalyi év folyamán korszerűsítve lett. Műanyag nyílászárok, redőnnyel, szúnyoghálóval ellátva, a fűtés cirko. ... további részletek >>

Zárt parkolót, pihenőudvart biztosítunk. Mind családoknak, mind baráti társaságoknak kiváló üdülési lehetőség. A történelmi belvárostól 5 perc sétára található. Eger látnivalói (vár, mecset, Líceum, Szépasszonyvölgy) gyalogosan megközelíthető. Közeli kis pincénkben termelői borkóstolási, borvásárlási lehetőséget biztosítunk. Üdülési csekket, Széchényi pihenőkártyát, Szép kártyát elfogadunk, (OTP, K&H, MKB Bank). Havas Apartman kulcstartójának felmutatásakor vendégeink, számos szolgáltató kedvezményt biztosít (Demjéni strandfürdő, Tangó étterem, taxisok, fodrászok.) Korlátlan internet, WIFI hozzáférés, kábeltévé. Állatbarát egri szálláshely, kis állat behozható. 2 db teljesen felszerelt kerékpár áll vendégeink rendelkezésére. Reméljük bemutatkozásunk elnyerte tetszésüket, és viszont látjuk egymást Magyarország egyik legszebb történelmi városában. Várja szeretettel Önt és kedves családját Észak Magyarország egyik legszebb városában, Egerben a Havas Apartman. Áraink: fő/éj vannak megadva, amely függ a foglalt idő hosszától és a vendégek számától. Áraink IFA - t nem tartalmazzák. (450.-Ft/fő, 18 év felett)


Feladva: 2017-11-26    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: HavasApartmanegyikegriEgertalálhatókéttörténelmivárosábanfelszereltlegszebbteljesenfoglaltÜdülésiMagyarországegybiztosítunkbarátiamelykismind

Forrás: pepitahirdeto.multiapro.com

Minőségi 4-8 tojásos leves és köret tészták kaphatók, megrendelhetők. A termékek hagyományos összetétellel, de modern technológiával készülnek! 100% Magyar Termék!


Feladva: 2016-10-10    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: kaphatókTerméktésztákMagyarköret100leveskészülnektojásostechnológiávalMinőségimodernKondorosösszetétellelkondorositesztahagyományosgyártótól

Forrás: pepitahirdeto.multiapro.com

Lökhárító, motoridom javítás és műanyag karosszéria javítás, horpadás javítás, műanyaghegesztés. Sérült, törött lökhárítók, fényszórók és egyéb műanyag alkatrészek javítása. Robogók, nagymotorok műanyag burkolatainak javítása. Műanyag háztartási, és egyéb eszközök javítása. Képek és árak a honlapon! Tel. : (30) 9 124- 279 Budapest 1105, Halom u. 42.


Feladva: 2017-01-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: javításMűanyagjavításamuanyagjavitashttpegyébBudapestLökhárítófényszórókZentaiKépeklökhárítókMŰANYAGJAVÍTÁStörötteszközökSérültHalom1105