0.12 keresünk - MultiApro.com hirdetések - Ingyen apróhirdetés, egyszerűen több apróhirdető oldalra
Nincs találat .... Nézze meg kiemelt hirdétéseinket.

keresünk

Havi fix és még autód is lehet! Hogyan vásárolhatsz olcsóbban? Hogyan lehet háromévente új autód? Hogyan lehet havi 140000 Ft jövedelmed? Itt a lehetőség! https://youtu.be/6ovqDxaNyyY www.senholding.com/kaldornoe0111


Feladva: 2017-05-12    [
Pénzkeresés - MLM]

Címkék, kulcsszavak: lehetHogyanautódhavihttpsmégfixsenholdingwwwháromévente6ovqDxaNyyYolcsóbbanyoutuvásárolhatszlehetőségIttjövedelmedNoémi140000Káldorcom

Forrás: pepitahirdeto.multiapro.com

Miért ajánljuk Agrimotor 3WF-3S permetezőt? Bevált magyar termék 12 hónap Agrimotor gyártói garancia Agrimotor gyár forgalmazza Országos szervízhálózat Teljes alkatrészellátás Egyszerű kezelés Kedvező ár Motor tipus: benzinmotoros, 2 ütemű, 42 ccm Teljesítmény: 1,2 kW Max. folyadék szállítás: 4 liter /perc vagy 6 kg/perc (POR esetén) www.bmann.hu/Agrimotor-3WF-3S


Feladva: 2017-04-15    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: Agrimotor3WFperceseténXIVbenzinmotorosgyárPORBudapesttipusgaranciaajánlóMotorgyártóivagyHirdetőKedvezőhónapliterPepitakezeléstermékfákhoz

Forrás: pepitahirdeto.multiapro.com

Fürjtojás kapható Étkezési fürjtojás 25 Ft/db Keltetni való fürjtojás 30 Ft/db Tenyészetkód: 9541049


Feladva: 2015-11-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: fürjtojáskaphatófürjTenyésztojás1850való1100Keltetni650ÉtkezésiolívaolajbanSzigethalompácoltGyulaFüstöltPénzes550

Forrás: pepitahirdeto.multiapro.com

Egy gyulladáscsökkentő gyógyszer sokat segíthet, ám ártalmaitól, káros mellékhatásairól sem szabad megfeledkezni! Sokan már csak akkor foglalkoznak ezekkel, amikor túl késő. Legyünk előrelátóak, hiszen van megoldás gyógyszerek nélkül élni! A természetes gyulladáscsökkentők közül mind több szakember ajánlja figyelmünkbe a fekete berkenye előnyeit. Ez az eredetileg Észak-Amerikában honos gyógynövény étrendkiegészítőként ma már az egyik legnépszerűbb erre a célra. Mint vény nélkül kapható ... további részletek >>

gyulladáscsökkentő, csupa természetes hatóanyaggal segít legyőzni a gyulladásos folyamatokat, melyek megelőzésében is hatásos.


Feladva: 2017-06-20    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: gyulladáscsökkentőnélkülgyógyszerektermészetesmárétrendkiegészítőkéntszabadtöbbKittielőrelátóakgyógynövénysemhatásosszakemberberkenyébőlkaphatókéső

Forrás: pepitahirdeto.multiapro.com

Ásvány medál ékszer szett 12 féle ásvány egy dobozban: www.lilibizsu.hu/modules.php?name= termek&id=01275_ASVANYMEDAL-KESZLET


Feladva: 2018-01-12    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ásványszettmedáldarabosdobozbanegyféleékszerWEBÁRUHÁZBIZSULILI

Forrás: pepitahirdeto.multiapro.com

Rövid- és hosszú ujjú bababody rendelhető kiváló minőségben és mosást tűrő nyomással, felirattal, többféle mintával. Rocker és motoros babáknak is, online rendeléssel. Webáruházunkban leadott rendelését 3-5 napon belül kiszállítjuk az ország bármely területére. www.rockpont.polomania.hu/termekek /4857_Babaruha-Rocker_es_motoros_be bibody


Feladva: 2017-08-24    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: motorosbababodyRockerujjúkiszállítjukmintávalhosszúbelültöbbféleRövidnaponfelirattalBudapestrendelésétnyomássalRockPontleadotttűrőbébiknek

Forrás: pepitahirdeto.multiapro.com

Komáromi János (Málca, 1890. december 22. – Budapest, 1937. október 7.) író, újságíró. Több tucat elbeszélés és regény szerzője. Sorozatcím: Komáromi János munkái gyűjteményes kiadás IV. Kiadó: Genius Könyvkiadó Rt. Kiadás éve: 1930 Kiadás helye: Budapest Kötés típusa: egészvászon Terjedelem: 233 Nyelv: magyar Méret: Szélesség: 13.00cm, Magasság: 19.00cm Kategória: Irodalom szépirodalom regény, novella, elbeszélés Dedikált, aláírt könyvek Antik könyvek ... további részletek >>


Feladva: 2017-04-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: KiadásBudapestgenius1930DedikáltelbeszélésnapokszepregénykirJánosKomáromi00cmkönyvekSzélességHirdetőaláírtTöbbMéretPepitaéveújságíróíró

Forrás: pepitahirdeto.multiapro.com

Falmatrica, faltetoválás, faldekoráció webáruház. Olcsó falmatricák, óriási választék! Ha unod otthonod egyszínű, fantáziátlan falait...


Feladva: 2016-10-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falmatricashopwwwwebáruházfaldekorációfaltetoválásFalmatricaválasztékóriásifalmatricákOlcsó

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

A noni termékek A-, B-, C- és E-vitaminokat, nátriumot, magnéziumot, káliumot, vasat és sok antioxidánst tartalmaznak. Minden korosztály számára fontos tápanyagok ezek, melyekhez a gyümölcsből természetes formában juthatunk hozzá. A noni ital sokféle hatását nemcsak a polinéz törzsi gyógyítók tapasztalatai alapján ismerjük, de ma már a tudományos alapokon végzett vizsgálatok eredményei is sokat mondanak ennek a gyümölcsnek az előnyeiről. Több mint 100 bioaktív hatóanyagával már a sejtektől ... további részletek >>

segíti egészségünk megőrzését, immunerősítő és gyulladásgátló hatással is rendelkezik. Noni rendelés webshopunkban!


Feladva: 2017-07-26    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Nonimárgyógyítókjuicegyümölcsbőlsegítimondanakvasattörzsimelyekhezsejtektőlsokatkáliumotpolinézwebshopunkbanezekeredményeimagnéziumotnemcsak100

Forrás: pepitahirdeto.multiapro.com

Újdonság Magyarországon a porcelán urna, mely gránit, márvány mintával, többféle színben választható és amire az Elhunyt porcelánképe kerül. Az urna elhelyezhető kültéren, bírja az időjárás viszontagságait, de egy otthoni házi oltár dísze is lehet. Az urna üreges, talpán van a hamvak elhelyezésére szolgáló nyílás, amit a hamvak elhelyezése után ragasztással kell rögzíteni. A teljes választék megtekinthető a www.sirkokep.hu oldalon.


Feladva: 2016-07-14    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: urnahamvakbírjakellmárványüregeskültérenragasztássalgránitelhelyezhetőutánmelylehetkerülelhelyezéseporcelándíszeoldalonporcelánképeoltáramit

Forrás: pepitahirdeto.multiapro.com

Akciós szépséghibás, kartonsérült és outlet háztartási gépek akár féláron! Új, csomagolássérült, leértékelt és outlet mosógépek, hűtőszekrények, valamint egyéb háztartási gépek széles választékban azonnal, készletről! Üzleteinket személyesen is érdemes meglátogatni, címlista itt: www.leertekelve.hu/content/6-kapcs olat


Feladva: 2017-04-27    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: outletleértékeltgépekháztartásihűtőszekrényekHirdetőszemélyesenmosógépekPepitaÜzleteinketBoltjakészletrőlkapcsolatÁrukazonnalcsomagolássérültcontent

Forrás: pepitahirdeto.multiapro.com

Hogyan kaphat ajándékba egy olyan pénztermelő gépezetet, ami nulláról indulva, alig 29 nap alatt, képes volt 3.748 eurós jövedelmet generálni, miközben emberek tucatjainak tettük egészségesebbé az életét…


Feladva: 2017-08-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8230egészségesenvoltegyéletétvégreképesajándékbaegészségesebbéSzeretnealattkaphatsztettüknapHogyantucatjainakalig8220emberekindulvaJózsef

Forrás: pepitahirdeto.multiapro.com

Porcerősítés céljából és ízületi gyulladás ellen kurkuma fogyasztása jól bevált módszer világszerte. Ezt az ősi fűszert gyulladás- és fájdalomcsökkentő hatása miatt alkalmazzák a mozgásszervek gyakori problémáira. A kurkuma hatékony ízület erősítő és porcerősítő gyógynövény, mely néhány héten belül képes jelentős javulást előidézni a mozgásban. A fájdalom, a duzzanat, a gyulladás fokozatosan mérséklődik, majd megszűnik. Mellékhatásokat okozó gyógyszerek nélkül is lehetséges újra fájdalom nélkül ... további részletek >>

járni vagy lépcsőzni! A porcerősítők kurkumából alternatív gyógymódot jelentenek a gyulladás és porckopás ellen.


Feladva: 2017-08-29    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: gyulladáskurkumaellennélkülporcerősítőfájdalomfogyasztásamérséklődikmelyjárnimiattízületifokozatosangyógynövényhatásacéljábólduzzanatporckopásősi

Forrás: pepitahirdeto.multiapro.com

Clímatrend termékeinket továbbra is ClimaGuard™ Premium üveggel (Ug=0,6 W/m2K), és extraként Swisspacer™ távtartó profillal (meleg perem) gyártjuk. Mindezek ellenére árainkat nem emeljük! Vásároljon extra hőszigetelésű üveggel készült ablakot, erkélyajtót és bejárati ajtót régi áron! Minőségi termékek elérhető áron, Schumacher™ nyílászárók! Kérjen ingyenes árajánlatot! Tel:06-79/478-405 E-mail: info@schumacherajto.hu www.schumacherajto.hu


Feladva: 2016-01-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SchumacherüveggeláronbejáratiellenéreingyenesClimaGuarderkélyajtótMindezekKérjentovábbraablakotgyártjuknyílászáróktermékeinketkészültschumacherajto

Forrás: pepitahirdeto.multiapro.com

A száj fertőtlenítő propolisz fogkrém használata természetes módját jelenti a rendszeres fogápolásnak. Vele javíthatjuk a fogak és az egész szájüreg egészségét, elejét vehetjük a gyakran a fogak elvesztését okozó ínybetegségnek. A propolisz hatásai a fogakra kórokozó ellenes tulajdonságainak köszönhetőek. A benne lévő flavonoidok gondoskodnak a baktériumok távol tartásától és legyőzéséről, ha azok már megfertőzték a szájüreget. Használata ajánlott azoknak is, akik már ínygyulladással vagy ... további részletek >>

fogínyvérzéssel küzdenek. A száj fertőtlenítő propolisz fogkrém véd a szájpenész és az afták ellen is. www.propolisz.fluormentes.com/propolisz-tinkturat


Feladva: 2017-07-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: propoliszfogkrémfogakHasználatafertőtlenítőszájmárelvesztésétajánlottrendszereslévőjelentibennegyakranmódjátszájüregetköszönhetőekvehetjükelejét

Forrás: pepitahirdeto.multiapro.com

Befektetőt, társat keresünk, 50-100 Mft-tal, azonnal kezdhető társasházak építéséhez, közre működéssel vagy a nélkül. Biztos megtérülést, garanciát, biztonságot ajánlunk. Biztosan Ön is tudja, hogy most lakásokba megéri befektetni. Jelentkezni a haza i@upcmail.hu e-mail címen.


Feladva: 2017-10-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: építéséhezkeresünkBefektetőthogyközrepesttudjaKftBiztosantársasházakcímenFinancialajánlunkkezdhetőmailEurópabiztonságotazonnalhazai@upcmailtal

Forrás: pepitahirdeto.multiapro.com

Legyen igényes autójára, nem mindegy a megjelenés! Nézzen be hozzánk, minőségi munka, korrekt árak. Kérjen időpontot, hogy ne kelljen várakoznia. Kézi autómosó, Sárvár.(a régi Opel szervízben) www.tibronc.wixsite.com/kezi-autom oso-sarvar


Feladva: 2017-03-03    [Autó - Motor - Jármű]

Címkék, kulcsszavak: SárvárkeziNagyrégiminőségiSzombathelyihozzánksarvarautómosóNézzenautomosovárakozniamegjelenéskelljenmindegycomhogynemwixsiteidőpontotautójára

Forrás: pepitahirdeto.multiapro.com

Egy világméretű üzletet már ellehet kezdeni 15.000 forinttal! Te szeretnél pénzt keresni, vagy még dolgozni akarsz apró pénzért? Ez egy vásárlói közösség. Ha tovább ajánlod a kártyát, milliós jövedelmed származik abból is. A lehetőség korlátlan, te döntöd el mit választasz a pénz kereset szempontjából, 12 féle lehetőség közül választhatsz!!!! Skype: kollar.klara a további információ itt: www.forevergreen.cafeblog.hu/2017/ 09/27/van-egy-jo-munka-en-ezt-megle ptem


Feladva: 2017-09-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: egylehetőségmárüzletetvilágméretűforinttal000kezdeniellehetszármazikakarszjövedelmeddolgoznifélemilliósmégszempontjábólkártyátittvagykereset

Forrás: pepitahirdeto.multiapro.com

HONDA GL 1500 GOLD WING - 1989-07 HAVI 74 KW 101 LE 154.982 KM !! 2018-05-ig érvényes MŰSZAKIVAL, 2 GYÁRI kulccsal,Jó állapotú első- hátsó gumikkal és féktárcsákkal, Barna BŐR ÜLÉSEK, AM/FM RÁDIÓ, TOLATÁS FUNKCIÓ, Elöl-hátul kiépített 12V rendszer, Kéz és Térdfűtés, MAGYARORSZÁGI RENDSZÁMOS!!!!!! Rendezett MAGYAR okmányokkal, azonnal megvásárolható!!!!! Eladó: 1.199.000.- Ft (Csereár 1.299.000 .-Ft) Akár hétvégén is megtekinthető, előzetes egyeztetés alapján! További képekért és ... további részletek >>

járművekért kérem keresse fel honlapunkat! www.markamotor.hu/magyar/motorok/gl-1500-gold-wing/legujabbak/osszes Teljes körű ügyintézés, Magyar rendszámos motorok névre írása, igény esetén friss Szerviz! Házhoz szállításban tudunk segíteni!


Feladva: 2017-11-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: WINGGOLDMAGYAR1500000RENDSZÁMOSHONDAmotorokHirdetőTovábbiféktárcsákkalrendszerosszes154199szállításbanPepitaképekértgumikkalKézTeljes101

Forrás: pepitahirdeto.multiapro.com

A Makulátlan Tiszta Terület Kft., Panoráma ablak, a PVC, a Parketta, a Felújítás utáni, A szőnyeg mély tisztítása, az Irodai eszközök tisztítását, a Zsíros kézmosó, a Boltíves üvegtető, a Lépcsőházi takarítás, a Kazánház takarítása, a Sportlétesítmény, a Kirakattisztítás, a Nagy felületű ablak tisztítása, a Mohás terasz takarítása, az Éttermi asztal tisztítása, a Maszatos, csíkos padló tisztítását a Gumicsík eltávolítását, a seprést, a Domború burkolatok, az Irodaház ablakainak tisztítását, az ... további részletek >>

Olajozott parketta tisztítását, a Garázs tisztítását, mind kihívásnak tekinti, és örömmel végezzük el.


Feladva: 2016-11-16    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tisztításáttisztításaMakulátlanparkettatakarításaKftTerületablakTisztafelületűeszközökpadlóNagyGarázsIrodaicsíkoskerületKirakattisztításmélyPVC

Forrás: pepitahirdeto.multiapro.com

Luxus Cars Jaguar az országban egyedülállóan foglalkozik hófehér jaguárok bérbeadásával. A Jaguár ezen R-es típusából fehér színben, jelenleg a nálunk lévő kettő darab található Magyarországon! Ritka és egyedi esküvői autó. A méltán elhíresült hófehér Jaguár egyedi megjelenése minden esküvői stílushoz igazodik a retrótol a legmodernebbig, fehér színe pedig szintén minden stílussal össze illeszthető az esküvők alapszíneként. Az autó kölcsönzése, bérlése bármely célra megfelelő lehet.


Feladva: 2016-09-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: esküvőimindenegyediJaguárhófehérfehérautóegyedülállóanösszekettőlehetországbanstílussalmegjelenéselévőmegfelelőJaguarnálunkcélraCarsszintén

Forrás: pepitahirdeto.multiapro.com

Non-stop bútorszállítás, költöztetés, lomtalanítás! Ügyfeleink időbeosztásához rugalmasan igazodunk, hétvégén és éjszaka is dolgozunk, telefonon a nap minden órájában elérhetőek vagyunk! Több éves tapasztalattal, jó referenciákkal, gyors és pontos munkavégzéssel hétvégén is hétköznapi árakon állunk rendelkezésükre! Igény szerint csomagolunk csomagolóanyagot kiszállítunk, szerelést is vállalunk! Tel: +36 70 2353403


Feladva: 2017-02-20    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: költöztetéshétvégénmindenbútorszállításcsomagolunkBudapestreferenciákkaléjszakaszerintCsacsitransztapasztalattaligazodunkIgénynapjánévesrugalmasanhét

Forrás: pepitahirdeto.multiapro.com

Béreljen, vagy vegyen! Miért éri meg a Fiscal Online pénztárgépet választani? - Kisméretű - Akkumulátoros - Érintőkijelzős - Könnyű, gyors papírcsere - Kis és közepes forgalmú üzletekben megállja a helyét - Felhasználó barát kezelés - Végösszeg korlát az elütések elkerülése végett - Nyugta sztornó, hogy felejtse el a sztornó füzetet - Átszemélyesíthető A bérlésről itt olvashat többet: ... további részletek >>


Feladva: 2017-07-11    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: sztornópapírcsereéribérlésrőlVégösszegATCgyorsMiértÁtszemélyesíthetőkezelésakcióKönnyűvegyenfüzetetbarátPénztárgépÉrintőkijelzősvagyFelhasználó

Forrás: pepitahirdeto.multiapro.com

Ha szeretnél Hollandiàban dolgozni, vagy màr kint vagy de vàltanàl?! Beszélsz angolul? Hívj bátran a 06706275010-es számon, hogy segíthessek Neked is munkát találni! Munkavállalók számára nincs közvetítői díj! A szállást a munkáltató biztosítja! Tutira megyünk, így munkaszerződéssel a kezedben indulhatsz útnak! Nézz szét a www.nrgkulfoldimunka.hu/kulfoldimu nka oldalon! Ha regisztrálsz, felhívunk!


Feladva: 2017-12-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 224vagywwwkintmunkáltatóHollandhogyszétdolgozniszállástszámonNézzbandíj06706275010útnakHollandiközvetítőibátranindulhatszszeretnélnincs

Forrás: pepitahirdeto.multiapro.com

A bagoly mintás zokni a szürke őszi-téli napokba egy kis pajkosságot varázsol színes mintájával és érdekesen kialakított felső részével. Kiknek ajánljuk ajándékba? - akik szeretik a különleges zoknikat - bagoly fanoknak - vidám minták kedvelőinek - akiknek mindig eltűnik a zokni egyik párja a mosógépben Méretei - egy méretben kapható: talpa 18-19 cm hosszú (nem nyújtott állapotban) - ez egy átlagos méretű női lábnak felel meg (35-39) szélessége: 8 cm Színe: több színkombinációban ... további részletek >>

kapható Anyaga: pamut, poliészter, spandex Itt található: www.atomzsir.hu/bagoly-mintas-szines-noi-zokni


Feladva: 2017-10-12    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: zoknibagolyegyszinestéliőszinoikaphatószínkombinációbanajánljuknyújtottakiknektöbbKikneknematomzsirkedvelőinekSzínerészévelhosszúszürkewww

Forrás: pepitahirdeto.multiapro.com

Kecskemét mellett Helvécián dinamikusan fejlődő településen, autópályától és a Mercedes gyártól 3 percre kiadó egy nettó 50/170 négyzetméteres kis műhely, udvarral, kis előtelővel, bekerítve. Nyugodt területen, műhelynek, rajtárnak, telephelynek.


Feladva: 2013-08-04    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: HelvéciánmellettKecskemétkiadóMercedeselőtetővelautópályátólkistelepülésenudvarralfejlődő661kisműhelydinamikusanÉrd170nmtelephelyneknettóegy

Forrás: pepitahirdeto.multiapro.com

Magyar termék, közvetlenül a gyártótól. 5 év garancia! Új ZS-Therm vegyes-tüzelésű kazánok: 15,22,27,35kw teljesítményben már 71.500 Ft + áfától. Kizárólag nyitott rendszerre (próbanyomás: 0,8 bar), vagy akár zárt rendszerre (próbanyomás: 3 bar) is szerelhetők. A kazánokhoz tartozékok megvásárolhatók 8000 Ft + áfás áron. Kazánjaink VM MGI vizsgálatával, TÜV Tanúsítvánnyal és CE Megfelelőségi jellel rendelkeznek. A kazánok mellett fűtési puffertartályok, gabonakanalak, pótkocsi ... további részletek >>

felépítményekhez hajlított trapézlemezek gyártásával is foglalkozunk. Ezúton szeretnénk felhívni figyelmüket a puffertartály akciónkra! Pl: 1000 literes puffertartály 69000 Ft + áfa! Termékeink értékesítéséhez hazai és külföldi (szlovák, román) viszonteladókat keresünk. Bővebb információért forduljon hozzánk bizalommal!


Feladva: 2017-10-02    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: barpróbanyomásrendszerretüzelésűvegyeskazánokpuffertartályhajlított500keresünkTanúsítvánnyalMagyarliteresszerelhetőkfelépítményekhezmárTÜVajánlás

Forrás: pepitahirdeto.multiapro.com

100+ nyelvpárban fordítunk szakszövegeket, a legmodernebb nyelvtechnológiai eszközökkel, magasan képzett szakfordítók bevonásával, professzionális irodai háttérrel. Specialitásunk a többnyelvű projektek kezelése, magyarról és angolról fordítunk egyszerre akár 40+ nyelvre. Leggyakrabban az alábbi témakörökben fordítunk, napi kapacitásunk több száz oldal: - jogi és pénzügyi szakszövegek, műszaki dokumentációk - felhasználói kézikönyvek, útmutatók, honlapok és online tartalmak - ... további részletek >>

szoftverfelületek és mobil applikációk - betegtájékoztatók, egészségügyi kiadványok - marketing anyagok - tréning és e-learning anyagok, multimédia tartalmak Irodánk kiemelten sok műszaki és élelmiszeripari szöveget fordít, ezekkel a projektekkel két külön divíziónk foglalkozik. A fordításokat fordítástámogató szoftverrel készítjük el, így lehetőség nyílik a szövegen belüli és a korábban lefordított szövegek közti egyezőségek felismerésére. További előnyök: - ismétlődésekkel arányos kedvezményes vállalási ár - garantált, következetes terminológia használat - könnyebb és hatékonyabb minőségellenőrzés - rövidebb határidők A fordításhoz kapcsolódó szolgáltatásainkra is felhívjuk a figyelmét: - lokalizálás - lektorálás - nyelvi konzultáció - fordítómemória és terminológiaépítés - szövegszinkronizálás - stílusútmutató - nyelvi tesztelés - gépi fordítás és utószerkesztés - DTP - internationalization „i18n” - leírás - kreatív fordítás | transzkreáció - voice over Kérje ajánlatunkat! www.edimart.com/szolgaltatasok


Feladva: 2017-04-12    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: fordításfordítunkműszakinyelviakártartalmakanyagokdokumentációkszakszövegeketfelhívjukfordítástámogatóalábbiovertranszkreációkövetkezetesegészségügyi

Forrás: pepitahirdeto.multiapro.com

Robway Hoverboard-ok széles választéka. Legjobb minőség, garancia, Samsung akkumlátor, Bluetooth, Innovatív applikáció. 79.900 Ft-tól www.cityroll.hu/robway.html


Feladva: 2017-09-22    [Autó - Motor - Jármű]

Címkék, kulcsszavak: robwayHoverboardBluetoothHirdetőakkumlátorPepitaSamsunghtmlgaranciaminőségcityrollLegjobbwwwválasztékatólszéles900applikációGyőrInnovatív

Forrás: pepitahirdeto.multiapro.com

Ásványból készült ékszerek, nyakláncok, karkötők hihetetlen árakon, most nagyszerű kedvezményekkel a Lili Bizsu Webáruházban. Karkötők már 290 Ft-os akciós ártól! www.lilibizsu.hu/fokat/5627b9518x2 82-ASVANY-EKSZEREK


Feladva: 2017-04-10    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: LiliKarkötőkBizsuakciókedvezményekkelásványékszernagyszerűmostártólárakonakcióshihetetlen290FtnyakláncokmárékszerekkészültWebáruházbanÁsványból

Forrás: pepitahirdeto.multiapro.com

Irodák, lakások napi, heti, havi takarítása, nagytakarítás, biotakarítás, igényes egyedi munkavégzéssel, profi személyzettel, gépekkel. Kárpit, szőnyeg, padlószőnyeg tisztítás profi extrakciós géppel. Cégeknek, magánszemélyeknek, mindenkinek. Igényes, precíz munkavégzés, korrekt árakon. További szolgáltatásainkról érdeklődjön honlapunkon, vagy telefonon. REND A LELKE MINDENNEK!


Feladva: 2016-01-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: IgényesprofiRENDlakásokgépekkeltelefononIrodákmindenkinekszemélyzettelvagyPécsmagánszemélyeknekmunkavégzésselhonlapunkonKftCégeknekegyedigéppel

Forrás: pepitahirdeto.multiapro.com

Balaton, Balatonfenyves, közvetlen vízparti szállás, üdülés, horgászat. Az udvarból a Balatonba léphet... csak 1 lépés a Balaton! Strandolás, horgászat helyben. Biztonságos, családias, gyermekbarát környezet. Ingyenes stég, csónak, vízibicikli, kerékpár használat. Bográcsozási lehetőség. SZÉP-KÁRTYA elfogadás! Nézze meg a honlapot és kérjen ajánlatot! NE FELEDJE: ... csak a halak vannak közelebb a Balatonhoz...


Feladva: 2016-09-25    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: csakhorgászatBalatonBalatonfenyvesilépésüdüléslehetőségBiztonságosvízpartiBográcsozásihelybenFELEDJEközvetlenhasználatajánlatotBalatonfenyveskerékpár

Forrás: pepitahirdeto.multiapro.com

Csapatomba keresek dolgozni akaró kollégákat! Otthonról dolgozhatsz, ha gyesen, vagy éppen tanulsz, de szeretnél zsebpénzt. Nem találsz munkát és szükséged lenne olyan lehetőségre, amivel csökkentheted háztartásod kiadásait. Nyugdíj mellett jól jönne kiegészítő jövedelem. Akkor Téged kereslek!!!


Feladva: 2017-11-21    [Pénzkeresés - MLM]

Címkék, kulcsszavak: dolgoznikiadásaitzsebpénztkeresekháztartásodszeretnélkereslekCsapatombacsökkenthetedtanulszTégedSiófokamiveléppenAkkorErzsébetlehetőségrevagyjól

Forrás: pepitahirdeto.multiapro.com

A Google kereső algoritmusa folyamatosan változik, mondhatni finomodik... Ennek lehetséges következménye lehet, hogy néhány - addig jól kereshető - weboldal, esetleg hirdetés kereshetetlenné válik, eltűnik. Általánosságban természetesen törekszünk arra, hogy a hirdetéseinkkel ez ne történjen meg! Garantáltan megóvni azonban csak azokat a felügyelt tartalmakat tudjuk, melyekre konkrétan felkérnek. Köszönjük a bizalmat, amit egy-egy hirdetés feladással kifejeznek a kedves látogatóink, ... további részletek >>

de a legjobb az lenne, ha a fontos dolgokra külön fel is hívnák üzenetben a figyelmünket egy üzenettel! Marad a mottónk, mely alapján keresőinket is üzemeltetjük: Nekünk az a fontos, ami Önnek az!


Feladva: 2017-05-19    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: egyhogyfontoshirdetéshívnákÁltalánosságbanamitkövetkezményeüzemeltetjükazonbanHirdetőfeleltűnikbizalmatlehetségeskeresőinketmegóvniPepitakülön

Forrás: pepitahirdeto.multiapro.com

Amiért érdemes figyelemmel kísérnie minket: • 60-70-80 % kedvezmény! • Kifutó szériás bútorok, amíg a készlet tart! • Hetente megújuló választék! • Konyhabútor, 4-6 elemes 29.000 Ft-tól • Szobai szekrénysor 29.000 Ft-tól • Hálószobai szekrénysor 29.000 Ft-tól • Tükrös gardrób 19.000 Ft-tól • Ülőgarnitúrák 39.000 Ft-tól • Ágy 19.000 Ft-tól • Étkezőgarnitúra 19.000 Ft-tól • Tálalószekrény 19.000 Ft-tól • ... további részletek >>

Kiegészítő kisbútorok 3.000 Ft-tól


Feladva: 2016-08-30    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 8226tól000szekrénysorbútorokminketTálalószekrényfolyamatosanválasztékkísérnieÉtkezőgarnitúraAkciósmegújulófigyelemmelÁgyHetenteérdemesÜlőgarnitúrák

Forrás: pepitahirdeto.multiapro.com

A Bujdigép Kft. 2004-től biztosít nagyteljesítményű munkagépeket kis- és nagyberuházásokhoz Szegeden, Csongrád megyében és országosan. Béreljen földmunkagépeket, autódarukat, emelőgépeket a Bujdigép Kft.-től. Makó, Kiskunhalas, Baja, Mórahalom, Kistelek, Hódmezővásárhely térségében biztosítunk munkagépeket kis- és nagyberuházásokhoz.


Feladva: 2016-06-13    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: nagyberuházásokhoztőlkisKftmunkagépeketBujdigépMakóSzegedennagyteljesítményűbiztosít2004biztosítunkemelőgépeketSzegedtérségébenautódarukatAnderass

Forrás: pepitahirdeto.multiapro.com

Nyugtató-lazító hatás: a test átmelegszik, könnyeddé válik az idegek kisimulnak az izmok ellazulnak az idegrendszer megnyugszik a vér- és nyirokkeringés megélénkül javul a sejtek oxigén- és tápanyagellátása salak- és méreganyagok kiválasztása hormonális hatás (érintésre a szervezet endorfin és oxitocin hormont állít elő, amelyek a test saját stressz- és fájdalomcsillapító szerei).


Feladva: 2015-08-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatástestméreganyagokpozitívellazulnakelőNagysalakhogyizmokállítmasszástápanyagellátásacéljakisimulnakhormontrelaxációsoxigénvégzőidegekválik

Forrás: pepitahirdeto.multiapro.com

Tessék már belegondolni! Mi szüksége van a Google-nak egy MLM cégre? Ha pedig mégis lenne, pont olyan emberekre bízná a toborzást, akik nem, vagy alig értenek valamit az internetes megjelenéshez? Értem én hogy nagy a szükség és meg kell ragadni - főként - a kínálkozó online lehetőségeket! De... 1. Rendkívül etikátlan valamit álláshirdetésként hirdetni, ami nem az! 2. Az MLM (Multi Level Marketing) értékesítési szisztéma jó dolog. Pont ilyen megtévesztésekkel kell elijeszteni tőle jó ... további részletek >>

sok mindenkit, hiszen sokakban úgy csapódik le, mintha az összes MLM erről szólna. 3. Legyen már legalább annyi igénye végre az internet használóknak, hogy bármi, amit olvasnak a neten, annak utána néznek előbb a jellemző szavakat keresve! A XXI. századi ember attól lesz valaki, ha tudja és akarja használni az eszközeit! www.pepitahirdeto.multiapro.com/apro.php?page_id=60546


Feladva: 2016-11-01    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: MLMPontvalamitmárGooglehogynemkellbíznájellemzőmegtévesztésekkelszükségeinternethirdetniakarjaminthaszükségemberekreelőbbilyenbelegondolni

Forrás: pepitahirdeto.multiapro.com

A reggeli futás hatásai a nap további részére azontúl, hogy megadják a kellő lendületet, még szellemi teljesítményünket is képesek javítani. Ha lassú tempóban végezzük, szervezetünkben felszabadul a kreativitás hormonja, melynek nagy hasznát vehetjük a napi problémák megoldásában. A futás és zsírégetés közti kapcsolat sokak számára a legnagyobb ösztönzést adja ahhoz, hogy ezt a mozgásformát válasszák. A megfelelő pulzusszámot elérve beindul a zsíranyagcsere, ennek köszönhetően érhetjük el a ... további részletek >>

szép, tónusos izomzatot. Futás kezdőknek és haladóknak - hasznos tippek weboldalunkon!


Feladva: 2016-11-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Futászsírégetéshogyköztitónusosfelszabadulmozgásformátkellőszépszervezetünkbeneztmegadjákmegoldásábanérhetjükvégezzükazontúlproblémákköszönhetően

Forrás: pepitahirdeto.multiapro.com

Android mobilalkalmazás programozókat keresünk Debrecenbe, akik annyira elhivatottak a programozás iránt, hogy már zöldülnek #A4C739 kód szerint és növekszik a robot antennájuk. Ha még nem tartasz itt, akkor is jelentkezz, mert ki tudjuk mutatni jó úton haladsz-e a folyamatban. Elõny, ha már a Google Play-en is van fent app-od, amit magadtól, nem céges nyomásra készítettél. További információ a www.jobs.ozeki.hu/index.php?owpn=5 4 oldalon.


Feladva: 2016-06-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: márnemozekiAndroidKfttartasznyomásraprogramozás245fejlesztőoldalonmégcégeselhivatottakfolyamatbanowpnantennájukannyirahaladszphprobotakik

Forrás: pepitahirdeto.multiapro.com

Ajándékozz névnapra, születésnapra gravírozható, rozsdamentes fém flaskát. Minden féle méretben, különböző ón matricákkal is kapható. Érdeklődj telefonon: 30 640 5940, postázni is tudjuk. www.hunbolt.hu/spd/2041/Flaska-kul onbozo-meretben-gravirozhato-laposu veg


Feladva: 2017-02-13    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: kaphatóméretbenMindenpostázniflaskát5940fém640rozsdamentestelefonongravírozhatóÉrdeklődjszületésnapranévnapramatricákkalAjándékozzkülönbözőBudapest

Forrás: pepitahirdeto.multiapro.com

A bélflóra egészségünk szempontjából hasznos és káros baktériumokat is tartalmaz. Több száz mikroorganizmus él itt, alapvetően egyensúlyban. Ám számos tényező van, ami ezt az egészséges egyensúlyt felboríthatja, pl. a stressz, a dohányzás, az alkoholfogyasztás és az antibiotikumok. Miért fontos a bélflóra helyreállítása? A károsodott bélflóra nem tud kellő támogatást nyújtani az immunrendszernek, így ha nem gondoskodunk a regenerálásáról, hosszútávon egészségünk romlani kezd, akárcsak a ... további részletek >>

közérzetünk, vitalitásunk. Ha gyakran kapunk el fertőzéseket, gyanakodhatunk! A bélflóra helyreállítása probiotikummal 100%-ban természetes módon történhet.


Feladva: 2017-04-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: bélflórahelyreállításaegészségünkfontosMiértnemkellőprobiotikummalegészségesTöbbromlanitudezttartalmazkárosodottamibaktériumokathosszútávonvan

Forrás: pepitahirdeto.multiapro.com

Póló szitanyomás, póló nyomtatás cégeknek, iskoláknak. Egyedi póló kiváló minőségben! Tervezze meg kedvenc pólóját, küldje el nekünk mit szeretne és mi megszitázzuk az ön által kiválasztott színű méretű pólójára. Megrendelését akár személyes, akár postai utánvéttel veheti át. A megrendelt termékeket 5-10 munkanap alatt juttatjuk el önhöz. Nagyobb mennyiségű megrendelések esetében ez az idő akár 10-15 nap is lehet megegyezés szerint. További kérdésére szívesen válaszolunk ... további részletek >>

keressen minket élérhetőségeink egyikén. A Facebook-on is megtalál: www.facebook.com/poloranyomas.hu


Feladva: 2017-02-16    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: pólószitanyomásakárnyomtatáspoloranyomasNagyobbiskoláknakakkorutánvéttelTovábbimitönhözcégeknekpostaiszerintnekünkjuttatjukszemélyesmegegyezés

Forrás: pepitahirdeto.multiapro.com

Mindenki számára egyszerűen és gyorsan kezelhető, folyamatosan a hatályos jogszabályok szerint fejlesztett számlázó program, készletnyilvántartó program és házipénztár szoftver. A programok DEMO változata díjmentesen kipróbálható! Díjmentes belföldi szállítás akár másnapra, letöltés esetén munkaidőben akár 1 órán belüli használatba vétel. CD-s változatban is igényelhető, több száz referenciával, ügyfélszolgálattal, NAV igazolással. www.naturasoft.hu/szamlazo_program .php


Feladva: 2016-08-17    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: programszámlázónaturasoftakáregyszerűenszállításváltozatbanBudapestbelföldiszamlazofejlesztettvételDíjmentesszerinthasználatbakipróbálhatówwwbelüli

Forrás: pepitahirdeto.multiapro.com

Ha van egy vállalkozási ötlete, de nincs (elég) pénze a megvalósítására hívjon, írjon, segítünk. Keresünk Önnek egy olyan befektetőt, aki addig finanszírozza vállalkozását, amíg az szükséges. Szolgáltatásunk sikerdíjas! Részletek a honlapunkon: www.civishitel.hu/vallalkozoi-hite lek


Feladva: 2016-07-23    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: pénzenincsötleteegyvansegítünkHitelirodaamígírjonCívishitelvállalkozásáthívjonfinanszírozzamegvalósításáraaddigakielégbefektetőthonlapunkon

Forrás: pepitahirdeto.multiapro.com

Bedolgozást vállalok ipari gépekkel Tárnokon. Szállítani sajnos nem tudok. Folyamatos munkát keresek. Heti 1-szeri szállítással lenne a legjobb. A megbeszélt időpontot mindig tartom. Gépparkom: - 4 szálas Siruba interlock - Brother fedőző - Siruba és Textima gyorsvarrók - Elszívós vasalóasztal és gőzölős vasaló.


Feladva: 2018-01-19    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: BedolgozástSirubaTárnokonfedőzőszállítássalgépekkelBrotherszeriipariinterlokkHetivállalokszálaskeresekvasalóGépparkommunkátgőzölősIldikótartom

Forrás: pepitahirdeto.multiapro.com

Búvóhely pároknak Siófokon néhány órára vagy éjszakára is! Csak hívj és foglalj. A feltüntetett ár 3 órára vonatkozik.Új szolgáltatásunk, dézsafürdőnk is igénybe vehető.(egyeztetést igényel) Rejtett telefonhívásokat nem fogadunk! Csak párok hívjanak! Nálunk a diszkréció az elsődleges szempont!


Feladva: 2017-06-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: pároknakBúvóhelyCsakóráraRejtetthívjszempontigényeléjszakáraelsődlegesegyeztetéstvagydiszkrécióvehetőnéhányNálunkigénybeSiófokonhívjanakpárok

Forrás: pepitahirdeto.multiapro.com

Egyedileg válogatott, magas minőségű gyerekruhák piciknek és nagyoknak. Örök méretgaranciával, akár ingyenes szállítással. A Facebookon is megtalálsz, keresd: Ruhacuka


Feladva: 2017-09-29    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: RuhacukaHasználtHirdetőakárajánlásingyenesEgyedilegszállítássalválogatottFacebookonmagasmegtalálszminőségűkeresdwebáruházgyerekruhákpiciknekÖrök

Forrás: pepitahirdeto.multiapro.com

Recepcios, szobalany, szakacs, pincer! Szívesen dolgoznál Németország gyönyörű tájain, szebbnél szebb hotelekben? A szállás ingyenes! www.nrgkulfoldimunka.hu/nrgelerhet oeseg Bérezés nettó 1100 Eur/hó-tól! Ne habozz! Regisztrálj www.nrgkulfoldimunka.hu oldalon vagy hivj most a 06706755010 - es szamon !


Feladva: 2018-01-16    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: pincerszakacsszobalanyRecepciosRegisztráljszebbnélKFThabozztájainCompanytólgyönyörűRecruitmentszamonEurNémetországNRG067067550101100dolgoznál

Forrás: pepitahirdeto.multiapro.com

Szeretnéd meglátogatni Peru legismertebb nevezetességeit mint Machu Picchu romjai, a Titicaca-tó vagy a Colca-kanyon? Esetleg olyan látnivalók érdekelnek, amikről olvastál de nem szerepelnek az utazási irodák ajánlataiban? Jelenlegi perui lakosként több éves latin-amerikai barangolásaim tapasztalatával vállalom személyre szabott nyaralások megszervezését és lebonyolítását magyar nyelvű utaskísérőként kedvező áron. Info: www.facebook.com/peruinyaralas és www.payasyougoholidayperu.com


Feladva: 2016-08-24    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: peruiáronnyaraláscomwwwPeruajánlataibankanyonInfomeglátogatnivállalomirodákColcaSzeretnédtapasztalatávalutazásivagykedvezőLimabarangolásaim

Forrás: pepitahirdeto.multiapro.com

Kézzel horgolt babacipő, babaszandál, sapi, keresztelő babaszett. Rendelhető keresztelőre, babaszületésre, ünnepre, hétköznapra. Kiváló babaviselet. A babacipő szép és kényelmes. Pamut fonalból készül, természetes szellőzése miatt a baba lába jól mozog és nem izzad benne. Talphossza: 7-12 cm Méret és szín választható! Nézzen be weboldalamra, válogathat a szebbnél szebb babacipők és más horgolt baba termékek között.


Feladva: 2016-11-10    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: horgoltbabacipőbabababaszettkeresztelőbabaszandálszíntermészetesbabaszületésreMéretkészülkeresztelőreTalphosszafonalbólmásRendelhetőbennePamutnem

Forrás: pepitahirdeto.multiapro.com

Ránk számíthatsz, ha szállíttatsz! Megbízható szakembereket keres akik megóvják értékeit a költöztetés során? Ne keressen tovább, hívjon minket még ma! Költöztetés 2 fő: 6500 Ft/óra Költöztetés 3 fő: 8000 Ft/óra Lomtalanítást is vállalunk!


Feladva: 2017-12-21    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: Költöztetésóra245minketszállíttatszhívjonszámíthatszvállalunktovábbRánkLomtalanítástkeressenatlaszsoránLomtalanítás8000értékeitmegóvjákKöltözetés

Forrás: pepitahirdeto.multiapro.com

Kedves Vendégek! Sok szeretettel várjuk Önöket a Büki Gyógyfürdő bejáratától 250 m-re található apartmanházainkban!


Feladva: 2016-08-17    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SzállásÖnöketvárjukszeretettelSokVendégekapartmanházainkbanKedvestalálhatóBükfürdő250ApartmanbejáratátólMolnárGyógyfürdőBükfürdőnBüki

Forrás: pepitahirdeto.multiapro.com

Hidraulika importőr cégünk megvételre hirdet: Hidraulika szivattyú, hidraulika pumpa, hidraulika fogaskerék szivattyú, hidraulika axial szivattyú, hidraulika szelep, hidraulika vezérlő, hidraulika útváltó, hidraulika tömb, hidraulika ágyú, hidraulika tőke, hidraulika henger, hidraulika munkahenger, hidraulika teleszkóp, hidraulika billentő henger, hidraulika


Feladva: 2017-10-17    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: hidraulikaszivattyúhengermegvételreágyúcégünktömbimportőrútváltóNagytarcsavezérlőPaszkalszelepPhilippaxialbillentőfogaskerékteleszkóppumpatőke

Forrás: pepitahirdeto.multiapro.com

Moteck SW 280 kétszárnyas kapunyitó szett: 83500 Ft Országos házhoz szállítás, 1 év garancia! Magyar nyelvű telepítési és programozási útmutatóval! Szeretné kézben tartani a kényelmet? Ha IGEN! Akkor Önnek találták ki az elektromos kapunyitószettet! Egy távirányítóval megoldja a kapunyitást, sőt a kerti világítást is kapcsolhatja a távirányító segítségével! A Moteck SW-280 egy igen kedvező árú, extra sallangoktól mentes, kiváló ár/érték arányú, több éve forgalmazott kapunyitó szett ... további részletek >>

márka. Természetesen az nem akadály, ha Önnek egy régi kertkapuja van: a motor felszerelhető régi, új, egy-, vagy kétszárnyú kapura is, illetve tolókapuk esetén szinte a legtöbb, már működő kapura is. A kapunyitó szettek felszerelése tehát nem kíván különösebb átalakítást a meglévő kapurendszerén! Egyszerű telepítés, komolyabb szakértelmet nem igényel a felszerelése! Megrendelés, további technikai információk weboldalunkon: www.boltcenter.hu


Feladva: 2016-09-20    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: kapunyitóegynemszettÖnnekfelszerelésekétszárnyúkapuraigenrégi280MoteckMegrendeléskényelmetkülönösebbmentesházhoztolókapukvilágítástakadálysőt

Forrás: pepitahirdeto.multiapro.com

Azért, mert a Gano Excel mellett már 4 éve elköteleztem magam, és amit életem egy jó lépésének tartok. Azért, hogy lecserélhesd a hagyományos kávéd egy egészséges és finom kávéra, amelytől jelentősen javul az energiád és a közérzeted. Azért, ganodermát, a spirulinát, és a Cordycepst tartalmaznak termékeink, és ezek jótékony hatására bármikor szükséged lehet. Egészség és szépség egy helyen! Azért, mert nekem már jövedelmem van ebből a „munkából”, és segíthetek Neked is ... további részletek >>

abban, hogy Te is tisztes jövedelemre tegyél szert. Persze csak akkor vagyok jó választás a számodra, ha neked is fontos a szabadság, az anyagi függetlenség és az egészség.


Feladva: 2017-08-16    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AzértegyegészségmárnekedhogymertExcelválasszakkorspirulináthagyományosmunkábólGanoszépségengemcsakganodermátlecserélhesd8222Tatabányalehet

Forrás: pepitahirdeto.multiapro.com

Sziasztok vonósok! BEIRATKOZÁS MOST!!! Egyéni módszeremmel, könnyedén, jó hangulatú hegedű órákkal várom a tanulni vágyókat Budapesten!!! Nálam nincs botkezű, botfülű ember, csak hegedülni szerető és tanulni vágyó emberkék vannak, akik szeretnek nálam tanulni és örömmel vesznek részt az órákon!!! Nincs korhatár, lehetsz 5, vagy 60 éves, egy a fő! Akarj és szeress hegedülni tanulni, mert az csodálatos! MINDEN HEGEDÜLNI VÁGYÓT SZERETETTEL VÁROK!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: tanulniHEGEDÜLNINincsnálamBudapestvagyvannakórákkalVÁGYÓTOroszlánlehetszemberkékhegedűÁRONkorhatárvágyóhangulatúMINDENAKCIÓSszeretőkönnyedén

Forrás: pepitahirdeto.multiapro.com

Gonzó még csak 6-7 hó körüli kisfiú, Aki már most nagy bajban van! A kutya egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie ... további részletek >>

Érdeklődni lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagymegkutyacsakGonzóegyvangazdaörökbebajbanGYEPMESTERIFogaddSÜRGŐSgazdinakNAGYONaltathatómárhagyjeredetikisjövendőbelijelentkezését

Forrás: pepitahirdeto.multiapro.com

Szívből - Jövő című könyvem szívből ajánlom a szépirodalmat, verseket kedvelő kedves olvasóknak. Megrendelni a webáruházban lehet: www.verses.boltaneten.hu/kinalat/1 __aranyosi_ervin_versei


Feladva: 2015-09-19    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: ervinaranyosiszívbőlverseikedvesmegjelentkedvelőversesköteteverseketlegújabbkinalatszépirodalmatboltanetenajánlomverseshttpkönyvemlehetcíműJövő

Forrás: pepitahirdeto.multiapro.com

A chiamag magas rost- és omega-3 zsírsav tartalommal rendelkezik. Természetes gyulladáscsökkentőként működik a szervezetben, ezzel elősegíti a szívbetegség és az elhízás megelőzését. A chia mag szuperélelmiszer, melynek fogyasztása előnyös az agy és az idegrendszer számára is. A kutatások megerősítették, hogy csökkenti a magas koleszterinszintet és a vérnyomást, javítja az agyi funkciókat, rendszeres fogyasztásával megelőzhető az időskori szellemi hanyatlás.


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: magchiachiamagmagascsökkentirendelkezikidőskorihogytartalommalmegelőzhetőmegerősítettékmegelőzésétzsírsavfogyasztásávalkutatásokelhízásomegaszámára

Forrás: pepitahirdeto.multiapro.com

Kuka, szelektív hulladéktároló, 120 literes, barna, fekete, kék, sárga, piros és zöld színekben. Továbbá 240 literes barna, fekete, kék, sárga, piros és zöld színekben, valamint fedél barna, fekete, kék, sárga, piros és zöld színekben. Tengely 120 l., tengely 240 l. és kerekek is kaphatók. 60 literes, 80 literes, gurulós, 85 literes, 110 literes, kerek, 110 literes horganyzott fém és többféle szemétgyűjtő konténer különböző színekben.


Feladva: 2016-02-16    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: színekbenkékfeketebarnakuka120lzöldpirossárgakülönböző240lszelektivtengely110lKerhttpgurolóstetővel80lvagy60lszínbenkonténerkaphatók

Forrás: pepitahirdeto.multiapro.com

Turkálósok, piacosok, magánvállalkozók figyelmébe ajánlom cégünket, amely több éves tapasztalattal kínálja Önnek használtruha termékeinket. 20 kg-os kiszereléstől az 500 kg-os kiszerelésig biztosítjuk a szezonális ruházatot. I. osztálytól a cream minőségig megtalál nálunk mindent egy helyen. Minden megrendelést ingyenesen kiszállítunk garancia vállalással. Kínálunk gyerek ruházatot, felnőtt használt ruházatot, bálás ruhákat, válogatott extra használt ruházatot, pólós bálákat, melegítős - ... további részletek >>

jogging használt ruha bálákat, lakástextilt, fajtára válogatott extra minőségű ruházatot. Kérje részletes ajánlatunkat!


Feladva: 2017-08-02    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: 224232236zatotruhextra242kathasznhasználttunkcégünketminőségűcreamOrigin20kgkisznlommelegkeinketingyenesenfigyelmválogatottosztályt

Forrás: pepitahirdeto.multiapro.com

Bogács üdülőövezetében a Termálfürdőtől, horgásztótól öt perc sétára önálló vendégház kiadó. Pihenjen családjával, barátaival úgy, hogy csak ismerősök vegyék körül! Itt nem kell idegenekhez vagy a tulajdonoshoz alkalmazkodnia. 2014 óta változatlan árakkal várjuk vendégeinket.


Feladva: 2017-01-24    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kiadóvendégházBogácscsaládjávalNórakellPihenjenvendégeinketKozmánénemvárjukBogácsonIttárakkalkörülönállóváltozatlanvegyéksétáraótaismerősök

Forrás: pepitahirdeto.multiapro.com

Kizárta magát? Nem nyílik az ajtó? Akad, szorul a zár? Hívjon és megoldjuk! Minden jellegű zár probléma gyors megoldása Budapest és Pest megye területén. Díjtalan kiszállás Budapest területén. www.zarcsere.eu Zárcsere - Zárcsere gyors szerviz éjjel-nappal.


Feladva: 2017-05-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: ZárcsereBudapestzarcserezárterületénnyílikgyorsNemproblémamagátwwwKizártahttpjellegűZárnyitásMindenZárszervizmegoldjukkiszállásHívjonDíjtalan

Forrás: pepitahirdeto.multiapro.com

Minden típusú zárszerkezet, nyitását vállalom, kulcselvesztés, vagy a zár-betét elromlása esetén. Nem fúrunk, törünk, rongálunk, NYITUNK. Hatósági ajtónyitás. Kinyitott ajtókon azonnali zárcsere kívánság szerint. Szakszerű munkavégzés, reális árakon. Szolgáltatásom: ajtónyitás, zárnyitás, hevederzár nyitás, páncélajtó nyitás, ajtómentés, betörés utáni helyreállítás. Biztonságtechnikában és ajtónyitásban komoly tapasztalat. Speciális amerikai és német szerszámok segítik a munkámat.


Feladva: 2015-10-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: ajtónyitászárnyitásajtómentésnyitászárcsereSpeciáliselromlásahevederzárPéterazonnalitapasztalatbetétKnappajtókonkomolyzárzárszerelésKinyitottvagy

Forrás: pepitahirdeto.multiapro.com

Ruhajavító üzletbe képzett varrónőt keresünk, felsőruházat és általános varrási munkák elvégzésére. Érdeklődni a 06 30 222 2912 vagy a 06 30 222 2912 -es telefonon lehet Munkaidő: Kedd - Péntek -ig Web: www.altalanosruhaszerviz.freewb.hu


Feladva: 2017-10-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkvarrónőt2912222üzletbeRuhajavítótelefononképzettfreewbvagyaltalanosruhaszervizÉrdeklődniLaszlohttpelvégzéséreBerkesWebmunkáksürgősen

Forrás: pepitahirdeto.multiapro.com

A magyar fejlesztésű és gyártású KREA gravitációs kéményrendszer a családi házak ideális kéménye. A kéménybe beköthető bármikor szilárd tüzelésű (cserép) kályha, kandalló, vagy akár kazán. Alkalmas atmoszférikus gázkészülékek füstgáz elvezetésére is, de megfelelő kiegészítőkkel egyszerűen és olcsón alkalmassá tehető turbós, ezen belül kondenzációs kazánok füstgáz elvezetésére égéslevegő ellátással együtt. Kedvező ár, hosszú élettartam, Kivitelezése egyszerű, akár saját kezűleg is elvégezhető. A ... további részletek >>

termékre 30 év garanciát vállalunk. A műszaki dokumentációk megtalálhatóak a Szegedi Székhelyünk és a Dunántúli Telephelyünk honlapjain! Országos házhoz szállítás : 12 000 Ft. Magyar Kéménygyártó Kft. Tüzeléstechnikai szaküzlet 8638 Balatonlelle, Kossuth Lajos utca 50/A Nyitva : H-P 8.00-16.00-ig. Tel.: 0630/8492544 www.kemenygyarto-balatonlelle.hu www.kemenygyarto.hu


Feladva: 2016-08-19    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: balatonlellekemenygyartoelvezetéséreKREAwwwfüstgázakárMagyardokumentációkAlkalmasélettartamkéményeTel000ezeneladóműszakikazánhosszúideálisKft

Forrás: pepitahirdeto.multiapro.com

Paprikakrémek és chili szószok fantasztikus kínálata a Kolbászáruházban! Minden termékünk kistermelői, kézműves termék! Kóstold meg finom szószainkat! Az édestől az extra csípősig! Házhozszállítás, utólagos fizetés!


Feladva: 2017-08-29    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: chiliPaprikakrémektermékBudapestfizetéskézművesKolbászáruházutólagoskistermelőiszószHázhozszállítástermékünkKolbászkrémcsípősigMindenextraédestől

Forrás: pepitahirdeto.multiapro.com

Az iratcsipesz, vagy Binder csipesz iratok, papírlapok gyors és sérülésmentes összefogására alkalmas. Az iratcsipesz rozsdamentes acélból készül, rugalmasságát nagyon hosszú ideig megőrzi. Az iratcsipesz nyom nélkül eltávolítható majd újra felhasználható. 10 ötlet az iratcsipesz használatára: www.youtube.com/watch?v=prG3qWjp4N k


Feladva: 2016-07-14    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: iratcsipeszcsipeszBinderötletrugalmasságátfelhasználhatókészülvagyújraacélbólBudapestmajdrozsdamentesprG3qWjp4Nkwtseltávolíthatóalkalmaswatchcom

Forrás: pepitahirdeto.multiapro.com

D-vitamin az egyik legalapvetőbb, legtöbb szervre ható építőeleme az emberi szervezetnek, amely hatással van nemcsak a csontok és az idegrendszer fejlődésére, de az immunrendszer működésére is. A magyar lakosság 95 százaléka D-vitamin hiányos. Ajánlott, októbertől - márciusig a D-vitamin kapszula formában történő bevitele!


Feladva: 2016-12-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vitaminvanFerencnéhiányoshatássalKerepesiszázalékaamelyalapfeltételelakosságszervezetnekbeviteleéletmagyaremberitörténőnapfényműködéséreformában

Forrás: pepitahirdeto.multiapro.com

Befektetések érdeklik? Most alakuló részvénytársaságba fektethet! Várható osztalék évente a befektetett tőke 35–40%-a. A legtöbb vállalkozó most ezt választja! Kérje a VSZ ajánlását és segítségét... Ajánlati szám: VSZ/00156/16/07


Feladva: 2017-12-01    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: VSZmostalakulóvállalkozóérdeklik00156legtöbbBefektetések8211ajánlásávalszámtőkeBefektetétesekAjánlatibefektetettsegítségétéventeajánlásátosztalék

Forrás: pepitahirdeto.multiapro.com

Aszfaltozás, útépítés A-Z-ig már 10 m2-től!!! Az ország egész területén a legolcsóbban! Kézi és gépi aszfaltozás egyaránt. Cégeknek, hivataloknak és magánszemélyeknek is! Tevékenységeink: - telephelyek, utak, terek, parkolók, gépkocsi bejárók, járdák, kerékpárutak építése - aszfaltozása - kátyúzása - térkövezése - betonozása Csarnokok, magtárak, minőségi kivitelezés olcsón, rövid határidővel, garanciával! Hívjon bizalommal, készséggel várunk minden érdeklődőt!


Feladva: 2017-01-25    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: aszfaltozásútépítésáronAkciósvárunkKézicsarnokokBetonútterekkészséggellegolcsóbbanbetonozásaAszfaltUtakbizalommalegésztérkövezéseJozeftelephelyek

Forrás: pepitahirdeto.multiapro.com

Kellemes környezetben, elérhető áron, apartmanként működő családi ház kiadó Gyulán. A szálláshely felszerelt konyhával(mikró, hűtők, tea-, kávéfőző, szendvicssütő, kenyérpirító, edények) rendelkezik. A szobákban TV. A kertben lehet grillezni, bográcsozni, szalonnát sütni, az ehhez szükséges eszközök biztosítva vannak. Az udvarban ingyenes, zárt parkolási lehetőség. A gyulai Várfürdő öt percre van a szálláshelytől.


Feladva: 2016-08-12    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: Gyulánkiadóparkolásiapartmankéntbográcsoznihűtőkzártárongrilleznimikróingyeneselérhetőlehetkonyhávaludvarbankörnyezetbenkertbenfelszereltvannak

Forrás: pepitahirdeto.multiapro.com

ELADÓ ORION 61CM SZTEREÓ SZÍNES TÁVIRÁNYÍTÓS TXT TV. KITŰNŐ ÁLLAPOTBAN. TF:+36/30/667-6007 VAGY +36/30/667-8487


Feladva: 2017-06-04    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: TÁVIRÁNYÍTÓS61CMORIONELADÓ667TXTSZÍNESSZTEREÓ8487JÓZSF6007VAGYSZÍNESTXTÁLLAPOTBANKITŰNŐ

Forrás: pepitahirdeto.multiapro.com

A kívánság lampion története: Ezeket a papírballonokat repülő lámpásnak, azaz Tiang Deng-nek nevezik, eredete a keleti világban több száz évre nyúlik vissza. Ázsiában a mai napig hagyományosan több ezer ilyen repülőlampiont, azaz kívánság lampiont engednek fel az emberek újév napján, vagy az ismert ”Fullmoon” ünnepeken. Annyi év elteltével még mindig él a szokás, hogy feleresztésekor a belesuttogott, ráírt kívánságok valóra vállnak. Megrendelhető - lásd Honlap alább!


Feladva: 2015-02-18    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: kívánságlampiontöbb8221azazhogykeletinapjánalábbszokáseredeteújévSzegedHonlaphagyományosanmindignevezikemberekLátványPontlásdnapigmégnek

Forrás: pepitahirdeto.multiapro.com

Szeged, Baktói, a városhoz közel fekvő részen található 1981 évben épült, 189 m2-es, 2 szintes, 2 generáció számára alkalmas, külön bejáratú, hőszigetelt sarokház tulajdonosoktól eladó. Földszint: 89 m2 (előtér, mosóhelyiség, WC, étkező, konyha, kamra, nappali, hálószoba, külön tusoló, fürdőszoba káddal). A 100 m2 alapterületű emeleti szint, a földszinti nappaliból nyíló teraszról közelíthető meg. Emelet: előtérként funkcionáló üvegezett erkély, nappali, 2 fél szoba, konyha, kamra, 2 ... további részletek >>

gardrób. A hőszigetelt padlástérben található egy 35 m2-es szoba. A tető 1 éve lett ellátva minőségi cseréppel. A kémény bélelt, zártrendszerű, a fűtés alapvetően központi gázkazánnal megoldott, valamint a földszint a radiátorok mellett kandallóval és elektromos padlófűtéssel és mind a két lakás hűtő-fűtő klímával is rendelkezik. A házhoz tartozik még egy 27 m2-es garázs, két műhely, egy fedett kocsi beálló, egy pince, egy kemence és egy fúrt kút is. Irányár: 39 900 000 Ft Érdeklődni a 06/30-270-77-52-es telefonszámon, vagy emailben: icag@freemail.hu


Feladva: 2017-09-05    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egySzegednappalieladókétszobatalálhatóméghőszigeteltalkalmasvároshozszámáraBaktóikülönkamragenerációföldszintkonyhafűtőfél189270megoldott

Forrás: pepitahirdeto.multiapro.com

Kedves Barátunk! Választási kampányunk sikeréhez nem kevés pénzre van szükség. Alapítványunk a Magyarország Gazdasági Felemelkedéséért Alapítvány (MGFA) köszönettel fogad minden támogatást a VSZ-FGRP és koalíciós partnereinek választási felkészüléséhez, kampányához a közös választási sikereink érdekében. A Vállalkozók Szövetsége (VSZ) és az FGRP, valamint a többi szövetségesünk azért indul együtt, hogy megmentse az országot. Jelszavunk: ”CSAK EGYÜTT SIKERÜLHET” Most ... további részletek >>

minden befizetés, támogatás ezt szolgálja. Kérjük, ha megteheted MOST támogasd. Sok múlik rajtad! Fontos tudni, hogy a befizetés elszámolható és az vállalkozásaid, adóalapját csökkenti. (Akár a december 20.-i adófeltöltési kötelezettség terhére is, tehát amit most ide befizetsz, annyival kevesebbet kell a NAV-nak utalnod) Minden segítséget köszönünk: Budapest Bank: MGFA számlaszám: 10101353-22504900-01004001 Külföldről: IBAN: HU06-10101353-22504900-01004001 Üdvözlettel: A kampánystáb


Feladva: 2017-12-07    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: VSZmostválasztásiMinden8221FGRPEGYÜTTMGFA0100400122504900befizetés10101353hogyterhéretöbbihazádértHU06tudnifelkészüléséheznakszükségtehetsz

Forrás: pepitahirdeto.multiapro.com

Egyedi női felkar ékszer a Lili Ékszer webáruházban. www.liliekszer.viltor.hu/termeklap /karkotok/fem-karkotok/felkar-eksze r-level


Feladva: 2018-01-19    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÉkszerLilifelkarwebáruházbannőiEgyediWEBÁRUHÁZ

Forrás: pepitahirdeto.multiapro.com

A Balaton-felvidéken, Badacsonyhoz 5 km távolságra káptalantótii szálláshelyek fényképes gyüjtőoldala. Kiadó panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Sok fényképpel a szálláshelyekről és a faluról. - Weblap: www.zimmerinfo.hu/kaptalantoti/hu. htm


Feladva: 2017-05-10    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: zimmerinfoszálláshelyekközvetítésipanziókszálláshelynélKiadówwwlehetőséggyüjtőoldalahttpfoglalásifényképesWeblapközvetlenfalurólelérhetőségükkelSok

Forrás: pepitahirdeto.multiapro.com

Minden típusú automata váltó javítása, felújítása korrekt árakon, garanciával, kifogástalan minőségben! Vállaljuk automata sebességváltók tuningját, verseny célú átépítését, megerősítését is. Csak minőségi, megbízható anyagok felhasználásával dolgozunk! Több éve jelen vagyunk a versenysportban, jelentős tapasztalatokat gyűjtöttünk. Várjuk céges megrendelők megkeresését is! Rendszeres megrendelés esetén jelentős kedvezményeket biztosítunk a munkadíjból. További információ: Facebook: Mopar Garage


Feladva: 2016-10-21    [Autó - Motor - Jármű]

Címkék, kulcsszavak: automatajelentősváltóTovábbiVállaljukVárjukEgermegbízhatómunkadíjbólminőségbengyűjtöttünkCsabaminőségibiztosítunkkifogástalantapasztalatokatHorváth

Forrás: pepitahirdeto.multiapro.com

Motoros mintás hátizsákok többféle mintával a retro pannónia logóstól a humoros feliratosig. Motoros férfiaknak és motoros nőknek egyaránt kiváló ajándék lehet minden alkalomra. Két rekeszes (egy nagy és egy zseb elől), könnyű poliészter hátizsák, fülhallgató kivezetéssel, állítható vállpánttal. Ha egyéni mintát szeretnél nyomatni, írj! Hossz / cm 40.00 Szélesség / cm 28.00 www.rockpont.polomania.hu/termekek /reszletek/151497_humoros_feliratu_ hatizsak_a_sor_kapcsan-online_rende les


Feladva: 2018-01-04    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: motorosegyhátizsáknőknekmintátmintásegyéniRockPontnagyférfiaknakvállpánttalrekeszesfeliratosigállíthatóKéthumoroskivezetésselalkalomralogóstól

Forrás: pepitahirdeto.multiapro.com

A GÁL-60® típusú kopasztógéppel óránként hatvan csirkét lehet megtisztítani. A gép egyéb baromfiakhoz (liba, kacsa, gyöngytyúk, fácán stb.) is használható. Kétféle méretben készül. Pulykák pucolásához célszerű a pulykapucoló változatot megrendelni. Egy perc alatt egyszerre egy csirkét lehet megpucolni, melyet közben fogni kell. A tokokat és az erős tollakat is kiszedi, ezért kézi utópucolásra nincs szükség. A géphez számos kiegészítő berendezés tartozik (pl.: kábító, vágó, forrázó, ... további részletek >>

bontó, csöpögtető, stb.), melyek alkalmazásával biztosítható az optimális kiszolgálás, csökkenthető a pucolási idő, növelhető a feldolgozott darabszám. (Kérjen árajánlatot a kiegészítőkről!) www.csibekopaszto.hu/magyar/index.html


Feladva: 2017-07-24    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 174stbGÁLlehetgépcsirkétegyhatvanwwwtollakategyszerreoptimálisKétféleberendezésóránkéntkiegészítőkrőlerősalattbiztosíthatóhasználhatótokokat

Forrás: pepitahirdeto.multiapro.com

Keresünk németországi intenzíves ápolásra szoruló betegekhez ápolókat, gyermekápolókat, diplomás nővéreket, két heti váltásban, jó kereseti lehetőséggel. Jelentkezni német nyelvű fényképes önéletrajzzal lehet e-mailben. Elvárások: -honosított (Anerkennung) vagy honosítható bizonyítvány -középszintű német nyelvtudás(B2-es nyelvvizsga) -munkatapasztalat Bővebb információ telefonon: H-P, 9-16 óráig!


Feladva: 2017-10-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németnémetországiElvárásokkétmunkatapasztalatMohácsmailbennővéreketnyelvvizsgaKftlehetdiplomásnyelvtudás2011önéletrajzzalgyermekápolókatKezeknyelvű

Forrás: pepitahirdeto.multiapro.com

Minőségi kínai telefonok és kiegészítők elérhető áron! Ingyenes szállítás 1 év garanciával, megbízható országos szervizekkel. Vásárlás csak előreutalással lehetséges. Vállalkozások részére külön kedvezmények. 0-24 elérhetőség online, telefonos ügyfélszolgálat 16.30-20.00-ig, hétvégén is.


Feladva: 2017-07-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: garanciávalkínaiMinőségionlineországosajánlóelérhetőségmegbízhatóHirdetőkedvezményekPepitakülönszállításnyelvenrészéreIngyenesmagyarVállalkozások

Forrás: pepitahirdeto.multiapro.com

Tulajdonságok: - LED televízió, 40 cm (15,6”) képátlóval - USB bemenet - HD DVB-T/C közvetítés USB feljátszása - Időeltolódás funkció (Timeshift) - Multimédiás fájlok lejátszása pendrájvról - Támogatott formátumok: DivX, XviD, MP3, WMA, JPEG - Dinamikus kontraszt: 8.000:1 - Fényerő: 300 cd/m2 - Visszahatási ütemidő: 5 ms - HD READY (1366 x 768) - Beépített HD DVB-T/C (MPEG4, MPEG2) tuner - PAL, SECAM BG/DK/I/NICAM, AV bemenet i NTSC 4,43 - Képfelbontás: WXGA 1366 x 768 Px - ... további részletek >>

Látószög: 150°/150° - Elektronikus műsorkalauz (EPG) - Teletext - Több nyelvű menü - Digitális fésűs szűrő (DCF) - ZOOM - Ekvalizer - Kikapcsolás-időzítő - Automatikus kikapcsolás - Gyermekóvintézkedés - Hotel üzemmód - Kimeneti teljesítmény: 2x 3 W - VESA méretben (100 x 100 mm) - Csatlakoztatható: HDMI, SCART, AV bemenet, VGA, PC Audio bemenet, USB, CI slot - Fogyasztása készültségi üzemmódban: 20 W / 0,5 W - A készülék méretei (sz x ma x mé): 376 x 240 x 38 mm - Méretek állvánnyal (sz x ma x mé): 376 x 274 x 120 mm - Tömege (készülék/csomagolás): 1,3/2,5 kg Ugrás a televízióhoz: www.aqua.hu/sencor-sle-1660m4-156-hd-ready-led-tv-303503.html


Feladva: 2017-07-15    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: bemenetUSBledready1660m4768sleDVB3761366sencorkikapcsolás100készülék150LátószögTimeshiftKimenetiMPEG4Pepita274fésűsWMAfunkcióüzemmód

Forrás: pepitahirdeto.multiapro.com

Mindig akad, aki mindent maga csinál, mert mindenki másnál jobb, ügyesebb... Jó sokan vannak, de valahogy mégis láthatatlanok maradnak, mert azért mégsem úgy vannak az internetes megjelenés alapvetései, ahogy ők gondolják. A Pepita Hirdető kínál olyan megoldásokat, amivel láthatóvá lehet válni a weben, csak kérni és használni kell... Szolgáltatásaink ebben: www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60547


Feladva: 2016-04-23    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: látszanivannakHirdetőmertPepitalehetMindigmegjelenéssokanláthatóváinternetesügyesebbamivelnemjobbmegoldásokatvagyúgymásnálolyaninterneten

Forrás: pepitahirdeto.multiapro.com

5 személyes KLÍMÁS lakókocsi bérelhető. Az elő-sátorban igényesen felszerelt konyha. A nagy árnyékot nyújtó nyitott terasz alatt kellemes az étkezés, pihenés egy jó beszélgetésre, ahol az estéket hangulatosan lehet eltölteni. A bérleti díj tartalmazza: a villany, víz használatát (tisztálkodásra a vizesblokkban van mód), 1 személygépkocsi parkolását a lakókocsi mellett, a kb. 150 m-re lévő strandra a belépést. Ágynemű van, huzat, lepedő, konyharuha hozandó. Házi állat nem hozható!


Feladva: 2015-10-31    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: vanlakókocsiestéketÁgyneműárnyékottisztálkodásraszemélyesaholbelépéstnagyhasználatátAlsóörshozhatóbeszélgetésrestrandrarészvízSándornemegydíj

Forrás: pepitahirdeto.multiapro.com

A már jól ismert, bevált, és előnyös tulajdonságaival bizonyított OSB lapok mellett 2006-ban megkezdtük a hasonló felhasználási területű, de költséghatékonyabb – olcsóbb – megoldást nyújtó MFP lapok forgalmazását is. Mindkét termékcsoport különböző vastagságban (az MFP nútféderes változatban is) megvásárolható telepi készletünkből. Az MFP lap is rendelkezik magyar ÉMI típusvizsgálati bizonyítvánnyal, hosszanti és keresztirányú szilárdsági értékei könnyedén teljesítik az OSB/3 ... további részletek >>

EN300-as követelményeit. MFP lapok - Árvai Fatelep MályiAz MFP lapok főbb jellemzői: - jól terhelhető - stabilitást nyújt - ellenáll a nedvességnek - megmunkálás és külső megjelenés szempontjából a masszív fához hasonló Az MFP lapok felhasználási területei: - padlókészítés - falborítás - tetőfedés - építési kerítések - csomagolások - fakeret szerkezet borításra a DTU 31.2 szerint engedélyezve - zsaluzatok - faházépítés Kérjen személyre szabott árajánlatot! http://arvaifa.hu/termekek/mfp-es-osb-lapok/


Feladva: 2016-10-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: mfplapokosbfelhasználásiarvaifahasonlójól8211engedélyezvekövetelményeit2006padlókészítésmagyarellenállMindkétszerintEN300mellettterületeinyújt

Forrás: pepitahirdeto.multiapro.com

Magas nedvszívó hatással rendelkező 130 gr-os felmosófej, zöld-fehér színben. Összetételének köszönhetően kevesebb vegyszert igényel, mégis könnyedén megbirkózik a szennyeződésekkel. Takarékos egyben hatásos is. www.szympyhygi.hu/micromix-zold-fe her-felmosofej-130g-t446987


Feladva: 2017-04-16    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: feherzoldmicromixfelmosófej130ghatássalmégisnedvszívóigényelMagasvegyszertajánlószympyhygikevesebbHirdetőwwwköszönhetőenPepitahatásosegyben

Forrás: pepitahirdeto.multiapro.com

Olcsó bérautónk sokkal tisztább és biztonságosabb, mint a tömegközlekedés MÁV, Volán, BKK, BKV igénybevétele. Autókölcsönzõnk májusi akciójában Renault Clio bérautónkat napi csak 3.000,- Forintért adjuk az átvételtõl számítva 24 órára. Bérautónk www.pluszautorent.hu autókölcsönzés oldalon. Automataváltós olcsó bérautók. Autókölcsönzõnket megbízhatóság, pontosság, jellemzi. Opel Ford Suzuki, Renault, Skoda, Chevrolet bérautók jó áron. Tel: +3630 9488730 www.plusautorent.hu Car hire ... további részletek >>

in Budapest. Válasszon a tiszta, jó, szervizelt, karbantartott olcsó bérautókból. Hosszú autóbérlés esetén akár 30% kedvezmény is igénybe vehetõ. Rövidebb bérlésnél is lehet 10%, és 20% akciós árat igénybe venni. Autóbérlés Budapesten, Pest megyében és a Ferihegyi Liszt Ferenc Nemzetközi repülõtérre kiszállítással. Válasszon bérautóink közül amelyek, 3, 4, 5, 6, 7 személyes, klímás, automata vagy kézi váltós, személyautó vagy kis tehergépkocsi, Kicsi economy, nagy luxus bérautók kölcsönzése. Bérelhetõ autótípusok Opel Corsa C 1.2, a hölgyek kedvenc bérautója. Kicsi helyre is könnyû parkolni vele. Suzuki Ignis 1.3, erõs fürge, pörgõs bérautó. Opel Vectra B 1.6 automata váltós, nagy 4 ajtós kölcsönautó. Ford Focus C-MAX 1.6 HDI Dízel fokozatmentes automataváltós CVT, egyterû. Nagyon alacsony a fogyasztása. Autókölcsönzõ Magyarországon kiszállítással. Suzuki Swift 1.3, a MI autónk a magyarok kedvence. A legolcsóbb bérautó klíma nélkül. Renault Clio 1.4, erõs 74 kw-os motorral.Renault Scenic1.6 Automataváltós egyterû bérautó. Kombi van. Opel Vectra C 2.2 nagy 114 kw szedan, erõ és biztonság jellemzi. Gépjármûkölcsönzés 1992-tõl. Chevrolet Aveo 1.2 kicsi gazdaságos, ezüst bérautó. 5 személyes. Skoda Fabia 1.2 Benzin Gáz LPG üzemû, hatchback 5 ajtós. Személyautó bérbeadás. Opel Vivaro 1.9 dízel 6 személyes kisteherautó. Az ülések gyorsan, könnyedén kiszedhetõek, így a rakodó tér kétszeresére növelhetõ. B személygépkocsi jogosítvánnyal vezethetõ. Renault Espace 2.2 dízel automata váltós 7 személyes bérautó. Klíma, cd tár, navigáció stb. A felsorolás nem teljes kérem, nézze meg a www.plusautorent.hu autókölcsönzõ weboldalunkat is.


Feladva: 2017-12-09    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 245251RenaultOpelbérautóautókölcsönzszemélyesolcsóSuzukiAutomataváltóskiszállítássalwwwAutóbérlésbérautókváltósnagyautomatakicsidízelChevrolet

Forrás: pepitahirdeto.multiapro.com

Megbízható, kipróbált, havidíj mentes rádiós riasztórendszerek telefonos és GSM értesítéssel, vezeték nélküli érzékelők, hangjelzők közvetlenül a forgalmazótól. Szerelésre előkészített komplett riasztórendszerek, melyeket csak fel kell szerelnie. Keressen minket!


Feladva: 2015-01-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: riasztórendszereknélkülivezetékRiasztodepoGSMRiasztódepóTelwebáruházaelőkészítettrádióswwwSzerelésrementesminketforgalmazótólhavidíjKeressenkell

Forrás: pepitahirdeto.multiapro.com

2000 mm-es csúcstáv, 750 mm-es elfordulású eszterga eladó, vagy targonca csere érdekelne értékegyeztetéssel!


Feladva: 2013-08-04    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 750mmcsúcstáv2000mmértékegyeztetésselérdekelnecseretargoncavagyeladóesztergaelfordulású

Forrás: pepitahirdeto.multiapro.com

Motormentés, motorszállítás. Budapest területén átalánydíj 6000.- Budapesten kívül 6000.- + Budapest határától, Budapest határáig 100.-/km.


Feladva: 2017-08-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BudapestMotormentés6000határátólkívülBudapestenátalánydíjterületénmotorszállítás100határáig

Forrás: pepitahirdeto.multiapro.com

Egyedi tervezésű, fából, kézzel készült, pirográffal (fába égetési módszerrel) gravírozott, tollak, tolltartók, ékszerek, táblák, fali órák, és egyéb kis fa csodák... A termékeket a saját elképzelésed szerinti szöveggel, grafikával és névre szólóan is elkészítjük számodra. Sokféle alkalomra ötletes, és igazán személyhez szóló ajándék.


Feladva: 2017-09-21    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ajándékelkészítjükKedvesegyébpirográffalszólóanórákkészültnévrefalikézzelgrafikávaltáblákszólófábólszöveggelékszerekszemélyheztervezésűszerinti

Forrás: pepitahirdeto.multiapro.com

Alsóörsi kiadó szálláshelyek fényképes gyűjtőoldala. Panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Több mint 100 fényképpel a szálláshelyekről és a településről! - SZÉP kártyát elfogadó szálláshelyek Alsóörsön - Egész évben nyitvatartó (kidó) szálláshelyek - Weboldal: www.zimmerinfo.hu/alsoors/hu.htm


Feladva: 2017-11-08    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfonélkülvillákAlsóörsöndíjhtmvendégházakelfogadóközvetítésialsoorsPanziókkártyátszálláshelynélgyűjtőoldalaSZÉPlehetőséghttp

Forrás: pepitahirdeto.multiapro.com

Hajsütővas, gőzállomás, waffelsütő, gofrisütő, melegszendvicssütő, porszívó, páraelszívó, fagyasztó, hűtő, szárítógép, mosógép, hősugárzó, olajradiátor, olajsütő, kenyérpirító. A tökéletes nászajándékok, karácsonyi ajándékok széles választéka! Személyes átvétel Budapesten. Link: www.stacioshop.hu Facebook: www.facebook.com/stacioshop Tel: 36704551969 E-mail: in fo@stacioshop.hu


Feladva: 2017-05-16    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: stacioshopfacebookwwwátvételhősugárzóinfo@stacioshopHajsütővasSzemélyesmosógépmailajánlóválasztékaszárítógép36704551969HirdetőszéleshűtőTelPepita

Forrás: pepitahirdeto.multiapro.com

Megoszlanak a vélemények azzal kapcsolatban, hogy a természetes hormonmentes fogamzásgátlás mennyire biztonságos. Tény, hogy napjainkban nem létezik olyan módszer, tabletta vagy eszköz, amivel 100%-os biztonsággal védekezhetnénk a terhesség ellen. A fogamzásgátlás otthon házilag történhet a testhőmérséklet, a hüvelyváladék figyelésével, naptár módszerrel vagy akár megszakítással is, amit azonban az orvosok egyáltalán nem javasolnak teherbeesés ellen. A hormonmentes fogamzásgátlás eszközei a ... további részletek >>

pesszárium, a spirál és különböző spermicid készítmények, melyek krém, kúp és hüvelytabletta formájában is kaphatók.


Feladva: 2017-01-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogamzásgátláshormonmenteshogyvagyellennemazonbanMegoszlanakházilagpesszáriumlétezikamitKittikaphatókotthoneszközeinapjainkbanmegszakítássalakár

Forrás: pepitahirdeto.multiapro.com

Hajcica Agency oldalán minden egy helyen! Nézzen be hozzánk, fantasztikus kínálat hostess, táncos hölgyekből, chippendale fiúkból, show műsorokból. Megszervezzük esküvőjét, szülinapi meglepetés buliját, vagy bármilyen céges rendezvényét teljes szervizeléssel! Rendeljen tőlünk! Kedvezményeink egyediek, az Ön igényeinek megfelelően. Rugalmasak vagyunk, hiszen a legfontosabb dolog: A MEGRENDELŐ-nek megfelelni, hogy visszajöjjön!


Feladva: 2014-12-24    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hajcicaagencymegfelelnihostesskedvezményeinkProdukciósmeglepetésnekkínálatfolyamatosanszervezéseszülinapiMEGRENDELŐfantasztikustőlünkrendezvényekcom

Forrás: pepitahirdeto.multiapro.com

Az Aloe Vera és tizenkét értékes növényi kivonat hatékony kombinációja. Védőrétegként vonja be az igénybe vett bőrt. Nyugtat és hűsít.


Feladva: 2017-03-18    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: VeraAloehűsítértékesNyugtattizenkétbőrtvettigénybePécsvonjaÉvaVédőrétegként500kombinációjaSprayhatékonykivonatnövényi

Forrás: pepitahirdeto.multiapro.com

Már 24 féle hangulat-színváltós nyaklánc közül választhat a legjobb áron a Lili Bizsu Webáruházban: www.lilibizsu.hu/lista/58835b20cxx 3c-HANGULAT-SZINVALTOS Házhoz szállítás már 650 Ft-tól, akár ingyenesen is


Feladva: 2017-10-22    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: színváltóshangulatBizsuLilimárszállításnyakláncHázhozlilibizsuwwwféleWebáruházbanWEBÁRUHÁZnyakláncokingyenesenakárárontóllegjobb650Ftközül

Forrás: pepitahirdeto.multiapro.com

Professzionális segítségre és gyógyításra számíthat az UNIQA legújabb betegségbiztosításával, ha egy súlyos, „rettegett” betegség ütné fel Önnél a fejét. A Best Doctors közreműködésével felkutatjuk Önnek az adott betegség legjobb specialistáit a világon, teljes körűen megszervezzük és térítjük a külföldi gyógykezelését 2 millió euró összeghatárig. Tájékozódjon honlapomon a Med TopDoc betegségbiztosításról, vagy kérjen tájékoztatót!


Feladva: 2015-01-18    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: MedbetegségTopDocBestlegújabbteljesbetegségbiztosítássalfejéthonlapomonUNIQAvilágonÖnnélTájékozódjonszámíthatspecialistáitfelösszeghatáriglegjobb

Forrás: pepitahirdeto.multiapro.com

Kiadó próbatermek Csepelen! Érdeklődni: telefonon!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: próbatermekKiadóÉrdeklődniCsepelenBudapestTulajpróbateremtelefonon

Forrás: pepitahirdeto.multiapro.com

Budapest első fogyatékossággal élő emberek által alapított kávézója. A kávézóban dolgozó csapat nagyon színes és nagy szeretettel vár minden látogatót. Egy pár szó rólunk: www.nemadomfelkavezo.hu/rolunk.php


Feladva: 2016-10-06    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: nagyfogyatékossággalszíneselsőnagyonBudapestcsapatStevedolgozókávézókávézóbanfelkávézójaadomlátogatótalapítottNemmindenáltalváremberekélő

Forrás: pepitahirdeto.multiapro.com

A zöldárpa hatása annak köszönhető, hogy a legfontosabb tápanyagokat ideális arányban tartalmazza. Összetevői szinte azonnal felszívódnak a szervezetben, azaz rögtön hasznosulni tudnak. Az árpafű a Föld talán legegészségesebb növénye, amit nagyon ajánlott fogyasztani azoknak is, akik plusz kilóktól szeretnének megszabadulni. Mivel benne minden létfontosságú tápanyag megtalálható, a diétázók úgy táplálhatják szervezetüket, hogy közben egyetlen felesleges kalóriát sem visznek be! Nagyszerű ... további részletek >>

gyulladáscsökkentő és vérképzéshez is kitűnő. Mire jó a zöldárpa por? Még többet megtudhat róla weboldalunkon! www.zoldarpa.buzafule.net/zoldarpa


Feladva: 2017-12-07    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: zöldárpahatásahogyÖsszetevőiköszönhetőmindenpornagyonszervezetbenegyetlenannakbenneamitfelszívódnakközbenMivelMirenövényeazonnalKittikitűnő

Forrás: pepitahirdeto.multiapro.com

Balatonboglár és vonzáskörzetében lévő ~ 180 kiadó szálláshely fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Több mint 2000 fényképpel a szálláshelyekről és a településekről! - Úszómedencével rendelkező szállások. - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó balatoni szállások. - Egész évben nyitva ... további részletek >>

tartó szálláshelyek Balatonbogláron. - Weblap: www.zimmerinfo.hu/boglar/hu.htm


Feladva: 2017-05-10    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szállásokzimmerinfokiadóBalatonboglárbalatonigyűjtőoldala2000KözvetlenelfogadófényképesmintwwwtérképpelPihenőkártyaszálláshelyTöbbhttpSzéchenyi

Forrás: pepitahirdeto.multiapro.com

Dolgozzon Amerikában! Házvezetőnői, szállodai munkák (szobák takarítására, párok jelentkezését is várjuk). Nyári tábori munkák. Jelentkezés e -mailben, vagy telefonon itt: www.amerikabandolgozni.hu Telefon:70 401 0882 Víberen is


Feladva: 2017-02-03    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: AmerikábandolgoznimunkákVíberen0882táboriBudapest401NyáriTelefonvárjukamerikabandolgoznijelentkezéséthttppárokitttakarításáratelefononszobák

Forrás: pepitahirdeto.multiapro.com

,,Magosan az aszalt gyümölcsökkel” Nézz be hozzánk, a weboldalunkra és kedvedre válogathatsz a sok csemege közül. Minden héten új termékekkel újítjuk meg kínálatunkat!


Feladva: 2016-10-10    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: aszaltkedvedreolajoskínálatunkatweboldalunkragyümölcsökmeghozzánkújítjukNézztermékekkel8221hétengyümölcsökkelMindenközülMagosancsemegeZsámbok

Forrás: pepitahirdeto.multiapro.com

Már több éve tagja vagyok egy MLM vállalatnak, de csak lassan tudtam haladni az online munkával. Nem igazán ment. Nem a vállalattal volt a hiba, hiszen láttam, hogy sokan milyen szépen gyarapodnak, haladnak. A DXN tökéletes választás volt. Már közel álltam, hogy kimondjam: ez nem nekem való, nekem nem megy. Kb. másfél hónapja szponzorom megmutatott egy új eszközt, ami segíthet nekem is. Gondoltam, mit veszíthetek, kipróbáltam. Eleinte szkeptikus voltam, de jöttek az eredmények. Egy hónap alatt, ... további részletek >>

többen csatlakoztak hozzánk, mint előtte lévő évben összesen. Felcsillant a remény, hogy ezzel én is tudok eredményesen dolgozni! Nagyon megszerettem ezt az automata eszközt! Így már én is meg tudom csinálni. Csatlakozz a csapatunkhoz, hogy kipróbálhasd Te is ingyenesen magadat és az eszközt! Ha dolgozol, garantált a siker, és ez nagyon jó érzés.


Feladva: 2017-09-29    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmárnekemEgyeszköztvoltNagyonÍgyösszesenközelgarantáltingyeneseneredményekhiszenautomataamivállalatnakévbensikerkipróbálhasdjöttek

Forrás: pepitahirdeto.multiapro.com

Rendelj online, mi pedig szélsebesen szállítjuk neked! Ragyogj Te is Rossettiben! · Ingyenes átvétel Bp-en · Online fizetés · Házhoz szállítás · Pick Pack Pont átvétel Fülbevalók - Gyűrűk - Akciós termékek - Nyakláncok - Szettek


Feladva: 2017-10-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: 183OnlineátvételPontnekedSzépPackszállítjuktermékekPickszélsebesenNyakláncokpedigSzettekszállításRendeljHázhozajánlásfizetésHirdetőAkciós

Forrás: pepitahirdeto.multiapro.com

Csopaki kiadó szálláshelyek fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel,térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Több mint 500 fényképpel a szálláshelyekről és a településről! - SZÉP kártya (Széchenyi Pihenő kártya) elfogadó szálláshelyek - Egész évben nyitva tartó szálláshelyek. - Weblap: www.zimmerinfo.hu/csopak/hu.htm


Feladva: 2018-01-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekkiadókártyacsopakzimmerinfofoglalásinyitvatartógyűjtőoldala500KözvetlenévbenfényképesminttérképpelEgészTöbbelérhetőségükkelelfogadó

Forrás: pepitahirdeto.multiapro.com

🍀Figyelem! Figyelem!🍀 Nyitási akcióként szeretnénk megajándékozni minden kedves REGISZTRÁLT ÜGYFELÜNKET ”1” Ft-os áron választható termékekkel. Ajándék választásának feltétele: 30 000 Ft és 60 000 Ft feletti termékek megrendelése! Az ajándékok a kosárban a meghatározott összeghatár után tekinthetőek meg!🤔🤔🤔


Feladva: 2016-11-09    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 129300000PROFI127808Figyelem8221VargatermékekREGISZTRÁLTIstvánfelettikedvesSZERSZÁMPLACCmindenmegMINTfeltételemegajándékoznitekinthetőekMÁS

Forrás: pepitahirdeto.multiapro.com

Rajzos, ez a szép,kis-közepes nagyságú 1,5 év körüli kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: ... további részletek >>

06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagySÜRGŐSgazdinakRajzosvárjatelepenkutyagazdaörökbeGYEPMESTERIkellutánközepesüzenetetnemBekerülésükNAGYONaltathatókishagyjeredetiÓzd

Forrás: pepitahirdeto.multiapro.com

Németországba keresünk fizikai betanított munkára férfi, női dolgozókat. Német nyelvtudás szükséges, jó kereseti lehetőség. Fényképes önéletrajzát várjuk i jckft.hr@gmail.com címre.


Feladva: 2016-02-24    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: betanítottfizikaivárjukmunkáramunkaönéletrajzátNémetországiFényképeslehetőségkeresünkkeresetiNémetországbaszükségesZalaegerszegnyelvtudásKftcímre

Forrás: pepitahirdeto.multiapro.com

Válassz kutyádnak nyakörvet széles választékunkból, legyen szó akár kistestű, akár nagy testű kutyáról.


Feladva: 2016-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: akárszóKutyalegyenválasztékunkbólszélesnyakörvetkutyádnakkutyárólVálassztestűgubanagyebengyártásakistestűnyakörvek

Forrás: pepitahirdeto.multiapro.com

Ön hagyományos szakácskabátban szeret dolgozni? Vagy kedveli a modern divatos munkaruhát? Mi mind kettőben tudunk Önnek segíteni. Már közel száz féle kész fazonból választhat, rendelhet akár egyéni kívánság szerint is. 100% pamut, vagy kevert szálú alapanyagból, vékony vagy vastagabb kivitelben, tetszésének megfelelő színben a hozzá harmonizáló kivehető gombokkal is elkészítjük szakácskabátját. Kívánságra céglógót, nevet, beosztást tudunk a kabátba hímezni.


Feladva: 2016-10-11    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: vagytudunkkészhímeznimodernharmonizálókevertfélekabátbakedvelihozzápamutszázdolgozniszínben100közelbeosztástszeretmegfelelőszerintMárakár

Forrás: pepitahirdeto.multiapro.com

1991 óta működő faipari cég garanciával vállalja, egyedi igények szerinti konyha, szoba, gyerekszoba, fürdőszobabútorok, polcrendszerek, beépített szekrények, valamint irodabútorok, egyedi bútorok készítését, és különféle asztalos munkákat. Bemutatótermünkben rendelkezésre állnak anyagminták, melyekből kiválaszthatja az ön által elképzelt egyedi kialakítású bútorát, valamint a webáruházunkban forgalmazott bútorainkból néhány darabot.


Feladva: 2015-11-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: egyediKoránvalamintbútorát1991munkákatszobakialakításúkftasztaloskonyhaKereskedelmikülönféleszerintielképzeltBútorkészítőkészítésétigényekáltal

Forrás: pepitahirdeto.multiapro.com

XVI. kerületbe azonnali kezdéssel 4 órás takarítókat keresek. 06-70-272-3283. Perencsei Zoltán


Feladva: 2018-01-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: kezdésselazonnalikerületbeXVIZoltánIldikóPerencseiHegedűsné3283keresünk272Takarítóketkeresektakarítókatórás

Forrás: pepitahirdeto.multiapro.com

Régiséget szeretne eladni? Minket mindig megtalál: Budapest V. ker. Kálvin tér 1 - Korona Antikvitás AZONNALI KÉSZPÉNZFIZETÉS történik ÜZLETÜNKBEN ÉS HELYSZÍNEN IS!!! AKÁR 20%-KAL TÖBBET FIZETÜNK MINT MÁS KERESKEDŐ! KIEMELT MAGAS ÁRON VÁSÁROLUNK: RÉGISÉGET, ANTIK-HAGYATÉKOT, ANTIK-GYŰJTEMÉNYEKET, MINDENFÉLE ANTIK LAKBERENDEZÉSI DÍSZ- ÉS HASZNÁLATI TÁRGYAKAT! A KISZÁLLÁS MINDEN ESETBEN DÍJTALAN!


Feladva: 2017-07-11    [Régiség - Művészet]

Címkék, kulcsszavak: ANTIKRÉGISÉGETÁRONMAGASAZONNALIszeretneLAKBERENDEZÉSIMÁSAntikvitásajánlóMINTKoronaHirdetőMINDENFÉLEFIZETÜNKtérPepitaGYŰJTEMÉNYEKETTÖBBETKálvin

Forrás: pepitahirdeto.multiapro.com

Magas vérnyomás? Reflux? Magas vércukorszint? Daganat? Kemoterápiás kezelés? Pikkelysömör? Izületi betegségek? Gyógyszerek helyek használjon természetes Bio Ganoderma Gomba termékeket.Minden problémára megoldást biztosit. A kedvezményekért keressen meg!


Feladva: 2017-02-02    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BioMagasGanodermavércukorszintmegtermészeteskeressenhasználjonRefluxkedvezményekérthelyekvérnyomásbiztositGyógyszerekGyálmegoldástbetegségekCsilla

Forrás: pepitahirdeto.multiapro.com

A Magyar Vakok és Gyengénlátók Országos Szövetsége 90 éve áll a hazai látássérült emberek szolgálatában. Érdekvédelmi tevékenységeinkkel és sokszínű szolgáltatásainkkal próbálunk könnyebb és élhetőbb világot teremteni a vak emberek számára. Pontírásban, hanganyagban és elektronikus formában készült folyóirataink és könyveink egyedülállóan biztosítják számukra az információhoz jutást, kultúrát és a szórakozást. Tankönyvellátó csoportunk szerzi be és alakítja át látássérült tanulóink számára a ... további részletek >>

tananyagot. Segédeszközboltunkban az önálló életvitelt megkönnyítő termékekhez juthatnak hozzá a látássérült emberek. A Magyar Vakok és Gyengénlátók Országos Szövetsége szeretne köszönetet mondani mindazoknak, akik személyi jövedelemadójuk 1 %-ával támogatták szervezetünket, és bízunk jövőbeni támogatásukban is. „Az ember dolga, hogy embernek lenni érdem, Hogy bátor legyen az elrendeltetésben, Az elhullásban és a fölemelkedésben, És nem hihetünk másban, csak e küldetésben” (Juhász Ferenc)


Feladva: 2016-10-15    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: OrszágosGyengénlátókVakokMagyarembereklátássérültSzövetségeHogyszámáraszeretneformábanFerenclegyenmegkönnyítősokszínűbízunkszórakozástTámogassa

Forrás: pepitahirdeto.multiapro.com

A Lada Vesta stílusos, merész és ragyogó – pont, mint amilyennek egy új generációs Ladának lennie kell. A szedán sziluettje korszerű és harmonikus, az X forma egységként kíséri végig a karosszériát. Az új, bátor stílus könnyen felismerhető a részleteiben: a fekete színnel kiemelt radiátor borításban, a lenyomatokban az oldalakon, a hátsó fényszórók fényvisszaverőin. A megemelt öv vonalának, meghosszabbított motorháztetőnek illetve lejtős tetőnek köszönhetően a Vesta külsőre is sportos és ... további részletek >>

dinamikus. Egy ilyen autóval nehéz észrevétlennek maradni az utakon. Vesta. A LADA új arca. www.ladaszolnok.hu/vesta_sedan_ismerteto


Feladva: 2017-04-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: vestaLADAEgymeghosszabbítottmintsedanszínnelilyenformavonalánakpontfeketeharmonikusmegemelt8211ladaszolnokrészleteibendinamikuskorszerűragyogó

Forrás: pepitahirdeto.multiapro.com

Akrobatikus tűzzsonglőr és tűztánc show, színpadi pirotechnika, tűzijáték, UV & LED show, gólyalábasok, rendezvényszervezés. Acrobatic firejuggler and firedance show, stage pyrotechnics, fireworks, UV & LED show, stilts, event organizing.


Feladva: 2016-05-08    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: showtűzzsonglőrLEDfiredanceAkrobatikusandBudapestfirejugglerBeátaorganizingAcrobaticILLÉSeventrendezvényszervezéscsapatstiltsgólyalábasokprodukció

Forrás: pepitahirdeto.multiapro.com

Hölgytársaim! Tudjuk, hogy a férfiak a teremtés koronái. Jól is van ez így! De azért szerencsére ma már mi nők is meg tudjuk valósítani a céljainkat, anyagilag függetlenné tudunk válni megfelelő profi eszközökkel. Hogyan tudod megvalósítani Te is a céljaidat akár több gyermek mellett is? Itt a megoldás: www.nyolcpontnyolc.hu/310012767/da ta


Feladva: 2017-08-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: tudjukmegfelelőszerencséremellettanyukáknakválniazértgyermekGyermekestudunkígytöbbfüggetlennévanakáranyagilagJólcéljaidatcéljainkatdatatudod

Forrás: pepitahirdeto.multiapro.com

..udvarból a Balatonba léphet... BALATONFENYVESEN közvetlen a Balaton-partján, családias, gyermekbarát környezetben üdülhet, helyben strandolhat, horgászhat. Ingyenes csónak, vízibicikli használat, kényelmes szállás, elegáns környezet. www.balaton-fenyves.hu 305918036 83-318-839


Feladva: 2014-07-16    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: léphetBalatonbabalatonudvarbólBALATONFENYVESfenyveshorgászhatstrandolhatwwwhelybenkörnyezetüdülhetÜDÜLŐPARADICSOMelegánskörnyezetbenszálláskényelmes

Forrás: pepitahirdeto.multiapro.com

Főbb kínálatunk: OMNITRONIC / PSSO dj – stúdió – hangtechnika ::: EUROLTE / FUTURELIGHT látvány – fénytechnika ::: DIMAVERY hangszerek ::: ALUTRUSS traverz ::: OMNILUX fényforrások ::: ROADINGER rack gyártás ::: EUROPALMS műnövények – dekoráció. Nálunk közel 10.000 termék közül válogathat. A megfelelő termékek kiválasztását fotók, videók, részletes termék leírások és pontos méretek segítik. Tekintse meg kínálatunkat... www.showtechnic.hu


Feladva: 2016-12-04    [Zene - Hangszer]

Címkék, kulcsszavak: showtechnictermék2003HUNGARYrackOMNILUXpontosPSSO000traverzleírásokOMNITRONICközelALUTRUSSkínálatunkNálunkhangszerekrészletesFőbbdekorációker

Forrás: pepitahirdeto.multiapro.com

Minden gépjárműre, személyautóra, kisteherautóra, kamionra traktorra, buszra készítünk méret pontos üléshuzatot. Legalább 100 fajta anyag minta közül választhat. UV álló anyagok, gyári kárpit anyagok, utángyártott anyagok, elasztikus anyagok, szövetek, között válogathat. A különböző színű, mintájú, vagy minőségű anyagok összevariálásának csak az ön fantáziája szabhat határt. Vásárolhat nálunk trikó üléshuzatokat, valamint univerzális üléshuzatokat is. Várjuk szeretettel. Tekintse ... további részletek >>

meg weboldalunkat: huzatkiraly.hu Bán&Vincze BT Kecskemét, Jókai utca 41 Telefon: 0630/911-1277 - 0630/4853749


Feladva: 2016-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: anyagokVinczeBán0630üléshuzatokatKecskemétkárpitvalamintpontosminőségűüléshuzatgyáritrikóméretvagyMéretpontoshuzatkiralyállónálunkkészítünk

Forrás: pepitahirdeto.multiapro.com

Automata mosógépek, mosogatógépek, hűtőgépek, varrógépek, mikrosütők, porszívók és egyéb háztartási gépek helyszíni és szervizes javítása 1 év garanciával.


Feladva: 2015-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: FerencCsókajavításagépekháztartásiszervizeshpmosógépekhospitalszervizesAutomataelektrohelyszíniltpwwwMarcalváros840Győr350egyébTelporszívók

Forrás: pepitahirdeto.multiapro.com

1 órán belül ott vagyunk, nincs kiszállási díj! Hétvégén és ünnepnapon is hívhat bizalommal, nonstop! Kerti kút, szökőkút vagy akár medence bekötését is vállalunk. Megoldunk mindent: legyen az átfúrt vízcső, ázás, -csap, - mosdó vagy akár -kádcsere, vagy vizes blokk teljes generálja, hívjon bátran. Mindenre van megoldás!


Feladva: 2016-08-12    [Lakossági szolgáltatás]

Címkék, kulcsszavak: vagyakármosdószökőkútvagyunkMindenrecsapkútottbátranázásKertibelülhívjonvízcsőnonstopórángeneráljaátfúrtbizalommalBudapestteljeslegyen

Forrás: pepitahirdeto.multiapro.com

Nyíregyházán két utcával határolt 4650 m2 telephely, építési teleknek is, az ukrán, román, szlovák határokhoz vezető 41-es főút 6-os km-nél eladó. A városközpont 4 km, az M3-as autópálya 1 km, a határok 50-100 km távolságra vannak. Sok célra alkalmasan, lekövezve, bekerítve, közművesítve, tetszés szerint oszthatóan. 63 m széles. A telek előtt 23 ezer gépjármű megy el naponta.


Feladva: 2017-05-03    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 245251bekerítvenélgépjármutcávallekövezvevezetezerkétalkalmasanhatárokhozNyíregyházáncélraszlováktelekNyíregyházaSokrománszélesJános100

Forrás: pepitahirdeto.multiapro.com

Alumínium zsalugáterek készítését vállaljuk — A FEMARKZSALU Kft új szolgáltatása: ajtó- és ablakzsaluk készítése alumíniumból. A számos variáció közül ajánljuk a védő zsalugátereket (biztonsági és nem biztonsági) típusban. Kérje ajánlatunkat méret szerint! www.femarkzsalu.hupont.hu/9/alumin ium-zsaluk-keszitese


Feladva: 2017-04-04    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: biztonságiKftFEMARKZSALU8212közülvállaljukszerintvariációkészítésétméretszámoszsalugáterekajánlatunkatalumíniumbólAlumíniumKérjekészítésetípusban

Forrás: pepitahirdeto.multiapro.com

Budapesten a XIV kerületi modern irodánkba keresünk lelkes, jól kommunikáló, telefonálni szerető operátorokat. A munka 6 órában végezhető, rugalmas beosztás mellett. Kezdők, tapasztaltak, diákok és gyermekes anyukák jelentkezését is várjuk! Fizetés: bejelentett jövedelem (fix alapbér -és mozgó bér a megkötött szerződések után) Leendő munkatársunk feladatai: - kimenő hívások indítása kizárólag vidéki területek irányába - script alapján beszélgetés irányítása - hívások adminisztrációja ... további részletek >>

Amit kínálunk: - nyugodt, modern munkakörnyezet - profi betanítás (kommunikációs- és értékesítés-technikai és szakmai ismeretek) - stabil háttér, hosszú távú munkalehetőség - összetartó közösség Elvárásaink: - kiváló kommunikációs készség, - felhasználó szintű számítógépes (Microsoft Office) ismeretek, - értékesítésben vagy call centerben szerzett tapasztalat előnyt jelent - lelkes, céltudatos hozzáállás - pozitív gondolkodású személyiség Amennyiben a fenti elvárásoknak megfelel és szeretne kellemes irodai munkakörnyezetben dolgozni, akkor várjuk a fényképes önéletrajzát a varadi.szabolcs@alphaphone.hu e-mail címre.


Feladva: 2017-10-31    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: lelkesmodernhívásokrugalmasvárjukkommunikációsXIVismeretekirodaiösszetartószerződésekSzabolcscéltudatosmunkakörnyezetgyermekescímreOfficeirányába

Forrás: pepitahirdeto.multiapro.com

Fedezd fel a profi V-Cube versenykockák izgalmas világát! Az egyedülálló technológiának köszönhetően nagyon könnyedén és precízen forognak, ami élvezetes játékot és gyorsabb kirakást eredményez. A V-Cube kockák kiváló anyagminőséggel rendelkeznek, karbantartást nem igényelnek, rengeteg versenyző használja őket. A lekerekített forma jobban illeszkedik a kézbe, dönts rekordot vele! Részletes leírás: www.gemklub.hu/v-cube-6x6-versenyk ocka-feher-lekerekitett.html


Feladva: 2017-11-24    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: cubelekerekitettversenykocka6x6veleizgalmasigényelnekhtmlélvezetesrekordotversenykockáknemamidöntsprofikarbantartástfeherforognakkézbefelőket

Forrás: pepitahirdeto.multiapro.com

AcPumPa azonnali országos kiszállítással, Budapesten 1-2 órán belül, vidéken 24 órán belül átvehető. AC pumpa tankon belül, AC pumpa tankon kívül, elektromos üzemanyag szivattyú 5200 autóhoz, és munkagéphez, raktárról non-stop működő webshopunkból. Telefonos érdeklődés napközben 8-18 óra között. „Velünk biztosan újra indul”


Feladva: 2015-05-04    [Autó - Motor - Jármű]

Címkék, kulcsszavak: acpumpabelülAzonnaltankonóránüzemanyagszívattyúbiztosanOrszágosacpumpawebshopelektromosVelünkwwwkívül8222kerwebshopunkbólközöttXVIIImüködő18h

Forrás: pepitahirdeto.multiapro.com

Szeretne könnyedén bevételre szert tenni Facebook oldala, vagy weboldala segítségével? ITT A MEGOLDÁS!!! Legyen üzleti partnerünk! Ne hagyja ki! www.multiapro.com/online-penzkeres et.php?ref=PA211


Feladva: 2016-09-30    [Pénzkeresés - MLM]

Címkék, kulcsszavak: partnerünküzletiLegyenkönnyedénFacebookpénztnagyjatenniKeressenszertbevételrePA211refMEGOLDÁSSzeretnephpITTOrszágosanpenzkeresetsegítségével

Forrás: pepitahirdeto.multiapro.com

Pályázatírás másképpen Biztosan sok helyen olvashatja, hogy ingyenes pályázatírás, ingyenes tanácsadás stb. …. de elege van, hogy a végén MINDIG MINDENT ÖNNEK KELL KITALÁLNIA???? Ráadásul a számla kiállítása után a lehető leghamarabb el is feledkeznek Önről? Ha szeretné, hogy…. - 15 perc „ingyenes tanácsadás” helyett tényleg EGYÜTT GONDOLKOZZANAK ÖNNEL - egyetlen gépbeszerzés helyett KOMPLETTEN, egyben vizsgálnák cégének valódi szükségeit - valóban ... további részletek >>

TEHERMENTESÍTSÉK az összes pályázatírással kapcsolatos papírmunkától - VÉGIGKÍSÉRJÉK az egész pályázati folyamatot az előlegtől a záró-ellenőrzésig - KAPCSOLATI TŐKÉT is kapjon pályázatához, ne csak egy számlát a pályázat megnyerésekor Akkor kérjen időpontot a +36 30 928 3621 telefonszámon (vagy montaltechkft@gmail.com e-mail-en) Zakor Beátától és várjuk Önt budaörsi irodánkban.


Feladva: 2016-09-29    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ingyeneshogytanácsadáshelyettpályázatírás8230zárószeretnéZakorvalóbanÖNNEKmegnyerésekorGONDOLKOZZANAKBiztosanelőlegtőlÖnrőlmailszükségeitMINDENT

Forrás: pepitahirdeto.multiapro.com

Ásvány ékszerek hihetetlen árakon nagyszerű kedvezményekkel akár 60% kedvezménnyel a Lili Bizsu webáruházban www.lilibizsu.hu Házhoz szállítás már 650 Ft-tól akár ingyenesen is


Feladva: 2017-10-29    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÁsványBizsuLiliakárnagyszerűmárárakonszállításhihetetlenHázhozékszereklilibizsuwwwWEBÁRUHÁZwebáruházbanolcsóniyeningyenesenékszertkedvezménnyel

Forrás: pepitahirdeto.multiapro.com

Megint egy újabb gardróbszekrényt hoztunk kínálatunkba. Mint ahogy megszoktuk két méretben (239 cm és 160 cm szélesben). A toló ajtókat a csíkos betétei teszik játékosabbá. 3 színben kapható: ferrara tölgy és finom barna, san remo és canterbury, canterbury és rusztikus fehér. Mint minden egyes gardróbunkra így rá is jellemző a 18 mm bútorlap vastagság, hogy minél tartósabb legyen a bútor. Magasító hozzá is kérhető így 263 cm magas. 160 széles szekrény: 10.1250,- 160 széles magasító: 41.850,- ... további részletek >>

239 cm széles szekrény: 124.200,- 239 cm széles magasító: 59.400,- Mevásárolható üzleteinkben és webshopunkban egyaránt. www.alphabutor.hu/haloszobai-valasztek/capri-gardrobszekreny Facebook oldalunk: www.facebook.com/Alpha.butordiszkont


Feladva: 2017-04-11    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: széles160magasító239szekrénycanterburyfacebookwwwígycapriMint124színbenlegyenahogyfehéralphabutorjátékosabbátartósabbkínálatunkbarusztikus

Forrás: pepitahirdeto.multiapro.com

Plotter papír értékesítés. Minőségi tekercses termékek, minden méretben. Akár azonnal, raktárról. További információért látogasson el honlapunkra: www.penztargeptekercs.hu/index_ele mei/plotter.htm


Feladva: 2016-05-26    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: plotterpapírtekercseshonlapunkraMinőségilátogassonértékesítésinformációértTovábbiXIIIraktárrólBudapesthtmazonnalKftAkárTóthelemeiméretbenindex

Forrás: pepitahirdeto.multiapro.com

Hiába panaszkodsz nekem, hogy itt fáj-ott fáj, fáradt vagy... Sajnos interneten keresztül nem tudlak megmasszírozni! EL KELL JÖNNÖD! www.egeszseg-megorzes.com/masszazs


Feladva: 2017-04-20    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fájszenvedjJÖNNÖDottKELLittmegmasszíroznihogytudlaknekemnempanaszkodszkeresztülHiábainternetenBudapestsajnosTímeavagytovábbfáradt

Forrás: pepitahirdeto.multiapro.com

A Vörös Reishi (pecsétviaszgomba, Ganoderma lucidum) gyógygomba méregteleníti és kiegyensúlyozza a szervezetet. Én port és kapszulát is szedek. A kapszulával jobban be tudom tartani az adagomat, ami 10 pár RG és GL kapszula. A Reishi port szeretem elszopogatni, mert egyből a szájüregből felszívódva a fogakra, ínyre és torokra is kifejti hatását. 3 éve használom a DXN Ganodermás termékeit. Személyes tapasztalataim 1 év után: ... további részletek >>

www.kavekiraly.hu/blog-2014-10-18-Megelozni_konnyebb__mint_gyogyitani_-_sajat_tapasztalataim Az RG nagyon erős méregtelenítő. Addig kutat a testben, amíg meg nem találja a panasz helyét. A GL-nek kevésbé agresszív a méregtelenítő hatása. Erőssége a regenerálásban és a kiegyensúlyozásban rejlik. A pecsétviaszgomba nem csak a testet méregteleníti és egyensúlyozza ki, hanem a lelket is. Hangulatjavító és antidepresszáns hatású. Webáruház: www.kavekiraly.hu/termekek


Feladva: 2017-01-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kavekiralyVöröstapasztalataimhttpnempecsétviaszgombaportReishiméregtelenítőGanodermaméregtelenítifelszívódvakevésbénagyonadagomattermékeitcsaknek

Forrás: pepitahirdeto.multiapro.com

Személyre szabott gyógynövény teák tanácsadással. Minőségi szálas teák, gyógynövényes teakeverékek, tearendelés a termelőtől! Rigó teák Vegyszermentes kistermelés, gyűjtés, gondos válogatás. Íz-illat-harmónia.


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teákgyógynövényszálasMinőségiVegyszermentesszabottSzemélyreRigóteakeverékektanulóillatgyógynövényesIstvánválogatásgondosgyűjtéstanácsadássalEger

Forrás: pepitahirdeto.multiapro.com

Non Stop Lakatos Budapest! Non-Stop Zármentés Budapest. A Non Stop Zárszerviz Budapest és környéke vállalja zárak cseréjét és javítását, postaládák zárcseréjét. Hevederzárak szerelése, javítása. Ellopták a kulcsait?Illetéktelen személyhez került a kulcs? Zárcsere!Ne váljon betörés ill. lopás áldozatává! A zárcserére és a biztonságtechnikára fordított összeg, többszörösen megtérülhet! Minket éjjel-nappal hívhat, mindig fix árakon dolgozunk. Munkánkról és a beépített anyagokról mindig ... további részletek >>

számlát és garanciát adunk! Tehát zárcsere, zárszerviz, lakatos munkák, vagyonvédelem és hevederzár szerelés Budapesten. Zárjavítás Budapest 0-24! Műanyag bejárati ajtó javítás és zárcsere. Felhúzó kilincses ajtók javítása és zárcseréje garanciával. HI-SEC ajtó zárcsere és javítás. Az elvégzett munkára és a beépített anyagokra garanciát adunk! Hevederzárak kínai ajtókra is! Kínai ajtó zárcsere és javítás. Hívjon bizalommal, minőség és szakértelem megfizethető áron! Hevederzár szerelés Budapesten és Pest Megyében. Minőségi hevederzárak kedvező áron, akár 3 év garanciával. Gyors és precíz, kiváló szakmunka a hevederzár specialistától! Személyre szabott vagyonvédelmi szaktanácsadás. A legjobb hevederzár árak! Biztibuk hevederzár, Prezidium hevederzár. Hevederzár zárbetétek kedvező áron. Hevederzár zárcsere, olcsón minőségi anyagokkal. Hevederzárak műanyag ajtókra is!!! Hevederzár kínai ajtóra is!!! Hívhat non-stop!


Feladva: 2016-10-12    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: HevederzárzárcserenonStopBudapestHevederzárakkínaizárszervizjavításajtóáronlakatosajtókraműanyagjavításagaranciávalmindigminőségiadunkgaranciát

Forrás: pepitahirdeto.multiapro.com

Marcali szálláshelyek fényképes gyűjtőoldala. Kiadó panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Szép kártya elfogadó szálláshelyek - Egész évben nyitva tartó szálláshelyek Marcaliban. - Weblap: www.zimmerinfo.hu/marcali/hu.htm


Feladva: 2017-07-20    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: marcaliszálláshelyekzimmerinfoKiadóhtmelfogadóárajánlatokkalkártyaapartmanokSzépnyaralóházakwwwnélkülvillákhttpdíjvendégházakWeblapközvetítési

Forrás: pepitahirdeto.multiapro.com

Mistyque FehérneműSzalon Online Márkás termékek: Triumph, Sloggi, Felina, Skiny, Misty, Bahama. Rider papucsok, minőségi fehérneműk, fürdőruhák, harisnyák, zoknik - KIFUTÓ MODELLEK KEDVEZŐ ÁRON! Kínálatunkból: FIORE 40 den-es, mintás harisnyanadrágok, több színben: 1.550 Ft. SKINY Essentials Tolerance női trikó (kék vagy narancs): 4.250 Ft. Átadás személyesen: Budapesten (XVII. ker.), Bálványoson (Somogy), vagy országos kiszállítással. Webáruházunk: www.mistyque.hu


Feladva: 2015-11-27    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: mistyqueMárkásországosfehérneműkOnlinevagyFehérneműSzalonpapucsokRiderSKINYfürdőruháknarancsmintáskékdenminőségitrikóFIORESomogynőiTolerance

Forrás: pepitahirdeto.multiapro.com

Ózdi gyepmesteri telepen levő kölyköknek gazdit keresünk! 2-3 hónapos kölykök, Akiknek semmi jót nem hozott az élet még! Megszülettek sokadik kutyának rossz környékre, rossz emberekhez, Akiknél egy kutya élete nem ér semmit! Talán Ők szerencsésebbek, mint más társaik, mert bekerültek az ózdi gyepmesteri telepre, ezzel talán esélyt kaptak egy jobb életre! Egészséges kölyök kutyák,Akik mára már gazdi keresők! Evelin (szuka) 10 hetes Ramszi (kan), 2 hónapos Érdeklődni: 06-70-325-2625, ha ... további részletek >>

foglalt,hagyj üzenetet,hogy melyik kutya miatt érdeklődsz! Ha lesz egy kis ideje visszahív


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: egygyepmesterirossztalántelepennemhónaposkutyákózdikutyaRamsziEgészségeskölykökmelyikmertBabaheteskörnyékreéletrekeresünkhogytársaikszuka

Forrás: pepitahirdeto.multiapro.com

Használtruha Nagykereskedésünk, az originál bálás használt ruha, valamint a minőségi válogatott használt ruha kollekciójával várja kedves vásárlóit. Nyári bálás ruha kínálatunk: vegyes ruha bála, felnőttruha bála, gyerek ruhabála, szabadidős jogging bála, Holland lakástextil és ágynemű bála, valamint Német munkásruha bála. Válogatott Angol ruházat 1.osztály, Extra és Krém minőségben a legjobb áron! Termékeink tartalma: szezonális, divatos és márkás ruha, garantált minőségben! Visszavásárlási ... további részletek >>

garancia! Hívjon minket bizalommal! Látogasson el weboldalunkra! Ingyenes házhoz szállítás a hét minden napján! Viber/Tel: 06306995904 Web: www.europanagyker.hupont.hu


Feladva: 2017-05-17    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: bálaruhahasználtruhaVálogatottbálásvalamintNagykerminőségbenAngoldivatoshttpgyerekLátogassonszezonálisminőségiWebfelnőttruhabizalommaltartalma

Forrás: pepitahirdeto.multiapro.com

Újra indul a családi házakra kiírt Napelem + infra fűtés 50%-s vissza nem térítendő állami támogatással program! Napelem szerelés kulcsra készen. Felmérés ingyenes, tervezés, árajánlat, engedélyeztetés, kivitelezés. Villanyszámla 0 Ft-os csekk és ha ezt kombináljuk infra fűtéssel, akkor a fűtése is ingyen lesz! A kora tavasztól késő őszig megtermelt többletáramot a szolgáltató télen visszaadja és a beruházás 5 év múlva megtérül. Utána ingyen áram évtizedekig.


Feladva: 2017-10-26    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: Napelemtérítendőnemvisszainfraingyentámogatássalengedélyeztetésállamimúlvainfrafutesleszárajánlatberuházásfűtéserendszertervezésvisszaadjaakkor

Forrás: pepitahirdeto.multiapro.com

Amerikai multinacionális kereskedelmi cég keres magyar termelőket, forgalmazókat globális beszállítónak, elsősorban az EU és más kelet-európai piacra. Az áruk és termékek, sőt szolgáltatások minden szegmense érdekli a céget, mert nagy mennyiségben szeretné értékesíteni a magyar és kelet-európai termékeket. A teljes élelmiszer palettából várnak gyártói, termelői ajánlatokat, mind napi fogyasztási cikk valamint tartós fogyasztási cikk viszonylatban is. Valamint a bútor és háztartási gép, jármű, ... további részletek >>

barkács, építkezés, sport, üdülés viszonylatig. A Vállalkozók Szövetsége intézi a kiajánlást számukra a beérkezett ajánlatok alapján. Ilyen könnyen még senki nem tudott új piacokhoz jutni. Ajánlati szám: VSZ/00152/16/07


Feladva: 2017-12-01    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: magyarkerescégAmerikaiValamintcikkfogyasztásiVSZeurópaitermelőketkeletbarkácsszolgáltatásokAjánlatimindbeérkezettjárműsőtjutniajánlatokatgép

Forrás: pepitahirdeto.multiapro.com

Autókölcsönző, autókölcsönzés, bérautó, autóbérlés, kaució nélkül!! Nonstop autóbérlés, kilométer megkötés és kaució nélkül, Napi 5.000.-Ft. Hosszútávra megegyezés szerint, Fiatal, megbízható, rendszeresen karbantartott kis fogyasztású autóból álló flotta. Honlap: www.berelhetoauto.hupont.hu


Feladva: 2015-10-25    [Autó - Motor - Jármű]

Címkék, kulcsszavak: autóbérlésautókölcsönzésgyőrautónélkülbérelhetőkauciósopronmosonmegbízhatóNonstophupontFiatalbérautóberelhetoautoszerintmegyébenAutókölcsönzőálló

Forrás: pepitahirdeto.multiapro.com

Duna House, Magyarország legnagyobb ingatlanközvetítői hálózata ingatlan-tanácsadói területre várja dinamikus, aktív, kitűnően kommunikáló, sikerorientált leendő munkatársait, akik számára fontos a kiemelkedő kereseti-, a folyamatos fejlődési lehetőség és a jó csapat. A Duna House kiemelkedő infrastruktúrával, folyamatos képzésekkel, karrierprogrammal és profi háttérével kiegészülve hosszú távon segíti tanácsadóit. Tanulj egy új szakmát nálunk, nyiss magad előtt új távlatokat! Amennyiben a ... további részletek >>

lehetőség felkeltette érdeklődésed, küldd el fényképes önéletrajzod a frank.andrea@dh.hu e-mail címre


Feladva: 2017-12-27    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: kiemelkedőlehetőségHouseDunaingatlanfolyamatosTanuljhálózatainfrastruktúrávalfelkeltetteleendőtanácsadóitingatlanközvetítőisikerorientáltsegítitávon

Forrás: pepitahirdeto.multiapro.com

Hordozható, vezeték nélküli, újratölthető. 6 hónap garanciával. A készüléket ott használhatja, ahol Önnek szüksége van rá. Többé nem szükséges a gyakran túl rövid áthidalókábelekkel vesződnie. A Start-Booster (12 V) segítségével azok az autók, teherautók, vagy generátormotorok is könnyen újraindíthatók, melyek nehezen hozzáférhető, vagy távoli helyen állnak. A bikázót 12 V-os szivargyújtó kábellel is újra lehet tölteni és mint hordozható energiaforrást is lehet használni. Postai utánvéttel is!


Feladva: 2016-09-20    [Autó - Motor - Jármű]

Címkék, kulcsszavak: hordozhatólehetvagymintÖnneknehezenAUTÓvesződnietölteniaholmelyekATLASZáthidalókábelekkelújrahasználhatjaújraindíthatókbikázórövidkábellelott

Forrás: pepitahirdeto.multiapro.com

Bádogosbolt! A következő termékeket lehet kapni: Csatorna és hozzátartózó termékek. Alumínium, színesalu, horganyzott, horgany, vörösréz egyedi termékek. Kéményszegély, szegélylemezek, csúcsdíszek, hófogók, szerszámok, szegecsek. Nyitva: H-P. 7:30-17 h-ig, Szomb. 8-13 h-ig (Páros héten)


Feladva: 2016-10-16    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: termékekPomáz2013SzinesaluKftszerszámokAluminiumkerhofogokhozzátartózóTomcsúcsdiszekCsatornaNovaszegélylemezekkapniu23KéményszegélylehetOrgona

Forrás: pepitahirdeto.multiapro.com

Addig dobolunk, amíg ez a lakás megtalálja új tulajdonosát! Dob utcában, csendes, félemeleti, 59 nm-es, 2 szobás, igényesen felújított, cirkós, könnyen 3 szobássá alakítható, befektetésnek is kiváló lakás eladó!!! A fotók önmagukért beszélnek! Nézze meg ma, megvásárolni ráér holnap:-) Fotókat küldök!


Feladva: 2017-07-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: DobeladólakásutcábanmegvásárolniszobássámegtaláljamegkönnyenamígNézzecirkósdobolunkbeszélnekfelújítottAddigönmagukértigényesenBudapestfotók

Forrás: pepitahirdeto.multiapro.com

Akuna Alveo gyógynövények kombinációja, mely több évtizedes kutatómunka eredményeként született meg. Összetett hatásaival bárki egészségi állapotán képes javítani, hiszen kizárólag értékes hatóanyagok találhatók benne. A méregtelenítő Alveo ital fokozza a kiválasztószervek működését, így segíti a szervezet megtisztulását. Hatására a bevitt tápanyagok jobban felszívódnak és intenzívebben érvényesíthetik előnyeiket. Mivel a benne lévő növényi összetevők fokozatosan és kíméletesen hatnak, ... további részletek >>

fogyasztása nem okoz kellemetlen mellékhatásokat a méregtelenítés során. Méregtelenítés Akuna Alveo itallal - rendelés webshopunkban! www.gyogynovenyek.megoldascsomagok.com/akuna-alveo-szolos-950ml


Feladva: 2017-02-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: AlveoAkunaitalméregtelenítőMéregtelenítésbennewebshopunkbanműködésétképesfogyasztásatöbbintenzívebbenrendeléskiválasztószervekállapotánhatnakmely

Forrás: pepitahirdeto.multiapro.com

Statikus szakvélemény készítése: - ingatlan vásárlásnál - falkivételnél - átalakításnál - tetőtér beépítésnél - falak repedéseinél - süllyedésnél vagy csak azért, hogy nyugodt legyen ingatlana állapotára vonatkozóan.


Feladva: 2015-10-26    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: szakvéleményStatikusbeépítésnélingatlanatetőtérlegyenátalakításnálnyugodtfalkivételnélhogyvásárlásnálazértingatlancsakkészítésevagysüllyedésnélKft

Forrás: pepitahirdeto.multiapro.com

Partneriskolánk felkészít a sikeres érettségire, neked csak be kell járnod az esti órákra és tanulnod kell! Miért ezt a budapesti esti gimnáziumot válaszd? - Az érettségid megszerzését az állam támogatja, ezért havonta csak 7000 Ft-ba kerül - Ha már valamelyik gimnáziumban vagy szakközépben teljesítetted a 9-10. évfolyam követelményeit, vagy szakmunkás bizonyítvánnyal rendelkezel, akkor 2 tanév alatt megszerezheted az érettségi bizonyítványodat. - Célirányos képzés - csak azt tanítjuk, ... további részletek >>

amire szükséged van - Jól képzett tanári kar, professzionális oktatás - Érettségi megszerzése jó eredménnyel Budapesten - A jelentkezés nincs korhatárhoz kötve - Tanulóinknak ingyenes internet használatot biztosítunk Ne hagyd ki ezt az ajánlatot és jelentkezz a tanfolyamunkra: www.tanfolyamokj.hu/esti-erettsegi-budapesten-a-xi-keruletben


Feladva: 2017-08-15    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: erettsegiestibudapestencsakkeruletbenkellvagytanfolyamokjezteredménnyelkerültanítjukMiérthagydbizonyítvánnyalBudapestmegszerzése7000aztoktatás

Forrás: pepitahirdeto.multiapro.com

PÉCS-től 4 km-re, a MECSEK lábánál, Cserkúton a Vackor Vendégházakba várjuk vendégeinket egész évben! Szép, csendes környezetben a négy különálló, összkomfortos vendégházunk összesen 20 alapággyal és 4 pótággyal működik. Lakásonként hálószobák, fürdő, WC, nappali-konyha, TV-műhold, mikró, kávéfőző, kenyérpirító, hűtőszekrény van. SZÉP Kártyát elfogadunk. Gyerekkedvezményt is adunk. Igény szerint étkezést is biztosítunk. Várjuk gyermekes családok, baráti társaságok, természetjárók, ... további részletek >>

nyugdíjasok jelentkezését!


Feladva: 2016-07-12    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: VárjukSZÉPműködikegészhűtőszekrényKonczpótággyalbiztosítunkvendégeinketkenyérpirítóSomogyvárinéalapággyalétkezéstVendégházakbakávéfőzőVackorokbannégy

Forrás: pepitahirdeto.multiapro.com

Egy lépéssel a betörők előtt! Bízza profikra otthona védelmét! Megbízható, pontos, referenciákkal rendelkező cég! Riasztó- és kamerarendszerek, távfelügyelet a legjobb árakon, Budapesten és Pest megyében! Kérje kollégánk segítségét: 06 20 452 2727 Írjon emailt, visszahívjuk!


Feladva: 2012-10-02    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: PestBudapestenvisszahívjukrendelkezőmegyébenemailtpontoskamerákÍrjonreferenciákkalriasztóksegítségétMegbízhatóAkcióskollégánkvédelmétmegyébenKérje

Forrás: pepitahirdeto.multiapro.com

Vállaljuk LG, Samsung, Sony, Thomson, Philips, Orion, Panasonic, Daewoo, Vestel, Beko, Digitek, Hisense, Hitachi, JVC, Videoton, Grundig, Fujitsu Simens, Toshiba, Pioneer, Beqo, Matsui, NEC, SIM2, Technika , plazma, LCD televízió, projektor készülékek javítását. Javításra és a beépített alkatrészekre garanciát vállalunk. Budapesten és környékén INGYENES KISZÁLLÁS!


Feladva: 2015-09-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: RichárdKadarkutiprojektorLCDplazmavállalunkThomsonTechnikawwwJVCgaranciátSonySIM25544176HitachialkatrészekreSamsungNECTelHisensebeépített

Forrás: pepitahirdeto.multiapro.com

Nadrágok, ruhák, szoknyák és kabátok rövidítését, szűkítését, vagy karcsúsítását vállaljuk rövid határidőre, korrekt áron. Cipzárcsere, cipzárjavítás szakszerűen! Cím: Budapest IX. Tompa utca 22. Ruhaszerviz Nyitva: h,sz,p,: 9,15-17,00-ig k,cs,: 10,00-18,00-ig A szombati nyitva tartásról érdemes előzetesen érdeklődni! Tel.: 06-1-215-7047 Várom szeretettel! www.divatruha.hu/index.php?page=ru haszerviz


Feladva: 2016-07-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: RuhaszervízFERENCVÁROSBANNEKEDBudapest251kítésétérdeklődjöncipzárjavításrövidítésétnyitvatartásrólCipzárcserekabátokszombatiáronszoknyákNyitvakorrekt

Forrás: pepitahirdeto.multiapro.com

Bizonyára Ön is megbízható, jó műszaki állapotban lévő autóval szeretne közlekedni. Ehhez szükséges a rendszeres karbantartás,autóhűtő javítás, ellenőrzés és gyakran némi szak-tanácsadás autóhűtője optimális üzemeltetésével kapcsolatban. Bízza autóhűtőjét olyan szakemberekre akik az Ön biztonságán kívül az elégedettségére is pályáznak és szem előtt tartják, hogy legközelebb is minket - a minőséget - válassza! Várjuk régi és új ügyfeleinket: Érdről és a környező településekről műhelyünkbe.


Feladva: 2017-05-02    [Autó - Motor - Jármű]

Címkék, kulcsszavak: javításautóhűtőkapcsolatbanÉrdrőlkarbantartásszemBizonyáraüzemeltetésévelügyfeleinketrendszerespályáznakBrigittaoptimálisrégiszükségeselégedettségére

Forrás: pepitahirdeto.multiapro.com

4 izgalmas minta a gyerekszobába, kicsiknek és nagyoknak! Az új Star Wars & Velux Galactic Night Collection tetőtéri ablakokra szerelhető fényzáró rolóit Jedi lovagoknak és a galaktikus kalandoroknak terveztük, mindenki megtalálja köztük a kedvencét. A Star Wars & Velux Galactic Night Collection a tetőtéri ablakok üvegfelületét egy űrbéli kaland hátterévé varázsolja, így a kis hősök éjjel-nappal kedvenceikkel lehetnek. A Star Wars & Velux Galactic Night Collection segít abban, hogy a ... további részletek >>

gyerekszoba kis Jedi lovagja gyorsan álomba szenderüljön és utazását messzi-messzi galaxisokban folytassa. Kérjen árajánlatot online: www.farmtuzep.hu/star-wars-velux-galactic-night-collection


Feladva: 2017-09-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: veluxwarsstarnightgalacticcollectionmesszifényzárótetőtériJedikishogymintakalandgalaxisokbankalandoroknakabbanizgalmasűrbéligalaktikussegít

Forrás: pepitahirdeto.multiapro.com

Új műnövények érkeztek! fák, futók, bokrok. www.selyemviragok.hu/index.php?id= 2039 Válogasson és rendeljen a Zöldvilág Webáruházban


Feladva: 2017-12-11    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ZöldvilágfákérkeztekműnövényekGyőrWebáruházWebáruházbanNagykereskedésSelyemvirágrendeljenMűnövényVálogassonbokrokfutók

Forrás: pepitahirdeto.multiapro.com

GH3X kalapácsmechanikás digitális zongora, állványzat, USB. Ingyenes szállítás! GH3X kalapácsmechanikás digitális zongora, állványzat, USB Billentyűzet: 88-billentyűs GH3X kalapácsmechanikás billentyűzet, szintetikus elefántcsont és ébenfa takarólap, kiváltópont Hangszínek: 36 hangszín, Yamaha CFX és Bösendorfer zongorák, VRM (Virtual Resonance modeling), Smooth Release és Key-off Sample Stílusok: 20 ritmus Effektek: 6 zengető, 3 chorus, 7 brilliance, 11 egyéb Dalok: 19 hangszín ... további részletek >>

demo, 50 klasszikus, 303 oktató, USB-ről Wav lejátszás Dalfelvevő: 250 dal, 16 sáv, USB-re Audio felvevő Adattároló: 1,5 MB beépített memória, USB memória (pl. pendrive) Funkciók: transzponálás, finomhangolás, metronóm, Dual (két hangszín megszólaltatása egyszerre), Split (billentyűzet két külön hangszínen megszólaló szekcióra osztása), Duo (billentyűzet két egyforma szekcióra osztása, közös tanuláshoz) Kijelző: 128 x 64 pixeles LCD Hangszóró: 2x 30 Watt, 2x 16 cm) hangszórók Vezérlők: 3 pedálos konzol Analóg csatlakozók: 2 fejhallgató kimenet, AUX in (vonal bement például mp3 lejátszó csatlakoztatásához), AUX out (vonal kimenet, pl. tovább hangosításhoz, felvétel készítéséhez) Digitális csatlakozók: MIDI (be/ki/át), USB To Host (zongora-számítógép csatlakoztatás), USB To Device (zongora-pendrive csatlakoztatás) Egyéb: kihúzható billentyűfedél, Acoustic optimizer, Intelligent Acoustic Control, Stereophonic optimizer Méret: 1461 x 459 x 927 mm Súly: 56 kg Tartozék: állványzat, pedálkonzol, fejhallgató akasztó, kottatartó Bővíthetőség: USB vezeték nélküli LAN adapter (UD-WL01), vezeték nélküli MIDI adapter (MD-BT01, UD-BT01, fejhallgató, zongoraszék, stb. Szín: matt rózsafa (R: Rosewood) www.hangszeraruhaz.hu/yamaha-clp-635r-clavinova-digitalis-zongora/P34732


Feladva: 2017-06-06    [Zene - Hangszer]

Címkék, kulcsszavak: USBzongoradigitálisbillentyűzetGH3XYamahakéthangszínállványzatfejhallgatókalapácsmechanikásClavinovacsatlakoztatás635RadapterCLPBT01csatlakozók

Forrás: pepitahirdeto.multiapro.com

Az Ezermester Magyarország legrégibb és legnépszerűbb általános technológiai magazinja. Gépek, szerszámok, technológiák, építés, kert, újdonságok, ötletek. Facebook oldal: www.facebook.com/ezermester.hu


Feladva: 2017-09-11    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: ezermesterfacebookáltalánosoldallegnépszerűbbötleteklegrégibbújdonságokMagyarországkertajánlóépítésHirdetőtechnológiákPepitaszerszámokHobbimagazin

Forrás: pepitahirdeto.multiapro.com

Minden nap 1x, ha belépsz a weboldalra, 200 TP Tőzsdearanypontot írunk jóvá. Pénzt kereshetsz: Rendszeres használattal (pl.: 3 nap belépése után, extra kuponkód, + kitüntetés) Tőzsdei tartalom elolvasásával, (KuponKód feltöltéssel, vagy automatikusan) Tanulással, videó megnézésével, online, illetve személyes rendezvényeinken, tanfolyamainkon való részvétellel. Promóciókban való segítséggel Facebook - Like & Megosztási aktivitással Meghívási aktivitással (Erre több lehetőség is van)


Feladva: 2015-01-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: valónapKuponKódaktivitássalszemélyestartalomMeghívásiTőzsdearanypontotilletveTőzsdeiMegosztási200onlinekitüntetésLikeweboldalramegnézésévelextra

Forrás: pepitahirdeto.multiapro.com

Gyári és utángyártott autóalkatrészek 35-50%-os kedvezménnyel! Raktárról, vagy megrendelésre, rövid határidővel, garanciával. Folyamatosan frissülő akcióinkkal várjuk kedves meglévő és leendő vevőinket. 1047 Budapest, Baross utca 35. 06-1-350-6202 06-20-330-6666 Hétfő 08.30 – 17.00 Kedd 08.30 – 17.00 Szerda 08.30 – 17.00 Csütörtök 08.30 – 17.00 Péntek 08.30 – 16.00 Olajszűrők: 900.- Ft-tól Levegőszűrők: 1200.- Ft-tól Utastérszűrők: 1500.- ... további részletek >>

Ft-tól Fékbetétek: 4000.- Ft-tól Féktárcsák: 8000.- Ft-tól/pár Vízpumpák: 4500.- Ft-tól Ablaktörlők: 3000.- Ft-tól Régebbi VW alkatrészek Kuplung szettek Futóműalkatrészek Karosszéria elemek, lámpák, rácsok, stb... Az ünnepi nyitvatartásokról honlapunkon mindig tájékozódhat. www.miksan.hu


Feladva: 2016-11-09    [Autó - Motor - Jármű]

Címkék, kulcsszavak: tól8211BudapestRégebbileendő1500vagyünnepiHétfőAutóalkatrészmeglévőUtastérszűrőkRaktárrólstb66663000kedves1200kedvezménnyelrácsok330várjuk

Forrás: pepitahirdeto.multiapro.com

Fuvarozna? Fuvarozót Keres? Regisztráljon Oldalunkon még ma! Közúti fuvarozás · Szállítás és Szállíttatás · >15000 Felhasználó · Biztonságos fuvarbörze Árak | Szállításra Váró Áru | Járműkeresés | Rakományok és Járművek


Feladva: 2017-07-15    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 183megbízhatóSzállításramégÁrakOldalunkonfuvarbörzeRegisztráljonBiztonságosKeresFuvarozótFelhasználóFuvaroznaJárművek15000ajánlóRakományokHirdető

Forrás: pepitahirdeto.multiapro.com

Horvátország, Dalmácia, Zadari Riviéra. Budapesttől 630 km-re, 4 nemzeti park közelében, Zadartól 15 km-re északra Privlakán, közvetlenül a tengerparton 40.000 nm-en fenyőfák árnyékában helyezkedik el a Dalmacija Camp***Holiday Komplex, sekély, homokos, köves öböl szélén, jól kiépített stranddal, parti zuhanyozókkal. Itt minden megtalálható, élelmiszerbolt, zöldséges, pizzéria, bajor söröző, grillház, parti pub, étterem, gyerekjátszótér, szép, tiszta vizesblokkok, wifis pub, fagyizó. Itt ... további részletek >>

ajánlunk összközműves 4-6-8 fős, 2-3 szobás, nappali-konyhás, fürdő-wc-s, klímás, wifis, kábeltv-s mobil-home apartman házakat nagy terasszal, heti (heti 210 euro-tól) és telepített klímás, wifis, tv-s lakókocsikat (heti 30 e Ft-tól). 2007 óta várjuk érkező utasainkat. Áraink 10-20 %-al olcsóbbak a kemping árainál. Magyar iroda, programok, kölcsönző. Videó ajánlásaink: www.youtube.com/user/TravelVirServis


Feladva: 2017-04-13    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: hetiwifisHorvátországpartitólIttpubklímástisztaPrivlakánÁrainkmegtalálhatótelepítettkonyhásKomplexwwwszépészakrautasainkateuromindennappali

Forrás: pepitahirdeto.multiapro.com

A D3 vitamin hatása nagyon jelentős, a legtöbb ember szervezetében mégis csak a kelleténél kevesebb található belőle. A hiány pedig súlyos következményekkel járhat! A D 3 vitamin fogyasztás rendszeresen már gyermekkortól kezdve fontos, amikor a csontok, a fogak és az izmok fejlődése a legaktívabb. Ilyenkor különösen oda kell figyelni rendszeres pótlására, hogy elkerüljük az angolkór és más mozgásbeli rendellenesség kialakulását. A D3 vitamin hatása kiterjed az immunrendszerre, az idegrendszerre, ... további részletek >>

a szív- és érrendszerre is. Segítségével sok gyakori krónikus betegség megelőzhető. www.d3.d-vitamin.bolt.hu/d3-vitamin


Feladva: 2017-07-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vitaminhatásaidegrendszerrekövetkezményekkelhogyemberfogakimmunrendszerresúlyospótlásáralegtöbbcsontokkiterjedpedigrendszeresjelentősamikorhiány

Forrás: pepitahirdeto.multiapro.com

Szeretné, ha haja egészséges, csillogó és dús lenne? Szeretne kellemes környezetben, igazi szakemberek által gyógyulni, szépülni? Nem elégedett a boltokban kapható hajápoló termékekkel? Szalonunk a következő szolgáltatásokat ajánlja: -Hajgyógyászati kezelések: hajhullás, kopaszodás, korpa, zsírosodás, száraz, vékony, töredezett haj és fejbőr panaszok problémájára. Több mint 20 éves tapasztalattal! Személyre szabott kezelési programok, professzionális gyógyászati anyagok, komfortos érzés ... további részletek >>

kezelés közben! Mikrokamerás hajdiagnosztika, fejbőr és hajvizsgálat -Biofodrászat: Haj-állapotfelmérés speciális kamerával. Az Ön stílusának és hajszerkezetének legmegfelelőbb módszerekkel dolgozunk. Vegyszermentes hajfestés a haj szerkezetét erősítő festékkel, (maximális őszfedéssel) Természetes eredetű styling anyagok (hajhab, zselé, hajlakk), melyek meg is vásárolhatóak! Referenciaszalonunkban speciális, biológiailag aktív növényi hatóanyagokkal dolgozunk! Hajmosás, styling, vágás személyre szabottan, az ön haj-és fejbőrtípusának megfelelően. Ionos hajszárítás, kolloid ásványi anyagokkal történő hajfeltöltés. Vegyszermentes hajfestés, hajszerkezet-visszaépítés, vékonyszálú haj erősítése Egyedülálló, a hajszálak szerkezetébe beépülő biológiailag aktív növényi hatóanyagaink biztosítják, hogy az Ön frizurája nemcsak szép, hanem egészséges is legyen!


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hajBiofodrászatnövényifejbőraktívhajfestésSzeretnebiológiailagVegyszermentesegészségesszemélyrekezelésekstylingHajgyógyászatianyagokdolgozunkNovotni

Forrás: pepitahirdeto.multiapro.com

Kűl- és beltéri fagyálló kőedények minden évszakban kiváló díszítő eleme lehet kertjének és lakásának. Anyagának köszönhetően megvédi a beültetett növényeket a nagy hőingadozástól, kedvező körülményeket biztosítva a fejlődésükhöz.


Feladva: 2017-01-07    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: kőedényekfagyállóKűlbiztosítvakertjénekPécskörülményeketlehetMáriakedvezőelemeMolnárnéhőingadozástóldíszítőKésesnagykiválónövényeketévszakban

Forrás: pepitahirdeto.multiapro.com

Szakdolgozatok, házi dolgozatok, bemutatók megírását, tételek kidolgozását, kérdőívek összeállítását és megszerkesztését és egyéb szövegek legépelését vállaljuk. Természetesen formai követelményeknek megfelelően. Gyorsan, olcsón és nem utolsó sorban megbízhatóan dolgozunk! Bővebb részletekért nézd meg a honlapunkat! Ár megegyezés szerint, kérjen árajánlatot üzenetben!


Feladva: 2015-11-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: háziírásszakdogamegirasa@gmailkidolgozásátBővebbkövetkezőTermészetesenamelyettételekdolgozunkhogyvállaljukszerintmegírásátmegbízhatóanÉrtesítjükegyéb

Forrás: pepitahirdeto.multiapro.com

A Centrál Autószerviz márkától függetlenül vállalja gépjárműve karbantartását, javítását. Törekszünk arra, hogy ügyfeleinkkel közvetlen kapcsolatot alakítsunk ki és elnyerjük bizalmukat minőségi, gyors munkánkkal. Nagy figyelmet fordítunk ügyfeleink által észlelt hibák kielemzésére. Autószerelő műhely - Sopron.


Feladva: 2016-08-10    [Autó - Motor - Jármű]

Címkék, kulcsszavak: AutószervizCentrálSopronTörekszünkműhelygyorsjavításátAutószerelőminőségikarbantartásátkielemzésérebizalmukatgépjárművehibákelnyerjükvállaljaészlelt

Forrás: pepitahirdeto.multiapro.com

Autómentés a nap 24 órájában az év minden napján belföldön minden gépjármű-kategóriában. • Rendelkezésre állás: 0-24 óráig! • Autómentő kiállási ideje Budapesten: 30-40 perc • Autómentő kiállási ideje vidékre/külföldre: azonnali indulással, a lehető legrövidebb időn belül!


Feladva: 2016-01-23    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 8226Autómentés6499188TelIstvánMészárosmindenidejekiállásiAutómentőnapbelülidőnpercDunakeszilegrövidebbBudapestenautószállításlehetőóráigNon

Forrás: pepitahirdeto.multiapro.com

A vesekő diéta segítségével megelőzhető a kövek kialakulása. Egy kis odafigyeléssel könnyen kivitelezhető, hogy kevesebb sót fogyasszunk, együnk több zöldséget, gyümölcsöt, csökkentsük a kávéfogyasztást. Ha már kialakult, a vesekő eltávolítása lehetséges akár otthoni módszerekkel is. Ehhez használhatunk vízhajtó teákat vagy speciálisan összeállított teakeveréket. A népi orvoslásnak az egyik leghatékonyabb gyógynövénye a vesekő tünetei ellen a nyírfalevél, melynek teája megakadályozza a kő ... további részletek >>

kialakulását, de a meglévő követ is képes elmorzsolni. Gyors és biztonságos beavatkozás az endoszkópos kőeltávolítás, mely után a beteg gyorsan felépül.


Feladva: 2017-03-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vesekőeltávolításakövetgyümölcsötleghatékonyabbkisbetegEhhezmeglévőzöldségetegyikEgyutánmódszerekkelkialakulásáttöbborvoslásnakkialakulásamely

Forrás: pepitahirdeto.multiapro.com

Csapatom bővítéséhez keresek munkatársakat. Munka és termékreklámozás. Minden támogatást megadok, hogy sikeres légy! Ha érdekel írj emailt!


Feladva: 2017-11-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyHajosmegadokIstvannetámogatástBahnhofstraMindentermékreklámozásMunkaemailtmunkatársakatírjkeresekérdekelbővítéséhezlégyCsapatomsikeres

Forrás: pepitahirdeto.multiapro.com

Az argán fa csonthéjas termésének magjaiból, hidegen sajtolással kinyert olaj az argánolaj. Az argan fa a föld egyik legidősebb fafajtája. A világon egyedül Marokkó délnyugati részén él, ellentmondva a sivatag törvényeinek. Illatos olaja Marokkó folyékony aranyának számít, mivel a betegségek megelőzésére és kezelésére szolgál, valóságos élet elixírként. Az argan olaj 80%-ban esszenciális zsírsavakból épül fel, rendkívül magas az alfa-tokoferol (természetes E-vitamin) tartalma, ezen kívül ... további részletek >>

gazdag A- és D-vitaminbanban, így az összetevők magas szabadgyök megkötő tulajdonsága révén megóvja a bőrt a külső és belső károsító anyagok okozta idő előtti elváltozásoktól. Az Argán olaj általános hatásai: gyulladáscsökkentő, fertőtlenítő, nedvesség megkötő, revitalizáló, gombaölő, baktériumölő, vérellátást javító, sejtfalvédő, immunrendszer erősítő, intenzív zsírégető. Felhasználási területe: Fürdés, vagy tusolás után a bőrön vékony, jól befogadható réteget képez. Pattanásokra, ekcémára, neurodermitisre, leégésre fényvédő hatású, védelmet nyújt az UV- sugarak ellen ( 5-ös faktorú), érzékeny- száraz bőrre, hajhullásra, száraz, törékeny hajra (pakolásként csodákat tesz a hajjal), narancsbőr ellen, reumatikus megbetegedések ellen, antioxidáns volta miatt bizonyos daganatos megbetegedések esetén jótékony hatású, érelmeszesedésre, magas vérnyomásra, keringési zavarok esetén, szívkoszorú-ér betegség ellen, a szívinfarktus rizikójának csökkentésére. Ajánlott mennyiség: 3 teáskanál naponta, a kész ételhez fogyasztva. www.solioetolaj.hu/olaj-reszletes/32


Feladva: 2017-07-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: olajellenmagasArgánmegkötőhatásúmegbetegedésekarganMarokkóeseténszárazAjánlottérzékenyfelkinyertrétegetanyagokmegelőzésérereszletesnarancsbőr

Forrás: pepitahirdeto.multiapro.com

Problémás a matek? Tanulj a ”Rendhagyó matek” sorozat könyveiből! Szeretsz gondolkodni, logikai feladatokat megoldani? Rengeteg feladatot találsz megoldásokkal a ”Gondolkodj!” című könyvben. Esetleg a természetbe vágysz? Szívesen olvasnál túraleírást, érdekel a Kéktúra? Akkor olvasd el a ”69 nap alatt Magyarország körül” című kiadványt. A megadott honlapon valamennyi könyvbe bele is olvashatsz.


Feladva: 2015-10-21    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: 8221matekcíműEsetlegbeleSzeretsznapkönyvbenkönyvbekönyveibőlolvasdGondolkodjvalamennyisorozatAkkormegoldásokkalhonlaponKéktúratalálszmegadott

Forrás: pepitahirdeto.multiapro.com

Építőioarban jártas embereket keresek. Segédmunkást, festőt, burkolót. Csapatok, brigádok ne jelentkezzenek! Csak egy-egy embert keresek mindegyik szakmában! Heti fizetéssel. Azonnali munka. Teljes munkaidőben. További részletekért hívja : Tel :06203535081 vagy 06209674893


Feladva: 2017-08-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresekburkolótfestőtSegédmunkástegyCsakBernátTeljesjelentkezzenekKissmunkabrigádokAzonnaliCsapatok06209674893fizetésselvagyHeti06203535081Tel

Forrás: pepitahirdeto.multiapro.com

Az AR-5316-os A3-as másológép 1 db 250 lapos papírfiókkal és 1 db 100 lapos oldalsó adagolóval rendelkezik. Egyszerű, könnyen kezelhető berendezés. A másológép lézernyomtatóként is használható a beépített LPT és USB portjain keresztül. Windows 10 operációs rendszerrel nem kompatibilis. www.fullc.hu/sharp/webaruhaz.php?S HARP-AR-5316-hasznalt-masologep&ope n=&id=465&kat=24&menu=w


Feladva: 2017-09-18    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: 5316SHARPmásológéplaposHirdetőkeresztülEgyszerűPepitaportjainrendelkezikhasználtphpUSBadagolóvalwebaruhazLPToldalsófullcbeépítettmenuwww100

Forrás: pepitahirdeto.multiapro.com

5 Féle Napkristály ital egy dobozban - 5 x 500ml - 5 Napos Bioflavonoid program - Kibővített összetétel - A legkorszerűbb nanotechnológia - Új vonzó íz, kellemes a gyomor számára. A flavonoidok a szervezet antioxidáns kapacitását növelik, amely képes csökkenteni a szabadgyökök sejteket romboló hatását. Támogatják a védekező rendszer optimális működését. A vörösszőlő segíti az érrendszer optimális működését, javítja a keringést. Antioxidáns tulajdonsága révén, segíthet megvédeni a bőrt is...


Feladva: 2015-11-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: optimálisitalNapkristályAntioxidánsműködésétszabadgyökökvonzócsökkenteniszabananotechnológiaérrendszerképesbőrtlegkorszerűbbsegítiFéleamelyVali

Forrás: pepitahirdeto.multiapro.com

A tolmácsolás összetettebb és kifinomult képességeket igénylő tevékenység, mint a fordítás. A tolmácsnak a másodperc tört része alatt kell reagálnia és fordítania a kommunikáció folyamatosságának fenntartása érdekében. Alapvetően kétféle tolmácsolást szoktunk vállalni. Konszekutív, azaz követő tolmácsolást. Ebben az esetben a szónok, tárgyaló fél, stb. elmond 2-3 mondatot, majd megvárja, amíg a tolmács azt lefordítja azt és így tovább. A tolmács egy üzleti tárgyaláson például 2 nyelvre is ... további részletek >>

fordít és közvetít a 2 tárgyaló fél között, mondjuk német-magyar, angol-magyar, német-angol, vagy épp az ügyfél által kért nyelveken. Profi tolmácsra van szüksége? Hívjon most! Tolmácsaink (az ügyvezetőnket is beleértve) számos üzletembernek segítettek már tető alá hozni a jó üzletet külföldi partnerével. Tegyen próbára minket Ön is, nem fog csalódni! Bármilyen szakterületen megálljuk a helyünket. Tolmácsoltunk már auditokon, szakmai konferenciákon, üzleti tárgyalásokon, szakszervezeti egyeztetéseken, nagy cégmegnyitó rendezvényeken, sajtótájékoztatókon, éves közgyűléseken, műszaki szakterületeken betanításokon, képzéseken, oktatásokon, stb. Szinte minden szakterületről tudunk referenciát felmutatni. Szinkron-, vagy konferenciatolmácsolás. Az alapvető különbség a konszekutívhoz képest, hogy ebben az esetben a tolmács párhuzamosan beszél az előadóval, az előadónak nem kell megvárnia, amíg a közönséghez eljut az információ az adott nyelven, mivel a hallgatósághoz fülhallgató segítségével jut el a tolmács által közölt információ. Ehhez természetesen szükség van bizonyos technikai feltételekre is, így tolmácsfülkére, tolmácsgépre, mikrofonra, a közönség számára fejhallgatókra, stb. Szinkron esetén a tolmács kizárólag az anyanyelvére fordít. Kollégáinkkal számtalan konferencián jártunk már, így tapasztalatunk rendkívül szerteágazó. Elsősorban német és angol nyelveken vállalunk szinkrontolmácsolást.


Feladva: 2017-07-01    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: tolmácsígymárstbangolnémettolmácsolástüzletiSzinkronvagyvanmagyaraztesetbentolmácsolásnyelvekenebbeninformációfélamígfordíttárgyalóáltal

Forrás: pepitahirdeto.multiapro.com

Hozzávalók a tésztához: 2 tojás 1 bögre cukor 200 g tehéntúró 1 kiskanál szódabikarbóna 1/2 kiskanál só 2 bögre liszt kókuszreszelék (a díszítéshez) Hozzávalók a krémhez: 3 tojássárgája 6 evőkanál cukor 5 evőkanál liszt 7 dl tej vaníliaaroma 200 g vaj Verjük fel a tojást a cukorral, majd adjuk hozzá a tehéntúrót, a szódabikarbónát, a sót és egy bögre lisztet, keverjük össze habverővel vagy kézi robotgéppel. Adjunk hozzá még egy bögre lisztet és keverjük össze. Tegyük ... további részletek >>

hűtőszekrénybe 60 percre a tésztát. Készítsük el a krémet: Keverjük ki a tojássárgáját a cukorral majd tegyük bele a lisztet és a tejet, kavarjuk össze habverővel vagy robotgéppel, lassú tűzön kezdjük főzni. Közben folyamatosan kavargassuk, amikor elkezd főni vegyük le a tűzhelyről és ízesítsük vaníliaaromával, hagyjuk hűlni. A vajat alaposan habosítsuk fel és keverjük hozzá a krémet. Vegyük ki a hűtőből a tésztát és osszuk 6 egyenlő részre, nyújtsunk belőle 6 lapot. Előmelegített sütőben, vajjal kikent tepsi hátulján süssük mindegyik lapot pár percig, amíg egy kis színt kapnak. A tortalapokat kenjük meg a krémmel és tegyük őket egymásra, szórjuk meg kókuszreszelékkel. Hagyjuk állni pár órát, majd szeleteljük. Jó étvágyat! www.webcukraszda.hu/bogres-raffaello-torta/


Feladva: 2017-04-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: keverjükbögrelisztettegyükmajdegyhozzáösszemegliszttésztáthagyjukevőkanálcukorVegyükkrémetcukorralrobotgéppelHozzávalókvagytortahabverővel

Forrás: pepitahirdeto.multiapro.com

Label automata ajtó, tolóajtók, nyílóajtó automatikák, kapu automatikák, üvegvasalatok, mobil üvegfalak A LABEL automata ajtókban és nyílóajtó automatikákban a LABEL spa. cég évtizedek óta felhalmozódó technikai fejlesztésének eredménye mutatkozik meg. Az olasz design és a német precizitás ötvöződik a meghajtásokban. Típusválasztékunk lehetővé teszi, hogy minden helyre a leghatékonyabb megoldást ajánljuk. Az új szabályozások, az akadálymentesítés szükségessége, a jobb ... további részletek >>

megközelíthetoség következtében a nagyobb forgalmú, vagy egyéb hivatali helyiségek bejáratát célszerű automatizálni. Ezekre a feladatokra kínálunk költségtakarékos, energiahatékony megoldásokat. Igény szerint partnereinkkel együtt, akár a teljes akadálymentesítési feladatot megoldjuk a meghajtásokban. Cégünk munkatársai díjmentes szaktanácsadással segítenek a legoptimálisabb megoldás kialakításában.


Feladva: 2016-08-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: LABELautomataautomatikákmeghajtásokbannyílóajtóüvegfalakmobilszerintötvöződikhelyiségekótamunkatársaiszabályozásoküvegvasalatokIgényprecizitásCégünk

Forrás: pepitahirdeto.multiapro.com

Önnek is Budapesten van ingatlana? Problémát okoz a takarítás? Akkor önnek a lakástakarítás Budapest szolgálatunkra van szüksége! Számunkra fontos a tisztaság amint ezt a szolgáltatásunk is mutatja, így ön a legjobb helyen jár ha lakástakarítás ügyében keres, megbízható, precíz takarító szolgálatot. Lakástakarítás - Lakástakarítás Budapesten Akciós áron minden alkalomkor! www.takaritasmost.hu/lakastakarita s.html


Feladva: 2017-12-19    [Lakossági szolgáltatás]

Címkék, kulcsszavak: LakástakarításBudapestvanBudapestenönnektakaritasmostmegbízhatótisztasághttpProblémátkeresfontosalkalomkoringatlanaügyébenSzámunkramindenjáráron

Forrás: pepitahirdeto.multiapro.com

Könyvelés és bérszámfejtés kedvező áron Angyalföldön a Full Active Bt. könyvelőirodában. Egyéni vállalkozások és társas vállalkozások könyvelése kedvező áron. SZJA bevallás magánszemélyeknek kedvező áron. Könyvelését bízza hozzáértőkre! Visszamenőleges könyvelést is vállalunk. Ha bármilyen kérdése lenne könyvelés ügyben, keressen minket bizalommal. Tel: 412-08-06, Fax: 412-08-07


Feladva: 2015-01-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: áronkedvezőkönyvelésActiveFullAngyalföldönbérszámfejtés412vállalkozásokhozzáértőkreEgyéniminketbízzakönyvelőirodábankeressenKönyvelésétügybenlenne

Forrás: pepitahirdeto.multiapro.com

Törökbálinton a Depóba raktári takarítási munkára keresünk főállású takarítókat délelőttre, illetve délutánra egyaránt (reggel 6 és délután 18 óra között elosztva 2 x 8 órában átfedéssel). Feladatok: kézi és gépi takarítás egy szép igényes rendezett raktárban. Napi 8 órás munkaidő hétfőtől péntekig, a hétvégék szabadok. Elsősorban férfi alkalmazottat keresnénk, de minden megoldásra nyitottak vagyunk. Jelentkezni telefonon a 20/9-268-790-es számon, illetve önéletrajz küldésével lehet, ... további részletek >>

fizetési igény megjelölésével.


Feladva: 2017-05-29    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: illetveküldésévelátfedésselmindenállásúNapiállásönéletrajzórábankeresnénkkeresünkraktárbantakarítóelosztvaalkalmazottatmunkárarendezettszámon790

Forrás: pepitahirdeto.multiapro.com

Kefir, ez az aranyos, 6-7 hó körüli kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: 06 70/325-2625, ha ... további részletek >>

foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!! körüli kan


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagykörüliörökbeGYEPMESTERIFogaddKefirSÜRGŐSgazdinakNAGYONkutyaegygazdaÉrdeklődnitörvényekÓzdértekifizetnieutánlenneVisszahívkellnem

Forrás: pepitahirdeto.multiapro.com

Vendégházunk a szabad strandtól kb 50 méterre, a Kecskeméti utca végén található. Két hálóval és egy hálóként használt nappalival a ház 4-6 fő részére kínál partközeli szállást. A házban 2 háló, egy előszoba, két fürdő és felszerelt konyha található. Az udvarban bográcsozási, grillezési lehetőség. Parkolás a zárt udvaron. A házba kutya és egyéb háziállat díjtalanul hozható! Létszám és a foglalni kívánt időszak megjelölésével kérje ajánlatunkat.


Feladva: 2017-12-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: egyméterretalálhatóstrandtólszabadházkétkívánthálókéntParkolásCsikósfoglalnihálóvallehetőségkiadóhálóLétszámvégéngrillezésiönállóházbanutca

Forrás: pepitahirdeto.multiapro.com

Nagyszabású lakóparki beruházások kivitelezéshez keresünk építőipari és építőipari kiegészítő-tevékenységet végző, tapasztalt alvállalkozókat, valamint szakipari munkákhoz vállalkozásokat, szakembereket a kisebb munkákhoz is. Ajánlati szám: VSZ/00160/16/07


Feladva: 2017-12-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: VSZmunkákhozépítőiparikeresünklakóparkiNagyszabásúalvállalkozókatkivitelezőt00160tapasztaltberuházáshozvégzőszámtevékenységetAjánlatikiegészítőkisebb

Forrás: pepitahirdeto.multiapro.com

Balatonföldvár, Neptun apartmanházban klimatizált apartman eladó. Szauna, úszómedence használat az árban, Balatonpart kb. 150 méter. Eredeti ár: 13.7 MFt.


Feladva: 2017-05-07    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóapartmanNeptunBalatonföldvárúszómedenceSzaunaklimatizáltIrányárapartmanházbanméter150BalatonpartüdülőárbanBalatonihasználat

Forrás: pepitahirdeto.multiapro.com

Otthon végezhető internetes munka. Javaslom jövedelem kiegészítésként. Semmi más dolgod nincs, csak 4 jegyű kódokat beírni. Nincs regisztrációs díj, nem kell eladni és értékesíteni sem. Fizetés egy kód után 10 cent, idő ráfordítástól függően. 2-3 óra alatt akár 30 ezer forint is lehet. Ha érdekel, ezen a linken tudsz regisztrálni: www.moduredrse.win/3885730528703/


Feladva: 2017-11-16    [
Pénzkeresés - MLM]

Címkék, kulcsszavak: Nincsforintmunkaegy3885730528703kódokatezerinternetesFizetéswinjegyűakárvégezhetősemmoduredrsecsakalattOtthonértékesítenihttpdolgodóramás

Forrás: pepitahirdeto.multiapro.com

Karcher HDS655 SX 220-as ipari gőzborotva vegyszeradagoló vizlágyító garanciával.


Feladva: 2017-10-29    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: Karchergőzborotvaipari220hds655zolt65506309126148hdsgaranciávalvizlágyítóvegyszeradagoló

Forrás: pepitahirdeto.multiapro.com

Számítástechnikai szerviz Pécsen a Lánc utcai rendelőnél. Nyomtatók és számítógépek javítása, olcsó nyomtató kellékanyagok. HP DesignJet plotterek javítása helyszínen. Pécs, Farkas István utca 8. Nyitva hétfőtől péntekig 9-től 17 óráig.


Feladva: 2017-01-17    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: PécsjavításaszervizSzámítástechnikairendelőnélutcaihelyszínenLáncPécsenóráigplotterektőlDesignJetpéntekigkellékanyagokImrehétfőtőlnyomtatóKovács

Forrás: pepitahirdeto.multiapro.com

Gondja van egészségével? Érszűkületes? Csontritkulása van, vagy lúgosítani szeretné szervezetét? Esetleg cukorszintjén szeretne javítani? Látogassa meg oldalamat www.vitalioninfo.lapunk.hu Ajánlataim segítik Önt egészsége megőrzésében és jobbá tételében: allergia, bőrproblémák/ ekcéma,pikkelysömör,herpesz,lábszár fekély/erősödik immunrendszere, pótolja vashiányát, változókori problémákra, vízhajtó,alvássegítő, nyugtató, emésztéssegítő,cisztára,és daganatos betegségek megelőzésére.


Feladva: 2015-12-27    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vanszeretneÖntcukorszintjéncisztáralábszárfekélyVitalionsegítikEsetlegemésztéssegítőherpeszHRIAjánlataimszervezetétnyugtatópikkelysömörlapunkekcéma

Forrás: pepitahirdeto.multiapro.com

Elektromos moped 4 évszakos gumikkal, Garancia + Mobilszerviz, ingyenes, gyors házhoz szállítással és beüzemeléssel! Idősebbeknek, nehezebben mozgóknak mozgáskorlátozottaknak és egészségpénztári tagoknak ajánlunk három kerekű elektromos mopedeket. Járműveink kezelése egyszerű, fenntartása olcsó. Árak 180.000 Ft és 250.000 Ft között.


Feladva: 2016-02-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elektromos000elektromopedmopedmopedeketbeüzemelésselAkcióközöttszállítássalHúsvétikerekűházhoz250háromgyors180ajánlunkingyenesÁraktagoknak433

Forrás: pepitahirdeto.multiapro.com

Eddig mennyit kerestél abból az üzletből, amely mellett minden körülmények között kiállsz? Értem én, hogy hirdetéseket adsz fel, mert valami csodát ajánlasz! Értem Én, hogy pénzt szeretnél keresni abból, amit ajánlasz! Azt nem értem, hogy miért kell külföldiek zsebét tömnöd! Minden külföldi tömhetné a Te zsebedet is! Gondolkozz!!!!!!!! Biztos vagy abban, hogy az a csoda termék, amit ajánlasz, Neked milliókat hozhat? Sok pénzt kifizettél, befektettél már világmegváltó lehetőségekbe? Sok ... további részletek >>

pénzt elveszítettél? Meg is érdemled! Ez fájdalmas tanuló pénz volt! Mindent értek! Csak azt nem, hogy miért nem vagy nyitott olyan lehetőségre, ahol minden másképp működik, mint amit eddig megismertél! Nem kell befektetned, nincsenek MLM eladások, nincsenek vásárlási és egyéb kötelezettségek, nincs semmi, amit nem szeretnél! Vannak lehetőségek, amelyeket kihasználhatsz, ha szeretnéd! Van arra lehetőséged, hogy akár 5-10 év alatt milliomos legyél továbbajánlások nélkül is!!!!!!!!!!! Ingyen van az információ, nem kell befizetned, és mégsem érdekel???? Mondd meg Te, hogy mit szeretnél, és megnézzük, hogy lehetséges e, de valószínű, hogy igen! Keress bizalommal kérdéseiddel az email címemen. Ha megadod a telefonszámod, szívesen fel is hívlak! Email: rozsabusiness@gmail.com


Feladva: 2017-03-07    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmindenamitértemabbólkellszeretnélajánlaszpénzteddigaztSokmellettamelyEmailüzletbőlkerestélfelmennyitnincsenekvankiállszmegvagy

Forrás: pepitahirdeto.multiapro.com

Sziasztok, ki szeretne otthonról: 🔸suli 🔸gyed 🔸gyes vagy 🔸meló mellett is akár egy kis plusz pénzt keresni? Ha elmúltál 18 éves, akár fő vagy mellékállásban is dolgozhatsz, saját időbeosztásoddal, azonnali jutalékkal! Te döntöd el mikor, honnan és mennyit dolgozol.   Nincs semmi másra szükséged csak egy okostelora vagy egy laptopra és internetre. Teljesen ingyenes! Én ezt teszem és te? Ha érdekel, írj privát, és küldöm a részleteket! ... további részletek >>

Nekem bejött!


Feladva: 2017-10-17    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 128312vagyegyakárTeljesen12288DolgozzbejöttmellékállásbaninternetregyesdolgozolNekemlaptopragyedmennyitrészleteketévessulihonnanküldömmikor

Forrás: pepitahirdeto.multiapro.com

Eladó szamurájkard, katana, wakizashi, tanto! Minőségi acél, választható markolat és sok minden más... Aktuális árukészlet és akciók a honlapunkon!


Feladva: 2017-04-28    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szamurájkardEladóKardokSzamurájtantowakizashikatana

Forrás: pepitahirdeto.multiapro.com

Kényeztető kozmetikai kezelések, masszázs és alakformálás Budán a Mechwart ligetnél. · Kozmetikai kezelések · Masszázs · Sminktetoválás · Manikűr - Pedikűr Kozmetikai webshopunk: www.algothermshop.hu


Feladva: 2017-10-02    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: 183KozmetikaiMasszázskezelésekligetnélEsztétikaalgothermshopMechwartAlgothermwwwBudánwebshopunkalakformálásKényeztetőPedikűrkerManikűrBudapest

Forrás: pepitahirdeto.multiapro.com

Társkereső weboldal baráti áron eladó. 3 in 1 megoldás. (Titkos, alkalmi, komoly). 1000-nél is több regisztrált felhasználó! .com-os, .hu-s domain nevekkel. Remek befektetés, ha komolyan gondolod. Alapozzad meg a jövődet! A részletekért hívj bátran!


Feladva: 2017-03-30    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: eladóweboldalTárskeresőnélBudapestgondolod1000AndraskomolyankomolyBundzselbefektetésalkalmiRemekTitkosnevekkelmegoldásbátrandomainhívjcom

Forrás: pepitahirdeto.multiapro.com

VENDÉGLÁTÓS állásaink Németországban: szakács, felszolgáló, szobalány, főzőasszony. SZAKÁCS végzettséggel és valamennyi némettudással, szállással és ellátással. 1800-2400€ Bruttó. FELSZOLGÁLÓ (végzettség nélkül is) Wirshausba (kocsma) 900€ nettó + borravaló (kb 1600-1800€ nettó lesz a vége), szállással és ellátással. (valamennyi némettudással-A1-től) 35 éves korig. SZOBALÁNY és konyhai kisegítő (50-50%) egy kis Panzióba ( 8 szoba van) 1000-1200 € nettó, ... további részletek >>

szállással és ellátással. (B1 némettudástól) BeiKoch – segédszakács, KUKTA- (főzőasszonyt- főzni tudó személyt keresünk) vendéglőbe valamennyi némettudással, szállással és ellátással. 1000-1200€ nettó. További infók a www.nemetmunka.hu/gastro.html weboldalunkon, ahol regisztrációs lehetőség is van. Érdeklődni munkaidőben a +36 1 920 3433 vagy a +49 8641 6949 000 vezetékes számokon lehet. Várjuk jelentkezését! Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban)


Feladva: 2017-03-26    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 8364ellátássalszállássalnettónémetnémettudássalvalamennyi1000állásainkSZOBALÁNYVENDÉGLÁTÓSFELSZOLGÁLÓTeamMunka1800SZAKÁCSvan1200számokonkonyhai

Forrás: pepitahirdeto.multiapro.com

BURKOLÓi állásunk Mannheim közelében2 http://www.nemetmunka.hu/allasaink.html Németországi állásainknál mindig direkt a német cég a munkaadó! -4 fő BURKOLÓ (hideg) Fix állás, ill. cég jelentkezése esetén a burkoló cég alvállalkozóként. -A munka a Mannhein-Heidelberg-Landau háromszögben van, 16 éve működő stabil hátterű német cégnél. -Az egyénileg jelentkezőket felveszi a cég 14€ Bruttó kezdő órabérrel, ami 19,-€-ig emelkedhet. Szállás az első 3 hónapban ingyenesen ... további részletek >>

megoldott, utána 150,-€/hó. A munkábajárás céges kocsival történik. Baustelle némettudás kell! (melós német) Hosszútávú munkát keresők jelentkezését várjuk. A cégként vagy vállalkozóként jelentkezőkkel a német cég vállalkozási szerződést köt, egyéni megállapodás szerint (magyar Bt, Kft is jó). 3-4 fős csapat esetében 1fő beszéljen németül. Jelentkezni lehet: (e-mailben, regisztrálással, telefonon) 1.) E-mailben, német nyelvű fényképes önéletrajzzal és telefonszámmal. info@nemetmunka.hu 2.) Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3.) Telefonon munkaidőben a magyar 06 1 920 3433 ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9.00-17.00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-09-10    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németcégburkolóMunkanemetmunkawww8364TeamVárjukillhtmlállásmagyarhttpmailbenTelefononjelentkezésétvagy8641németülhónapbanNémetországirégi

Forrás: pepitahirdeto.multiapro.com

Egy falat Székelyföld, egy falat hagyomány, egy falat egészség. Boltunkban megtalálják a legfinomabb székely kézműves élelmiszereket. A Székely Falat kiváló füstölt hústermékeit, a madarasi, székelyszentléleki és torockói sajtokat, házi vajat, Szász Illyés méhészetéből kikerülő havasi bio mézeket és egyéb mézkülönlegességeket, Gáll Erzsébet házi lekvárjait és szörpjeit, az Ábel székely mustárt, a Csíki áfonyát, a Hargita Gyöngyét és számtalan egyéb székelyföldi manufaktúrákból kikerülő terméket


Feladva: 2015-10-24    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: FalategyszékelyegyébházikikerülőÁbelLászlóIlyésmanufaktúrákbólélelmiszereketszörpjeitBagiSzászszékelyföldikézműveslekvárjaitboltvajatErdélyi

Forrás: pepitahirdeto.multiapro.com

XXI. századi modern és nagyszabású lakóparki beruházások kivitelezéshez keresünk tervező mérnököket, mérnöki irodákat. Már „zero riport”-felmérésekhez is... Ajánlati szám: VSZ/00159/16/07


Feladva: 2017-12-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: VSZtervezőszázadiirodákatXXI00159mérnökikeresmérnököketmérnökötszámkivitelezéséhezAjánlatikeresünkBeruházásfelmérésekhezkivitelezéshez8221riport

Forrás: pepitahirdeto.multiapro.com

A tisztaság fél egészség! Persze a mondás máshogy is szól, mely akár még igaz is lehet. Hiszen minek vesződjön a ruhatisztítással, a fárasztó mosással, vagy a korán sem kíméletes vegytisztítással, amikor van, aki szívesen megcsinálja Ön helyett? A mosoda Budapesten biztosítja azon professzionális ruha- és vegytisztítási szolgáltatásokat, melyek garantáltan foltmentes világot teremtenek. A mosoda Budapesten több évtizedes múltra tekint vissza. Új üzemeltetőként igyekszünk a patinás patyolat ... további részletek >>

hírnevét tovább vinni, munkatársaink a mosást, a vegytisztítást és a ruhatisztítást gyorsan és precízen látják el, olyan kiegészítő szolgáltatásokkal együtt, mint például a frissen mosott ruha házhoz szállítása. Teljes körű szolgáltatásaink, kedvező áraink, szakképzett kollégáink és a professzionális eszközeink teszik lehetővé, hogy a mosoda Budapesten még a háztartási mosógépek világában is versenyképes legyen. Ruhatisztítás Budapesten és egész Pest megyében, gyorsan és precízen!


Feladva: 2016-10-05    [Lakossági szolgáltatás]

Címkék, kulcsszavak: mosodaBudapestenprecízengyorsanmégRuhatisztításruhaprofesszionálismegcsináljamintfárasztóháztartásitovábbteremtenekmondáskedvezőszívesenegyüttaki

Forrás: pepitahirdeto.multiapro.com

Izgalmas meséskönyv gyerekeknek e-könyv és nyomtatott könyv formában. Elérhető a www.publioboox.com/hu_HU/allati-to rtenetek1 oldalon.


Feladva: 2017-05-01    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: könyvkönyElérhetőformábannyomtatottgyerekeknekoldalonmeséskönyvtortenetek1IzgalmasallatiBudapestcomKisspubliobooxVirághttps

Forrás: pepitahirdeto.multiapro.com

Az álmok jelentése a legtöbb embert érdekli. A tudomány sem cáfolja azt a nézőpontot, miszerint álmunkban legbensőbb világunk jelenik meg, félelmeink, vágyaink, reményeink vetülnek ki különböző fantáziákba szőve. Az álom működése azonban még ma sincs teljesen megfejtve. Hogy mit üzennek, gyakran csak találgatni tudjuk, máskor pedig egészen egyértelmű, hogy a napközben átélt helyzeteket dolgozzuk fel általuk. Az álmok megfejtése napjainkra egyfajta “tudományággá” vált, sokszor ... további részletek >>

segítségül hívhatjuk a különböző lelki problémák, konfliktus- és stresszhelyzetek feldolgozásához.


Feladva: 2016-11-08    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: jelentéseálomhogykülönbözőmégálmoktudjuksegítségülműködésefelálmunkbantalálgatniKittisokszordolgozzukmiszerintcsakKellérváltszővehelyzeteket

Forrás: pepitahirdeto.multiapro.com

Murci,ez a nagyon szép,kedves, 1,5 év körüli kis-közepes nagyságú kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie ... további részletek >>

Érdeklődni lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagykutyaSÜRGŐSgazdinakNAGYONMurcitelepengazdaörökbeGYEPMESTERIkellutánkisüzenetetnemgazdiraBekerülésükaltathatókörülihagyjeredetiÓzd

Forrás: pepitahirdeto.multiapro.com

Minőségi, bontatlan bálás használtruha, számos fajtáit kínáljuk, értékesítés céljából, különböző kategóriákba sorolva. Friss gyűjtésű, szezonális, minőségi import, gyerek használtruha, felnőtt használt ruha, használt munkásruha, és lakástextil, valamint ágynemű. Nyers bálásruha, és válogatott, zsákos kiszerelések! Érintetlen, eredeti csomagolások! Nagykereskedelmi árak, magánszemélyek részére is! Ingyenes házhoz szállítás országosan. Tel: 0670-579-1452 (Viber is!) Web: ... további részletek >>


Feladva: 2017-02-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: használtruhaminőségibáláshasználtimportNagykereskedelmibontatlanlakástextil1452FrisscsomagolásokGyulamunkásruha579sorolvaeredetiangol0670ruha

Forrás: pepitahirdeto.multiapro.com

Velence Korzón második referenciaszalonunkba kreatív, munkájára igényes munkatársat keresünk műkörmös és pedikűrös munkakörbe! Érdeklődj telefonon! - 20 323-7254 www.biohajklinika.hu/hu/dolgozz-ve lunk/cikkek/dolgozz-velunk


Feladva: 2016-08-30    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: VelencekeresünkmunkakörbepedikűrösGabriellaműkörmösNovotniPEDIKŰRÖSTmunkatársatMŰKÖRMÖSTigényesmunkájára7254kreatív323referenciaszalonunkbatelefonon

Forrás: pepitahirdeto.multiapro.com

Kertészetünkben fejlett, több hajtásból álló kék áfonya bokor, másnéven vaccinium corymbosum kapható személyes átvétellel vagy az ország bármely pontjára futárszolgálattal, házhozszállítva. www.afonyaporta.hu/termekkategoria /afonya-bokor Áfonya Porta A kertészet Dabas külterületén, a 405-ös főúton található Vitafort Zrt. melletti útról közelíthető meg, melyet táblák jeleznek. .


Feladva: 2017-09-18    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: ÁfonyabokorkaphatóDabaspontjáraállómegkertészetbármelyhajtásbólközelíthetőPortaországtöbbútrólvagyfejlettmellettiátvétellelKertészetünkbenZrt

Forrás: pepitahirdeto.multiapro.com

Autóbontók bontott alkatrészei egy helyen, az ország legnagyobb bontott alkatrész webáruházában: - Több, mint 250.000 db bontott alkatrész! - Pénz-visszafizetési garancia 15 napig - Házhoz szállítás másnapra - Magánszemélyek és viszonteladók kiszolgálása. A https://bontoplaza.hu webáruházban magyar autóbontók kínálatából vásárolhat karosszéria, fék, futómű, elektromos és motorikus alkatrészt., jelenleg az alábbi modellekhez: Alfa Romeo, Audi, BMW, Chevrolet, Chrysler, Citroen, Dacia, ... további részletek >>

Daewoo, Daihatsu, Fiat, Ford, Honda, Hyundai, Infiniti, Iveco, Jaguar, Jeep, Kia, Lada, Lancia, Land Rover, Lexus, Man, Mazda, Mercedes-Benz, Mini, Mitsubishi, Nissan, Opel, Peugeot, Porsche, Renault, Rover, Saab, Seat, Skoda, Smart, Ssangyong, Subaru, Suzuki, Toyota, Volvo, VW Volkswagen.


Feladva: 2016-10-15    [Autó - Motor - Jármű]

Címkék, kulcsszavak: bontottautóbontókhttpRoverhelyenegyalkatrészeialkatrészbontoplazaMazdafékHyundaiszállításAudiwebáruházábanMankarosszériaVolkswagenHondaHázhoz

Forrás: pepitahirdeto.multiapro.com

Balatonalmádi szálláshelyek fényképes gyűjtőoldala. Kiadó Hotelok panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron! -Több mint 1000 fényképpel a szálláshelyekről és a városról! - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Egész évben nyitva tartó szálláshelyek Balatonalmádiban - Weblap: www.zimmerinfo.hu/almadi/hu.htm


Feladva: 2017-11-28    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekKiadószállásokBalatonalmádizimmerinfolegolcsóbbwwwapartmanokSzéchenyinélkülhttpnyaralóházakkártyadíjWeblapvillákSZÉPközvetítésiévben

Forrás: pepitahirdeto.multiapro.com

Neked már fizetett valaki azért, hogy kávét iszol? És szeretnéd, hogy fizessenek? Ha igen, jelentkezz a weboldalon: www.fekete.egeszsegeskave.hu/uzlet i_lehetoseg


Feladva: 2013-07-07    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyszeretnédpénztlehetosegiszolKeressuzletikávétKávézolegeszsegeskaveazértfeketevalakihttpfizetettweboldalonmárjelentkezzNekedigenErzsébet

Forrás: pepitahirdeto.multiapro.com

Gold-Styll antiallergén prémium divatékszer! A Gold-Styll családi vállalkozásunk ebben az ékszerek iránti szenvedély jegyében egy nőies, rafinált és minőségi divatot kíván létrehozni. Szeretnénk meghódítani az európai piacot és minél több országban jelen lenni. Értesüljön akcióinkról, látogassa honlapunkat! Megtalál bennünket a Facebook-on is: facebook.com/goldstyll


Feladva: 2015-12-08    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: egytöbbminélStyllGoldlétrehozni2015embernekEleganciakívánkeresünkévbendivatotRégioembereketebbenminőségimanezsereketőszintevállalkozásunkadni

Forrás: pepitahirdeto.multiapro.com

Adósságbehajtás, Őrzés-védelem, Takarítás, Magánnyomozás, Testőrszolgálat, Sofőrszolgálat... Miért az Alfa 333 Group? Üzletfilozófiánk legfontosabb eleme a személy és a tulajdon védelme, ennek sérthetetlensége, óvása, fenntartása. Összegezve: számunkra Ön a legfontosabb!


Feladva: 2017-02-27    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: AlfaSofőrszolgálatTestőrszolgálatMagánnyomozásTakarításvédelemŐrzésAdósságbehajtásKftGroup333

Forrás: pepitahirdeto.multiapro.com

Susani, ez a szomorú szemű,1,5 év körüli,közepes nagyságú kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni ... további részletek >>

lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagygazdaörökbeGYEPMESTERISÜRGŐSgazdinakszeműszomorúkutya325elaltathatóakmegegysürgősenMEGTELTáltallehetszerintmentsdkankeresünkTELEP

Forrás: pepitahirdeto.multiapro.com

Minőségi Taktikai, outdoor, sport, vadász ruházat, kiegészítők és felszerelések nagy választékban! Webshopunkban több 100 termékkel, kedvező árakkal és folyamatos akciókkal várunk! Országos kiszállítás.


Feladva: 2016-10-30    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: FreskaZonetermékkeloutdoor100TaktikaitöbbMinőségiWebshopunkbanBudaörskiszállításválasztékbanNetOrszágosnagyvárunkfelszerelésekWebáruházakciókkal

Forrás: pepitahirdeto.multiapro.com

Tanuld meg irányítani a sorsodat? Ne fusd a felesleges köröket! Csináltass személyes horoszkópot! Oldjad fel blokkjaidat, jobb életminőséget kapsz érte és nem neked, de gyermekeid élete is ez által javulni fog! Online tanácsadás: asztrológia-horoszkóp, numerológia-számmisztika, névmisztika, tarot-kártya-jóslás, feng-shui. Email: dk kati33@gmail.com Web: www.dk-magie.com


Feladva: 2016-08-23    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: comSegítőSorsshuifusdonlineéletminőségetfengsorsodat8226jobbjóslásirányítanifogblokkjaidatkártyamegjavulnifeltarotTanuldáltalOldélete

Forrás: pepitahirdeto.multiapro.com

Kutyakozmetika, kutyakozmetikus. Szeretettel várjuk Önt és kedves kutyáját kozmetikánkban. Kedvence részese lehet az Ön igénye szerint egy fürdetésben és egy nyírásban. Telefonos időpont egyeztetéssel.


Feladva: 2015-08-25    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: XIIIegyKutyakozmetikakerületegyeztetésselrészesekutyájátidőpontKedvencekedvesTelefonoskozmetikánkbanönttartástalálhatóvárjukNyitvaalattnyírásban

Forrás: pepitahirdeto.multiapro.com

A BlackStyles webshop egyedi mintás és feliratos pólók, illetve pulóverek színes választékával és igen kedvező árakkal várja a kedves vásárlókat!


Feladva: 2017-07-31    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: webshopBlackStylesTamásválasztékávalOrbánszínesPólópulóverekOnlineilletvepólókvásárlókatfeliratoskedvesmintásvárjaegyediárakkalkedvezőigen

Forrás: pepitahirdeto.multiapro.com

Gerincsérv, derékfájás, lumbágó, isiász, hátfájás, porckorongsérv, térdfájdalom, ízületi fájdalom? Meglepő fájdalomcsillapító tapasztalatok egy 7 perces VIDEÓban! 4 ember mondja el tapasztalatait és azt, hogy pontosan mit csinált!


Feladva: 2015-12-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Gerincsérvizületitapasztalataitporckorongsérvmondjahátfájás33580emberisiász4124VIDEÓbanlumbágóclikapercderékfájáshttptapasztalatokcsináltMarcsi

Forrás: pepitahirdeto.multiapro.com

Új lakásba, házba költözni nagy öröm, még akkor is, ha csak nekünk új az ingatlan... Díszítse, dekorálja egyéni módon lakását vagy házát! Ha nincs ötlet, elképzelés, mi segítünk! Esetleg a hálószobában egy közös emlékeket idéző falmatrica. Vagy egy gravírozott kávéscsésze vagy müzlis tál, esetleg két - vagy több - névvel ellátott borospohár. Keressen minket és mi megoldjuk!


Feladva: 2016-11-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: vagyesetlegegyidéződekortöbbemlékeketlakasközöshttpkéthálószobábanZamárdisegítünkPétertálajándékozzmegoldjukBuzásmüzlismitminketötleted

Forrás: pepitahirdeto.multiapro.com

Megrendelőinknek díjmentes lakberendezési tanácsadás. Színvonalas választék, díjmentes felmérés. Költözik, tanácstalan? Enteriőr tervezés! Főbb területeink: - - Bútorszövet - Tapéta - Karnis - Függöny


Feladva: 2017-05-22    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: FüggönydíjmentesTapétaBútorszövettervezésajánlóEnteriőrHirdetőtanácstalanPepitaKöltözikotthonábafelmérésviszünkStílustKarnisválasztékSzínvonalas

Forrás: pepitahirdeto.multiapro.com

Még mindig a leghatékonyabb módja a dohányzás leszoktatásnak a biorezonanciás kezelés. Kínlódás, és elvonási tünetek nélkül. A biorezonanciás kezeléssel megszűnik a nikotin éhség. Stresszoldást és általános méregtelenítést is adunk,a tartós eredmény érdekében. A rögzült szokások oldását életmód tanácsokkal segítjük. A kezelés személyre szabott, kérjük hozza el magával az utolsó szál, félig elszívott, majd eloltott cigarettáját. Időpont egyeztetésre hívjon a megadott telefonon.


Feladva: 2017-05-19    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kezelésMégbiorezonanciáskérjükDebreceneredményIdőpontnélkülszabott06309074786tartóscigarettájáttünetekszemélyrecigarettátóladunkeloltottelvonási

Forrás: pepitahirdeto.multiapro.com

Nagy lépés ez egy embernek, és még nagyobb az emberiségnek! Megtakarítások nélküli probléma megoldás! Sok család eddig azért nem tudta megoldani nagy kiadásokkal járó problémáit, mert a bevételből nem tudott megtakarítani ezek érdekében! Ennek a korszaknak vége, most már nincs akadálya annak, hogy minden tervét megvalósíthassa! A „Jövőképem a Létem” Támogató rendszer többek között lehetőséget nyújt: Családi ház, nyugdíj, Gépjármű vásárlás, Áram és gázszámla megszüntetése, ... további részletek >>

Gyermeke magas szintű oktatása, Családja anyagi jóléte, utazások, hobby, karitatív tevékenység, egyéb álmok, célok megvalósítására! A „Jövőképem a Létem” Támogató rendszer célja, hogy megszüntessük Magyarországon a szegénységet, hogy ne kelljen családoknak szétválniuk külföldi munkavállalás miatt, hogy a családok életszínvonalát jelentősen növeljük annak érdekében, hogy a jelen és a jövő generációja már egy sokkal jobb világban élhessen! Úgy oldhatja meg a jövőben felmerülő jelentős összegű anyagi kiadásait, hogy nincs szüksége havi rendszeres megtakarításokra! Jövőkép Programunk tökéletes megoldás arra, hogy akár már 2-3 év alatt megoldhassa az igényeihez szükséges anyagi hátteret! Mivel Önnek garantáltan ez egy fillér költségébe sem kerül, és a programot követve garantáltam megoldhatja a jövőben felmerülő jelentős anyagi kiadásokkal járó problémáit, ezért jelentkezzen bátran, mert kizárólag csak nyerhet a Tökéletes Támogató rendszerünkkel! rozsabusiness@gmail.com


Feladva: 2017-04-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyanyagiTámogatómáregymegoldásproblémanélkülinemMegtakarításokproblémáitrendszerjáró8221nagykiadásokkalLétemTökéletesnincsJövőképemjelentős

Forrás: pepitahirdeto.multiapro.com

Használt üzletberendezések eladók. Fali elem: 21.500.-/fm Gondola: 32.000.-/fm Szigetszentmiklósi raktárkészletről. Érd: 06-70-528-1162 ; 06-70-775-5205 Email: i roda@polcozzunk.eu


Feladva: 2017-07-04    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: raktárkészletrőlPolcozzunkSzigetszentmiklósiüzletberendezés000PolcrendszerGondolairoda@polcozzunk500Emailelem5205Fali775eladók1162üzletberendezések

Forrás: pepitahirdeto.multiapro.com

Otthonról végezhető munkára keresek 5 főt Betterware csapatomba! Komoly gondolkodású,kitartó munkatársak jelentkezését várom. - Ha elmúltál 18 éves, - Jól kezeled a számítógépet, - Szeretnél plusz jövedelmet, - Dolgoznál is érte Írj és megbeszéljük. :)


Feladva: 2017-05-03    [Pénzkeresés - MLM]

Címkék, kulcsszavak: OtthonrólgondolkodásúVelemSzeretnélKomolyDolgozzszámítógépetcsapatombakezeledBetterwareJólfőtéveskeresekmegbeszéljükelmúltálmunkáraÍrjváromérte

Forrás: pepitahirdeto.multiapro.com

Bízza profikra a munkát! Hivatalos okiratok, szerződések cégpapírok hitelesített fordítása. Jogi fordítás · Keresztnyelves fordítás · Szakfordítás · Fordítás Kérjen árajánlatot!


Feladva: 2017-07-13    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: Fordítás183szerződésekárajánlatotokiratokKérjenHivatalosmunkátprofikraSzakfordításBízzaKeresztnyelvesajánlóJogiHirdetőfordításaPepitahitelesített

Forrás: pepitahirdeto.multiapro.com

Területi Igazgatókat Keresünk! Közép-Európa (Magyarország, Ausztria, Románia, Szlovákia, Ukrajna, Szerbia, Szlovénia, Horvátország, Csehország) területéről keresünk vállalkozókat, vállalkozásokat az Intercontact Marketing Network Kft. információs rendszerének további kiszélesítésére és szervezői munkáira. Amit kínálunk: Eredményes próbaidő után kizárólagos területi képviseleti jogot adunk. Bérezés, juttatások: Kiemelkedően magas jutalékot biztosítunk. Akiket keresünk: Elsősorban ... további részletek >>

azok jelentkezését várjuk, akik kapcsolatban állnak az ipar, a mezőgazdaság, a kereskedelem és a szolgáltatás ágazataiban tevékenykedő vállalatokkal, cégekkel, vállalkozásokkal. Főbb területek: Árualap és szabad gyártói kapacitás felkutatása, nemzetközi anyagos és bérmunka kihelyezése. Főleg a fémipar - faipar - építőipar - élelmiszeripar gyártói kapacitás lekötés, valamint a beruházás, export-import, projekt finanszírozás, vegyesvállalat alapítás profiljában vagyunk érdekeltek. Elvárások: Maximális megbízhatóság és szorgalom. Előnyt jelent már meglévő közép - nagyvállalati ügyfélkör, de nem alap elvárás. Fő célunk: Minél több gazdasági, üzleti információt biztosítani, üzleteket létrehozni a magyar gazdaság szereplői számára. Az üzleti lehetőségek, megrendelés, befektetés, ingatlan és cég adás-vétel üzleti ajánlatok ismertetése. Tevékenységünk: Külföldi üzleti partnerközvetítés, nemzetközi gazdasági stabil üzleti kapcsolatok, folyamatos megrendelések létrehozása. Kiemelten fontos tevékenységünk a magyar áruk és termékek külpiaci bevezetése, külföldi piackutatás. Feladat: Piacképes magyar gyártók és árualapok felkutatása. Nagyon sok esetben konkrét minták és műszaki dokumentációk is rendelkezésünkre állnak. Elsősorban profi és minőségi szinten lévő, komoly munkákra képes üzletembereket, cégeket keresünk. Jelentkezés: Még ma jelentkezzen ! Csatlakozzon hozzánk ! Várjuk megbízható, profi üzletemberek, cégek, vállalkozások jelentkezését ! Legyen Ön is egy 27 éve sikeresen működő cég munkatársa! Részletesebben: www.intercontact.hu/kepvis/kepvis1.html További információ: Tel: +36 30 449 7559 imn@t-online.hu


Feladva: 2017-04-17    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: üzletiintercontactkeresünkmagyarkapacitásközépprofigyártóicégwwwVárjukkülföldihttpterületigazdaságifelkutatásaElsősorbannemzetközijelentkezését

Forrás: pepitahirdeto.multiapro.com

Az MS-METAL KFT. tevékenysége közé tartozik különböző acéltermékek, fémtömegcikkek gyártása, valamint ezen termékek értékesítése. Megrendelőink igényei alapján gyártunk különböző stancolt, hajlított vagy görgőzött, hegesztett lemezalkatrészeket, különböző polcokat, polcszerkezeteket, állványszerkezeteket, fali síneket, fali tartókarokat, valamint raktártechnikai elemeket és egyedi acéltermékeket. A gyártott termékek vasfoszfátos alapozással, elektrosztatikus vagy tribosztatikus porlakk ... további részletek >>

bevonattal készülnek. Termékeink segítségével minden tárolási probléma gyorsan és egyénileg megoldható. Tevékenységünk közé tartozik az álmennyezeti elemek gyártása és értékesítése, mely mind beltéren, mind kültéren használható. A méretválasztékból a kombinációs lehetőségeket kihasználva minden igényt kielégítő polcrendszer állítható össze, legyen az irodában, lakószobában, gyerekszobában, kamrában, garázsban. Ha vásárolni szeretne, válasszon webshopjaink közül!


Feladva: 2016-12-31    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: mindenkülönbözőközévalamintvagymindfaliértékesítésetermékekgyártásatartozikelemeketpolcszerkezetméretválasztékbólhegesztettporlakktevékenységePolc

Forrás: pepitahirdeto.multiapro.com

Original Hobbit Hole Egyedi játszóházak a gyártótól! 200 x 270 cm alapterületű platform. Belmagassága 150 cm, nyitható ajtóval és ablakkal. Natúr kivitelben: 190.000 Ft Zsindely fedés: 40.000 Ft Csúszda indító platform, feljárattal: 30.000 Ft 3 m-es csúszda: 25.000 Ft A szállítás, szerelés, rögzítés, festés plusz költség!


Feladva: 2016-12-20    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: 000platformHobbitcsúszdaalapterületűköltségajánlófedés270pluszHirdetőZsindely200festésPepita190gyártótólrögzítésjátékkivitelbenjátszóházak

Forrás: pepitahirdeto.multiapro.com

Chrysler Voyager sok féle megmaradt alkatrészei olcsón eladók! Magánszemélytől!


Feladva: 2018-01-05    [Autó - Motor - Jármű]

Címkék, kulcsszavak: VoyagerChryslereladókalkatrészeimegmaradtfélesokpaulMagánszemélytőlolcsón

Forrás: pepitahirdeto.multiapro.com

Siófoki Aranyparton apartmanok szabad strand mellett kiadók. Földszinti 3 szobás,fürdőszobás, konyhával nappalival, Tv, hűtő, kertkapcsolatos apartman 4-5-6 főnek. emeleti 1 szobás fürdőszobás, tv. hűtő felszereltséggel. Ebből 2 db van. Szép kártyát elfogadunk. Légkondi igényelhető térítés ellenében. Bővebben: gosyapartmanok.info


Feladva: 2016-09-29    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: hűtőfürdőszobásszobásapartmanokSiófokiBővebbenvízpartimellettellenébenstrandtérítésszabadigényelhetőemeletiLégkondifőnekAranypartonelfogadunkSzép

Forrás: pepitahirdeto.multiapro.com

Látogasson el hozzánk, ha különleges alkalomra való gyertyát keres! Akár belföldről, akár külföldről érkező igény esetén -nagy volumenű munkák tekintetében - alvállalkozóként is szívesen közreműködünk! Legyen szó akár rusztikus, akár adventi gyertya, vagy egyéb más gyertya készítésről, szívesen várjuk megkeresését! Örömünkre szolgál, hogy olyan termékek, gyertyák gyártását végezzük, melyek a hangulatteremtés szimbólumai!


Feladva: 2017-03-28    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: adventigyertyaBarbaraKismindenes

Forrás: pepitahirdeto.multiapro.com

Asztali sörcsapolók, hogy mindig legyen hideg sör a vendég előtt! Kell-e bármit még mondani ahhoz, hogy ellátogasson a honlapunkra?


Feladva: 2017-07-15    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hogysörcsapolókAsztalimégDebrecenbármitajánlóKellHirdetőelőttPepitavendégsörhonlapunkrahidegellátogassonlegyenmindigahhozmondani

Forrás: pepitahirdeto.multiapro.com

Sport HD kamera nem csak mindenféle sport események rögzítésére alkalmas, de lehet csatlakoztatni egy autóba, egy motorra, stb tartalmaz a sokféle tartót a csomag, hogy csatolja a kamerát könnyen mindenféle helyre. Tartalmaz egy vízálló tokot is a csomag. Kamera kijelzője 2” és a tömege a kamerának akkumulátor nélkül csak 46 gramm. www.elektronikai-webshop.hu/hu/spo rt-akcio-kamerak/30-sport-kamera-er intokepernyos-hd-720p.html


Feladva: 2017-10-14    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: sportkameraegycsakTartalmaz720perintokepernyosmindenfélecsomaghtmlmotorraautóbanélkülhelyrecsatlakoztatniakkumulátorlehetkameránakkönnyentömege

Forrás: pepitahirdeto.multiapro.com

A megbízható méhpempő boltok közös jellemzője, hogy feldolgozás nélküli étrendkiegészítőket lehet tőlük vásárolni. Ez azt jelenti, hogy a többszörösen is ellenőrzött méhészeti termék semmilyen vegyi vagy fizikai eljáráson nem esik át, míg a fogyasztóhoz kerül. Eredeti, 100%-ban természetes formájában fogyasztható, ahogyan a méhek előállították! A megbízható méhpempő boltok kínálatában tehát a legjobb minőséget találja! Ezen webshopokat egy helyre gyűjtöttük össze, weboldalunkra kattintva ... további részletek >>

könnyedén válogathat termékkínálatukban! Valódi méhpempő rendelés, megbízható boltokból!


Feladva: 2017-08-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: megbízhatóméhpempőboltokbólrendeléshogyValódiboltokfogyasztóhozgyűjtöttükellenőrzöttelőállítottákjellemzőjemíghelyretöbbszörösenméhekközösesikegy

Forrás: pepitahirdeto.multiapro.com

Honlap készítés Bemutatkozó honlap készítés Az internetes jelenlét egy cég számára elengedhetetlen manapság. Miért ne használná ki ezt a lehetőséget, aminek segítségével még több ügyfelet szerezhet? A bemutatkozó honlap potenciális lehetőséget ad, hogy vállalkozása jelen legyen az internet világában, így bárki számára megismerhető és elérhető lesz. A bemutatkozó honlap célja az, hogy minél többet megtudjon az érdeklődő a cégéről és tevékenységéről. A honlapnak a legfőbb célja hogy ... további részletek >>

meggyőzze a látogatókat arról, hogy valós megoldásokat találhat Önnél. A honlap elkészítési ára 40.000 Ft Ha nincs még tárhelye és domain neve, akkor intézzük teljeskörűen az igénylést és a regisztrációt. Ennek költsége bruttó 15.000 Ft / év. Mit tartalmaz a szolgáltatás? Képernyőhöz igazodó honlapot - responsív nézet Egy főoldalt max. 3-4 aloldalt – bemutatkozásnak, termék és szolgáltatás ismertetéséhez kapcsolati oldalt űrlappal galériát MIÉRT ÉRDEMES NÁLUNK TERVEZTETNI ANYAGAIT? Több, mint 15 éve tervezünk a hazai és a külföldi ügyfeleinknek. Precíz és kimagasló minőségű munkák kerülnek ki a kezünkből. Tervezésünk változatos és letisztult stílusú. Szakmai fejlődésünk folyamatos. Érdeklődni: info@emblemakeszites.hu címen


Feladva: 2018-01-02    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: honlaphogybemutatkozókészítésTöbbszámáraszolgáltatás000MIÉRTmégEgylehetőségetcéljacímenismertetéséhezszerezhetkerülnekhonlapothonlapnakÖnnél

Forrás: pepitahirdeto.multiapro.com

Rongyszőnyegek: A másra már nem használható, nagyobb darab farmeranyagokból készítjük. A rongyszőnyegek általában a kék különböző árnyalataiban készülnek, de gyártunk fekete, szürke, ritkábban barna színekben is. Az összes rongyszőnyegünk kézi szövésű. 70 cm szélesek és 70 cm-től 6 méteresig mindenféle méretben gyártjuk. Kérésre egyedi méretekben is! Kreatív szőnyegek: Ezeket a szőnyegeinket a farmernadrágok zsebeiből, ülepéből, övrészéből, stb készítjük. Kézzel varrottak, ezért az összes ... további részletek >>

darab teljesen egyedi. A gyakoribb méreteken kívül, megrendelésre egyéb méretekben is elkészítjük őket. Nézze meg a szőnyegeinket! www.oldblue.hu/index.php/szonyegek


Feladva: 2017-04-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: rongyszőnyegekszonyegekszőnyegeinketegyedidarabösszesKreatívméretekbenkészítjükstbnemoldblueméteresigméretekengyártunkövrészébőlmárwwwtőlmásra

Forrás: pepitahirdeto.multiapro.com

Rendelhető !!!!!!! ZEITGARD 1 arctisztító készülék a ragyogóan tiszta bőrért Zeitgard Discover Az arctisztítás új dimenziója Tiszta és ragyogó bőr elérése a ZEITGARD 1 arctisztító készülék segítségével. Az innovatív elektromos arctisztító kefe forradalmasítja a hagyományos arctisztítást. 10-szer hatékonyabban távolítja el a sminket és a szennyeződéseket anélkül, hogy a bőrt túlzottan igénybe venné. Egyedülálló higiénia A kefeszálakban található MicroSilver BG™ antibakteriális ... további részletek >>

hatóanyag biztosítja a higiénikus használatot. A MicroSilver BG™ védőpajzsként működik: elpusztítja a bőrről a kefeszálakra átkerülő baktériumokat, és megakadályozza az újraképződésüket. A bőrtisztítás új dimenziója Az innovatív ZEITGARD 1 arctisztító készülék forradalmasítja a hagyományos arctisztítást. Egyszerre hatékony és kíméletes a bőrhöz. Az elektromos arctisztító készülék és a kifejezetten hozzá kifejlesztett arctisztító készítmény láthatatlan hálót képez a bőrön, melynek segítségével a bőrön található szennyeződéseket eltávolítja. Használatukkal bőröd felkészíted az arcápolás további lépéseire. A bőr finom lesz, simább és ragyogó. Innovatív Zeitgard Innovative Principle ZEITGARD 1 arctisztító készülék A ZEITGARD arctisztító rendszert a legapróbb részletekig átgondoltuk: az oszcilláló mozgású kefe még a pórusok mélyén található szennyeződéseket is eltávolítja. A speciálisan a keféhez kifejlesztett arctisztító készítmények textúráját pedig úgy alakítottuk ki, hogy könnyedén eltávolítsa a bőr felső, elhalt hámrétegeit is. Az eredmény láthatóan tiszta és ragyogó bőr. Az arctisztító készülék keféjében rejlik az egyedisége Az egyedileg kidolgozott, legömbölyített végű kefeszálaknak köszönhetően lágyan tisztítja a bőrt. A kefe fejének 7.000 rezgés/perces sebessége gondoskodik az alapos tisztításról, ami lehetővé teszi a szennyeződések és a smink eltávolítását az arcbőrről. Tiszta és ragyogó arcbőrt eredményez. Tapasztald meg te magad! Könnyű használni Zeitgard Application Sugárzóan tiszta bőr 1 perc alatt? Bőrgyógyászatilag igazolt: a bőrgyógyászati vizsgálatok azt bizonyítják, hogy a ZEITGARD 1 arctisztító készülékkel 10-szer hatékonyabb az arctisztítás, összehasonlítva a hagyományos kézi tisztítással. Tisztítsd az arcbőr különböző területeit (homlok, orr, arc mindkét oldala, áll) körülbelül 20 másodpercig területenként. Bőröd olyan tapintású lesz, mint egy alapos krémezés után. Hatékony ápolás Ragyogó arcbőr 1 perc alatt. Használd naponta 1 percig a gyorsan látható eredmény érdekében. A ZEITGARD 1 arctisztító készülék és a ZEITGARD arctisztító készítmények tökéletesen kiegészítik egymást. Látható eredmény Javítja a bőr állapotát a mélytisztítás eredményeképpen Hatékonyabb felkészülés az arcápolás további lépéseire Ragyogóbb arcszín a bőr élénkebb mikrokeringésének köszönhetően Feszesebb, simább bőr


Feladva: 2016-10-23    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: arctisztítóZEITGARDbőrkészülékRagyogótisztakefehogytalálhatóeredményhagyományosszennyeződéseketInnovatívarctisztításdimenziója8482alattszerlesz

Forrás: pepitahirdeto.multiapro.com

Minden típusú hőlégfúvó, bármilyen gyártmányú hőlégfúvó és mindenfajta fűtőanyagú hőlégfúvó javítása. Olcsó hőlégfúvót keres? www.olcso.holegfuvok.com


Feladva: 2015-05-06    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: hőlégfúvómindenfajtacomgyártmányúholegfuvokbármilyenolcsotípusúwwwMindenkeresHalásztelekhőlégfúvótszervizOlcsójavításafűtőanyagú

Forrás: pepitahirdeto.multiapro.com

Magyarországon létrejött az Organikus Üzleti Közösség a Sunmoney napenergia program. Egy Nemzetközi naperőmű hálózatban vásárolhatunk teljesítményt, ami után 25 éven keresztül passzív jövedelemre tehetsz szert. Megvásárolt teljesítmény után évi 7,6%-7,8%-ra tehetsz szert. Disztribútorként további jutalékokra is szert tehetsz!


Feladva: 2017-11-18    [Pénzkeresés - MLM]

Címkék, kulcsszavak: tehetszszertutánDöbröcelétrejöttévihálózatbanMagyarországonnaperőműteljesítményNemzetköziJózsefMegvásároltEgySzmatonajövedelemreprogrampasszívami

Forrás: pepitahirdeto.multiapro.com

Rejtett Kamerák raktárról otthoni és ipari használatra is! www.kameradepo.hu/komplett-rejtett -kamera-rendszer


Feladva: 2017-06-14    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: RejtettBudapestKameradepokészletünketóriásimeghasználatraNézzeipari8211otthoniKamerarendszerekraktárrólKamerák

Forrás: pepitahirdeto.multiapro.com

Profi Őrzés Többéves szakmai tapasztalattal, jól képzett szakemberekkel. Biztonságtechnika · Magánnyomozás · Komplex biztonságtechnika · Őrzés-védelem A Justice Security olyan tanácsadó és szolgáltató vagyonvédelmi cég, mely igyekszik teljes körű szolgáltatást nyújtani, ha vagyonvédelemről van szó.


Feladva: 2017-07-14    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: Őrzés183szakmaibiztonságtechnikacégszódíjnyertesszolgáltatószakemberekkelvantanácsadóképzettvagyonvédelemrőlolyanjólnyújtaniSecuritytapasztalattal

Forrás: pepitahirdeto.multiapro.com

ALOE VERA BABAÁPOLÁS! A szett tartalma: - Aloe Vera baba arc és testápoló érzékeny bőrre - 100 ml - Aloe Vera habfürdő és sampon érzékeny bőrre - 250 ml - Aloe Vera baba krém érzékeny bőrre - 100 ml A három termék együtt: 7990 Ft A babák és a gyerekek gyengéd bőre nagyon érzékeny, hiszen még fejlődik! Ahhoz, hogy megfelelően védjük, fontos az alapos ápolás. A termékcsalád ápoló termékei 40%, a tisztító termékei pedig 30% aloe verát tartalmaznak. Kíméletesen ápolják az érzékeny ... további részletek >>

bőrt. A bio calendula kivonat regenerálja és védi a bőrt. A bőrbarát termékek nem tartalmaznak parabént és ásványi olajokat. Védik a bőrt a kiszáradással szemben, hiszen elegendő nedvességgel látják el. A mamák teljes körű ápolására is gondolva: a termékcsalád egy masszázs balzsamot is tartalmaz, melyet az anyukák terhességtől megviselt bőrére lett kifejlesztetve. A balzsam ideálisan ápol és támogatja a bőr rugalmasságát. A babák bőrén is használható!


Feladva: 2017-11-22    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: aloeveraérzékenybabacalendulaBABAÁPOLÁStermékcsaládbőrrebőrtbabáktartalmaznakmelyetbőrmártermékeihiszen100ápolókrémelterjedtfejlesztettünk

Forrás: pepitahirdeto.multiapro.com

Álmait megvalósítjuk, otthonát hangulatosabbá tesszük, komplett szolgáltatást nyújtunk. Egyéni megrendelők és közületek számára egyaránt a klasszikus megoldásoktól a modern stílusig. Minőségi munkát, minőségi szolgáltatást végzünk, korrekt áron. Szolgáltatásaink: függönyvarrás, drapériák, ágytakarók készítése, római roló és lapfüggöny készítése, függönytisztítás. Varrodánkban textilválasztás is lehetséges!


Feladva: 2016-07-24    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: függönyvarráskészítéseszolgáltatástminőségistílusigtesszükágytakarókmodernhangulatosabbádrapériákmegoldásoktólotthonátklasszikuslehetségesmegvalósítjuk

Forrás: pepitahirdeto.multiapro.com

Továbbá gyártunk különböző méretű, huzalvastagságú horganyzott és műanyagos drótfonat, vadvédelmi háló, vadháló, tüskéshuzal, tüskésdrót, szögesdrót, vezérdrót, kerítés háló, kerítésháló, feszítőhuzal, feszítő huzal, kerítésdrót, tüskés szöges vezér drót, vadkerítés, kerítés építés, kerítésépítés, kerítésfonat ,kiskapu, nagykapu, huzalfeszítő csavar, vibropréselt zsalukő, lábazati elem, fémoszlop, faoszlop, natodrót nato drót, fém fa beton kerítés oszlop, kerítéspanel, kerítéselem, kutyakennel, ... további részletek >>

drótháló, drótkerítés, kis nagy vas kapu, kutya kennel, szőlőoszlop, kerítésoszlop, betonoszlop, kutya kenel, szőlőkaró, kutyakenel, szőlő oszlop karó. Vállalunk az ország egész területén vadhálóval, vagy dróthálóval komplett kerítésépítést 1000 Ft/m áron. (Csak drótkerítéseket és vadvédelmi kerítéseket építünk, fakerítést nem!!!)Rengeteg terméket gyártunk és forgalmazunk a kerítésdróton és betonoszlopokon kívül, amit egy hirdetésben nehéz lenne felsorolni, ezért kérem, látogasson el honlapunkra www.kerites.hupont.hu oldalra, vagy telephelyünkre, a KÓTAJI DRÓTFONAT, VADHÁLÓ és BETONOSZLOP CENTRUMBA ahol személyesen akár további kedvezményekre is van lehetőség.


Feladva: 2017-05-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keriteswwwvadvédelmibetonBETONOSZLOPdrótVADHÁLÓDRÓTFONAToszlopgyártunkhálóvagyhupontkutyakerítéseketkerítéspaneltüskéshuzalaholegészkívülfém

Forrás: pepitahirdeto.multiapro.com

Pihenjen, üdüljön, kapcsolódjon ki nálunk és szülessen újjá a helyi Zsóry Gyógy-és Strandfürdőben, ami a szó szoros értelmében egy kőhajintásnyira van a Csilike apartmantól. Akcióinkról tájékozódjon a weboldalunkról: www.csilikeapartman.hu


Feladva: 2017-02-28    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: CsilikeáronkőhajintásnyiraszülessenjótegynálunkcsilikeapartmannyáronértelmébenkapcsolódjonwwwTélenszorosüdüljönhttpszóPihenjenweboldalunkrólami

Forrás: pepitahirdeto.multiapro.com

Parkolási megoldás, Parkolóházi parkolás, az Erzsébet krt, József krt, Rákóczi út találkozásánál, a Blahánál, az Akácfa utcában 1072. Budapest, Akácfa utca 12-14 EZ Akácfa Parkolóházban Parkolásért már nem érdemes aggódni. Alkalmi óradíjas parkolás 220 Ft/ fél óránként, Napidíjas Parkolás kedvezményesen, 24 órára elővételben. Parkolóházi havi bérletek 15 960 Ft-tól www.ezpark.hu/parkolohazak/akacfa- parkolo


Feladva: 2017-01-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: AkácfaParkoláskrtBudapestParkolóházParkolóházióráranemRákóczikedvezményesenmárParkolásértJózsefNapidíjasParkolóházbanErzsébetóránkénttólmegoldás

Forrás: pepitahirdeto.multiapro.com

IFETCH - az igazi szórakozás Önnek és kutyájának! Újdonság a kutyajátékok piacán!! www.petsafe.hu/hu/ifetch-labdakilo vo/444-ifetch-labdakilovo-kutyaknak .html


Feladva: 2016-01-05    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: ifetchkutyajátékokÚjdonságkutyájánakhtmlÖnnekkutyaknakszórakozáslabdakilovigaziPápa418KftpetsafeTradinghttpWilsonpiacánkutyajáték

Forrás: pepitahirdeto.multiapro.com

Támogassa a koraszülött babák ellátását adója 1 százalékával! Miért minket támogasson? Köszönjük, ha elolvassa: www.anokert.hu/ado-1


Feladva: 2017-09-27    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: adobabákanokertkoraszülöttwwwTámogassaelolvassaajánlóKöszönjükHirdetőtámogassonPepitaminket8206MiértBabákértszázalékávalSzázalékadójaAdó

Forrás: pepitahirdeto.multiapro.com

Nyilván keresett, hiszen ha valaki valamit keres az interneten, akkor ahhoz a döntő többséghez tartozik akik a Google-val keresnek... Európában az emberek 97%-a! Érthető, hogy akik érdekeltek az internetes kereskedelemben, vagy egyéb értékes információk megjelentetésében, azok tesznek azért, hogy a különböző szavak, kifejezések keresésénél előlelő helyen legyenek a találatok között... És ha már megjelennének a keresés begépelése közben, az még előrébb helyezné őket? Hát persze! ... további részletek >>

Sokaknak sokkal vonzóbb a kattintási lehetőség képes ajánlatra, még ha a keresés közbeni legördülő Google ajánláson jelenik is meg! Nálunk elérhető ez a szolgáltatás... Lehet bármilyen tetszőleges internetes tartalomra mutató link: - weboldalak bármely oldala - közösségi oldal nyilvános tartalma (Facebook, Google+, Twitter, stb...) - webcímmel rendelkező PDF fájl Mivel a Pepita Hirdető keresője - kevés kivétellel - minden webhelyünkön megtalálható, ezért jóval több, mint egy hirdetés... Alább az Írjon nekünk! menü linkje látható, ha érdekelné... www.pepitahirdeto.multiapro.com/apro.php?page_id=21471


Feladva: 2017-06-12    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: GooglemegvalamitinternetesHirdetőkeresettPepitakereséshogyakikmárkivételleljeleniktesznekTwitterSokaknakemberekAlábbmutatótalálatokkevésHát

Forrás: pepitahirdeto.multiapro.com

Otthonról is végezhető munkát keresel, de nem tudod fog-e menni? Egy hónap elég lenne, hogy kipróbáld magad? Mit szólnál egy harminc napos ingyenes próbához? Ráadásul egy automata eszköz elvégzi a munka nehezét helyetted. Megkeresi azokat, akiket érdekel az ajánlatod, és bemutatja nekik. Ne töprengj, hanem vágj bele most azonnal. Csatlakozz, és már kezdheted is. Még regisztrációs díjat sem kell fizetned. A cég napi fogyasztási cikkekkel foglalkozik, tehát biztos a kereslet. A jutalékod miatt ... további részletek >>

sem kell aggódnod, mert megkapod forintban. A videókból mindent megtudhatsz. Mutasd meg ismerőseidnek, milyen remek lehetőséget találtál, még mielőtt ők mutatják neked ugyanezt. Katt ide és nézd meg a videókat! => http://bit.ly/tesikered


Feladva: 2017-11-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: megegyautomatakellsemjutalékodeszközKattregisztrációskipróbáldmegtudhatszbemutatjavégezhetőkeresletugyaneztkezdhetedhogymindentajánlatodbiztos

Forrás: pepitahirdeto.multiapro.com

Bútorrestaurálás, asztalos és kárpitos munkák, galéria, egyedi bútorok és kópiák készítése. Bútorfényezés politúrral és lakkokkal, viaszokkal. Antik bútorok restaurálása, bútorjavítás és bútor készítés hagyományos és új módszerekkel. Bútorfényezés sellakpolitúrral, különböző viaszokkal és lakkokkal, intarzia, fafaragás készítés és javítás. Kárpitos bútorok restaurálása szerkezeti javítással, rugózat újra építésével, afrik és vattatöméssel, újabb garnitúrák, ágyak, heverők székek áthúzása.


Feladva: 2016-02-03    [Régiség - Művészet]

Címkék, kulcsszavak: bútorokKárpitosBútorfényezésasztaloskészítéslakkokkalviaszokkalrestaurálásaágyakmunkákmódszerekkelgarnitúrákhagyományosújabbBútorrestaurálásjavítás

Forrás: pepitahirdeto.multiapro.com

Szeptemberben indult az ATV-n a Húzós ötödik évada Rónai Egonnal, és most itt van a korábbi adásokból összeállított ötödik Húzós-könyv! Legalább olyan izgalmas, tanulságos és szórakoztató olvasmány, mint a korábbiak. A paletta is rendkívül színes, „megszólal” benne csillagász, filmrendező, író, orvosprofesszor, politikus, sportoló, színész, rádiós és televíziós műsorvezető, üzletember, valamint zenész. Kedves Olvasó, jó szórakozást! Kedvezményesen megvásárolható: ... további részletek >>


Feladva: 2017-11-28    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: HúzósRónaiötödikegonhuzostanulságosműsorvezetőitt8221szazadkiadoizgalmastelevíziósmostmegszólalwwwolyanrádiósEgonnal8222megvásárolhatószínész

Forrás: pepitahirdeto.multiapro.com

Selyemvirágokat, műnövényeket rendeljen a Zöldvilág Webáruházban! Most az ősz színeiből is tud válogatni.


Feladva: 2017-09-26    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: SelyemvirágZöldvilágGyőrválogatniWebáruháztudNagykereskedésszíneibőlőszműnövényMostWebáruházbanrendeljenműnövényeketSelyemvirágokat

Forrás: pepitahirdeto.multiapro.com

Minőségi divatos ékszerek karórák a Lili Ékszer Webáruházban hatalmas kedvezménnyel


Feladva: 2017-12-03    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: hatalmasÉkszerLilikedvezményekkelkedvezménnyelDivatékszerekWebáruházbankarórákékszerekdivatosMinőségiWEBÁRUHÁZ

Forrás: pepitahirdeto.multiapro.com

Golosi Kitten speciális táp a kiscicák számára, 1 hónapos kortól 1 éves korig. Ebben az életszakaszban könnyű, mégis gazdag beltartalmú táplálékra van szükség, mely elősegíti a fiatal kismacska kiegyensúlyozott, egészséges fejlődését. A könnyen emészthető csirkehús olyan fehérjeforrás, mely nagy mennyiségben tartalmazza a növekedéshez elengedhetetlenül fontos aminosavakat. A frukto-oligoszacharid (FOS) tartalmú prebiotikumok elősegítik a tápanyagok megfelelő felszívódását, mivel egészséges ... további részletek >>

táptalajt biztosítanak a bélflórának. Ugyanakkor a krokett forma a kiscica igényeinek megfelelően lett kialakítva, elősegítve ezzel a rágást. Teljes értékű állateledel csirkével és rizzsel kiscicáknak 1 hónapos kortól 12 hónapos korig. www.golosipetfood.hu/katalogus/macska/golosi-kitten


Feladva: 2017-07-01    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: golosikittenhónaposkortólmelykorigegészségesajánlóaminosavakatemészthetőlettgazdagmivelHirdetőkiscicáknakfontoskönnyenmegfelelőenmégisPepita

Forrás: pepitahirdeto.multiapro.com

Táplálékunk az egészségünk! Túlszennyezett világunkban rengeteg káros anyag halmozódik fel bennünk, ezért fontos a szervezetünk megtisztítása, és az ételeink megtisztítása is! Ehhez nyújt segítséget e készülék, mely ózonnal (O3) kitisztítja a zöldségekbe, gyümölcsökbe felhalmozódott vegyszer, rovarölő-szer maradványokat. A húsokból és halakból a hormon és egyéb maradványokat. De fertőtleníthetjük lakásunkat, autónkat a különböző gombáktól, baktériumoktól is. Igazi természetes fertőtlenítő! ... további részletek >>


Feladva: 2014-10-23    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: megtisztításamaradványokatfertőtlenítőkészülékvegyszerautónkatvilágunkbanfelhalmozódottételeinklakásunkatTúlszennyezettgyümölcsökbeszervezetünkegészségünk

Forrás: pepitahirdeto.multiapro.com

Ingatlan értékbecslés az Ön településén is, független értékbecslőktől. Hivatalos és magán ügyben egyaránt. Bírósági - Adóhatósági - hagyatéki - vagyonmegosztási - válási és bármilyen más ügyben. Keressen bennünket + 36702408616 telefonszámunkon, vagy írjon a info@ertekbecslot.hu címünkre. Olcsón - gyorsan és szakszerűen készítjük el megrendelt értékbecslését. www.ertekbecslot.hu/bemutatkozunk. html


Feladva: 2017-12-01    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ügybenfüggetlenértékbecslésIngatlanírjonhagyatékiertekbecslotBudapestvagyAdóhatóságiwwwirodatelefonszámunkonBíróságiértékbecslésétÉrtékbecslőegyaránt

Forrás: pepitahirdeto.multiapro.com

A bio gránátalma segít legyőzni a baktériumokat, gombákat, vírusokat, miközben erős antioxidánsaival fiatalon tartja a szervezetet. Szabadgyökfogó képesség tekintetében túltesz a zöld teán és az áfonya levén is! A gránátalma a legbőségesebb ellagsav forrás, aminek óriási szerepe van a rák megelőzésében. Antikarcinogén hatású, ahogyan azt számos vizsgálattal bizonyították az elmúlt években. Az immunerősítés gránátalmával igen hatékonyan megoldható, hiszen legalább 3 féle antioxidáns, rengeteg ... további részletek >>

vitamin és rost található benne, ezeknek pedig mind szerepük van a védekezőképesség működésében. Bio gránátalma vásárlás itt!


Feladva: 2017-03-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: gránátalmaBiovanvásárlásantioxidánsképességbizonyítottáklegyőzniaminekféleSzabadgyökfogóvizsgálattalsegítszerepükforráslegalábbszervezetetszámos

Forrás: pepitahirdeto.multiapro.com

Azok számára állítottuk össze kezdő csomagjainkat, akik most vágnak bele a kisállat tartásba. A csomag tartalmaz minden, a felelős állattartáshoz szükséges kelléket. A Cavie 60 a Ferplast több éves fejlesztése. Strapabíró, praktikus és rendkívül esztétikus tengerimalac ketrec. Magas peremmel rendelkezik, így a kiszemetelés esélye minimális. Tálcája erős minőségi műanyagból készül, tisztán tartása könnyű. A csomag tartalmazza: -Felszerelt Cavie 60 ketrec /1db 300ml-es csepegésmentes ... további részletek >>

önitató, 1db szénarács/ -Fogkoptató kő /Panzi,55gr/ -Tengerimalac eledel /Panzi, 1000ml/ -Réti széna /350g/-Fenyőforgács /5L/ Színekről érdeklődjön elérhetőségeinken.


Feladva: 2017-09-18    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: tengerimalacketrecCaviePanzicsomag1dbtengerimalacnakkezdocsomagmindenerősállítottukkisallatokpraktikus1000mltartalmazTálcájaszámárawebshopAzok

Forrás: pepitahirdeto.multiapro.com

Mezőgazdasági szaküzleteknek, iparcikk boltoknak, virágüzleteknek és még sok hasonló kiskereskedőnek ajánljuk közel 5.000 termékünket. Saját gyártmányaink is vannak, mint pl. a képen látható temetői szett. Látogasson el raktárunkba Halásztelekre, ahol minden termékünket megtekintheti, kipróbálhatja. Támogassa a magyar gyártókat és gyártmányokat!


Feladva: 2016-10-08    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: termékünketboltoknakiparcikk000MezőgazdaságiraktárunkbaközelgyártmányokatHalásztelekLátogassonajánljukgyártókatgeogallszettkiskereskedőnekmagyarsok

Forrás: pepitahirdeto.multiapro.com

Comac Hungary - Comac Márkakereskedés Nem akar sok pénzt egyszerre elkölteni? Nem akarja, hogy a cége likvid tőkéje csökkenjen? Akkor érdemes hosszútávra, azonos havi költséggel járó fix összegű bérlésben gondolkodni! Nincsenek szervíz költségek, nincsenek rejtett költségek, nincsenek apró betűs részek! Bővebben honlapunkon olvashat erről!


Feladva: 2017-09-18    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: nincsenekComacNemköltségeklikvidBővebbenfixcégeHungaryrészekjáróhogyajánlóbetűsköltséggelakarjaHirdetőapróhaviPepitaazonoselkölteniáron

Forrás: pepitahirdeto.multiapro.com

Tuti Turi Ptc Kiegészítő jövedelemre van szükséged? Gyere és dolgozz velünk! 2017. Magyarország egyetlen PTC oldala! Ami ingyen is elkezdhető, és csinálható! Napi kereset változó! Jutalék rendszer és más egyéb lehetőségek! Csak rajtad múlik, hogy mennyit akarsz keresni! Az első 2000 Tag, ajándék tagságban részesül! Link... http://tutituriptc.xyz/?ref=ijoco< /a>


Feladva: 2017-05-20    [
Pénzkeresés - MLM]

Címkék, kulcsszavak: PTColdalaijocoegyetlenMagyarország2017ajándékvanlehetőségekAmiTagjövedelemreegyéb2000KiegészítőmáselsőTurirendszerrefkeresniTutiJutalék

Forrás: pepitahirdeto.multiapro.com

Keresem ambiciózus kollégáimat, mellékállásban-kötetlen munkaidőben végezhető Betterware katalógus, állatkísérlet mentes termékeinek értékesítésére, vásárlói közösség kialakítására. Esélyt szeretnék adni bárkinek, aki szeretné fejleszteni képességeit és törekszik arra, hogy javítson az életminőségén. Segítünk elérni a képviselőinknek az anyagi függetlenséget és szakmai fejlődésüket-előmenetelüket biztosítjuk. Mindenkinek aki érdeklődik egy nagyszerű lehetőség iránt és szeretne egy szuper ... további részletek >>

csapat tagja lenni segítek a regisztrációban, az indulásnál és ameddig szükség van rám! Nincs kötelező kezdőcsomag és belépési díj! Kicsit részletesebben: www.tisztaotthon.cafeblog.hu/2017/07/16/hello-vilag


Feladva: 2017-11-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: akiegyszeretneirántállatkísérletEszteranyagiameddigbárkineklehetőségkatalógusDévényiképviselőinknekindulásnáladninagyszerűBetterwareMárnéelérni

Forrás: pepitahirdeto.multiapro.com

A Johnson & Johnson új egynapos viselésű 1-Day Acuvue Moist kontaktlencse tervezésénél az elsődleges cél a szem frissen és nedvesen tartása volt egész napon át. A 1-Day Acuvue Moist kontaktlencse kiváló nedvesítést, ezáltal a hosszan tartó kényelem szabadságát nyújtja Önnek. Minden napra új kontaktlencse a maximális higiéniáért és kényelmes kontaktlencse viselésért. Az egyedülálló LACREON technológiával készült kontaktlencse alapanyaga egy olyan nedvesített alkotórészt tartalmaz, amely ... további részletek >>

teljes egészében a kontaktlencsében marad a nap végére is, amikor szemei elfáradtak, és és extra nedvesítésre van szükségük. A 1-Day Acuvue Moist kontaktlencse UV védelemmel is el van látva szemei épségének megőrzéséért. A kontaktlencsék UV-szűrő képessége több mint 70%-os az UV-A, és 95%-os az UV-B sugarak tekintetében. A 1-Day Acuvue kontaktlencsék felhelyezése és kivétele rendkívül könnyű. Bővebben: www.lencsebolt.hu/termek.php?id=31


Feladva: 2017-11-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kontaktlencseAcuvueDayMoistszemeijohnsonvankontaktlencséknapranaponvégéreegyegynaposMindenlátvaegészphpnapalapanyagaÖnnekvolttermekmarad

Forrás: pepitahirdeto.multiapro.com

Törökországban, Alanyaban élő magyar házaspár vagyunk. Itt egész évben szezon van, egész évben segítséget nyújtunk a Török Riviérára utazó turistáknak. Fő profilunk: fakultatív programok, egyéni utazások szervezése, lakások eladása-vétele, letelepedési ügyek intézése, cégalapítás. Élérhetőségeinket megtalálja a hirdetés alján! Telefonszámunk nem emelt díjas! Ha utazást, üzleti tevékenységet tervez, állunk rendelkezésére!


Feladva: 2015-11-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: syedrawww5mptorok534nyujtunkRobertszervezesetelsegitsegettoursrivieranutazasokcomvallaljukhomesfelegyenihomes@hotmailevbenElerhetosegeink

Forrás: pepitahirdeto.multiapro.com

Rutinos számítógép szerelőt keres? Megtalálta. Számítógép szerviz Budapest egész területén házhoz megy. Amit vállalok: számítógép javítás, szerelés, karbantartás, amennyiben megoldható, bővítés, korszerűsítés. Nem csak asztali számítógépet, hanem laptopot is szervizelek. Ha meglévő gépét szeretné lecserélni, akkor a számítógép vásárlásban is megbízható partnere lehetek. Ne habozzon, tekintse meg weboldalamat a további részletekért és minél hamarabb kérjen ajánlatot.


Feladva: 2016-06-22    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: számítógépszervizBudapestterületénArnoldrészletekértmegyakkorteljesNemtovábbiházhozlecserélnikorszerűsítésweboldalamatszeretnébővítésmegegész

Forrás: pepitahirdeto.multiapro.com

Magyarország legnagyobb óriáscsúszdás oldala! Szabadtéri és fedett élményfürdők, ahova rossz idő esetén is érdemes menni...


Feladva: 2016-11-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: óriáscsúszdásStrandokoldalalegnagyobbMagyarországMagyarországonFürdők

Forrás: pepitahirdeto.multiapro.com

Vendégházunk Zamárdi csendes, panorámás részén, a Rétföldi utcában található. A ház 10-12 férőhelyes, tökéletesen alkalmas családok, baráti társaságok számára: - 5 kétszemélyes háló, - földszinti, emeleti nappali, étkező, - felszerelt konyha, - földszinti, emeleti fürdő, - fedett terasz, - parkolás az udvarban, - grillezési, bográcsozási lehetőség, - gyermekjátékok (hinták, homokozó), - medence 6x3,5 m, 1,2 m mély, - napozóágyak, kerti bútor, - díjtalan internet csatlakozási ... további részletek >>

lehetőség (wifi). OTP, MKB és K&H SZÉP kártyát elfogadunk. Létszám és a foglalni kívánt időszak megadásával kérje ajánlatunkat!


Feladva: 2017-12-14    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: emeletiZamárdiföldszintilehetőségmélyrészénfedettZamárdibanMKBtársaságok6x3panorámásajánlatunkatfürdőOTPbarátimedencecsendeskérjewificsaládok

Forrás: pepitahirdeto.multiapro.com

Online Parfümök 30-50%-al olcsóbban. Ingyenes parfüm átvétel Bp-en. Ritka és új parfümök széles választékban kaphatók Expressz kiszállítással - Parfüm Divat


Feladva: 2017-04-18    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: parfümökParfümDivatRitkaátvételIngyenesolcsóbbanOnlinekiszállítássalféláronExpresszMinőségikaphatókválasztékbanszéles

Forrás: pepitahirdeto.multiapro.com

Anyaga: rozsdamentes acél, talpa 11 rétegű Tartalma: sütőkosár nyéllel, bakelit alátét, vákuum gomb Szín: piros Nyél: biztonságos, nem forrósodik Súly: 5000 gr Használható: gáz, kerámialapos, halogén, indukciós és elektromos tűzhelyen is Szószos edény mérete: 16 x 8 cm Lábas: 20 x 10 cm Lábas: 24 x 14 cm


Feladva: 2017-07-21    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: LábasSúlynyélleledényEDÉNYKÉSZLETforrósodiksütőkosárSzószosRÉSZESnemTartalmatűzhelyenbiztonságosrétegűelektromosNyéltalpaindukcióspirosacél

Forrás: pepitahirdeto.multiapro.com

Ha Ön és cége, vállalkozása > termékeinek, valamint szolgáltatásainak új piacot keres > szabad kapacitását szeretné lekötni > szellemi termékeit szeretné értékesíteni > Telephelyét, ingatlanát óhajtja eladni > együttműködésre törekszik külföldi cégekkel > képviseletet óhajt külföldön > reklámra, vagy telemarketingre van szüksége, akkor cégünkben megbízható partnerre talál!


Feladva: 2016-02-13    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: szeretnéképviseletettermékeitmegbízhatócégecégekkelszellemicégünkbenPartnerkülföldilekötniakkorBusinesstörekszikkapacitásátszükségeEuroszabadvan

Forrás: pepitahirdeto.multiapro.com

Oly sokszor üzentem, versbe szedve, szépen. - El is olvashatod, már ezen a héten. Új verseskötetem napvilágot látott, ”MEGSÚGOTT TITKAIM” hiszed, majd, ha látod. Verseim díszíti 69 képem, mit magam festettem, a számítógépen. Valóra válik hát, dédelgetett álmom, s ki előre utal, annak dedikálom.


Feladva: 2015-11-05    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: TITKAIMMEGSÚGOTTverseskötetemErvinAranyosi8221szedveszámítógépenversbefestettemdedikálomüzentemmagamlátottannaksokszormitnapvilágotutalOlymár

Forrás: pepitahirdeto.multiapro.com

A Puli sétányon, Csepel kiemelt zöldövezetében, néhány lépésre a Katalin horgásztótól és az Akácfa utcai kiserdőtől egy pompás lakás eladó. A lakás felújított, 70 nm-es, 2+2 szobás, 1. emeleti, loggiás, csendes, világos, cirko fűtésű, jó beosztású, tiszta levegőjű. A lakáshoz egy pince is tartozik. A beépített konyhabútor és a háztartási gépek a vételár részét képezik. Ne az árat nézze, hanem a lakást! Hívjon még ma! Fotókat tudok még küldeni.


Feladva: 2017-07-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: PuliegylakásmégHívjonAkácfabeépítettAndrascsendeslakásthorgásztótóltartoziksétányloggiáshanemKatalinpinceemeletinézzelépésreszobásárat

Forrás: pepitahirdeto.multiapro.com

Saját weboldalt szeretnél, olcsón, minőségi, környezetbarát tárhellyel, akkor jó helyen jársz. Egy WordPress oldalt kb 1 óra alatt el lehet készíteni. A legolcsóbb tárhellyel ez havi 199 Ft bruttó amiért 2 Gb tárhelyet és rengeteg szolgáltatást adunk.


Feladva: 2013-11-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: 199tárhellyelweboldalttárhelyetoldaltSajátamiértWordPressBytebruttóEgyAlfajársztólhavihelyenmárakkorcsomagoklegolcsóbbkörnyezetbarátadunk

Forrás: pepitahirdeto.multiapro.com

A FÉRFI DIVATNAK NINCS TÖBBÉ TITKA A SPARTOO ELŐTT! 2006-ban elindulva, a Spartoo először is cipőkre specializálódott. Az éves alatt kiszélesítettük kínálatunkat, számos divatos táskával valamint egy szuper elegáns ruhakollekcióval Mottónk: a divat. Ennek köszönhető, hogy jelenleg széles választékban megtalálhatja férfiaknak kínált modelljeinket, melyek természetesen a 100% divatot képviselik! NÉZZE MEG ONLINE FÉRFIAK SZÁMÁRA KÍNÁLT SZÉLES CIPŐ-, TÁSKA- ÉS RUHAVÁLASZTÉKUNKAT! ... további részletek >>

Bármilyen legyen is a stílusa: rocker, laza vagy inkább divatos, a SPARTOO.HU-n biztosan megtalálja az Önnek tetsző darabot. Férficipő kínálatunkban több száz tornacipőt, bakancsot, sportcipőt, városi- vagy deszkás cipőt ajánlunk figyelmébe. Továbbá rendelkezésére bocsájtunk egy teljes kollekciót férfiruházatból (farmerek, nadrágok, pulóverek, ingek...). valamint a legutóbbi divattrendeknek megfelelő táskákat is. TALÁLJA MEG HONLAPUNKON A LEGJOBB MÁRKÁKAT! Nike, Converse, Pataugas, Birkenstock, Vans... A Spartoo a legjobb márkákat sorakoztatja fel férfidivat világából. Nézze át újdonságok rovatunkat és felfedezze a divat legújabb trendjeit, melyekre mindenki ráharap. Ne felejtse el átnézni tippjeinket sem, ahol találhat cipőket olcsón, melyek a 100%-os divatot képviselik. www.spartoo.hu/ferfi.php


Feladva: 2017-07-15    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: spartoo100férfidivatdivatotMEGvagymelyekmárkákategySZÉLESlegjobbdivatosdivatKÍNÁLTvalamintNézzeképviselikvilágábólcipőtmodelljeinketTÁSKÁK

Forrás: pepitahirdeto.multiapro.com

Palatetõ tisztítás, festés, javítás, felújítás cseréptetõ tisztítása festése felújítása Cserepes és trapéz lemeztetõk tisztítása festése! Garanciával!


Feladva: 2017-03-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 245festésetisztításatrapézmegszüntetéseCserepesBeázásokfelújításacseréptetfelújításjavításGaranciávalfestéstisztításPalatetLajoslemeztetKocsis

Forrás: pepitahirdeto.multiapro.com

Túl lassú, vagy költséges szállítási megoldást javasoltak mások? Kérje ajánlatunkat és legközelebb is hozzánk fog fordulni! Európán belül széles kapcsolati rendszerrel dolgozunk, egy feladatra több alternatíva közül tudjuk kiválasztani az Önnek legideálisabb megoldást.


Feladva: 2017-07-11    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: SzállítmányozásmegoldástbelülEurópánTúltöbbhozzánkajánlófeladatralegközelebbHirdetőegyajánlatunkatPepitadolgozunkKérjerendszerrelmásokszállítás

Forrás: pepitahirdeto.multiapro.com

Hegesztő minősítő tanfolyamok indulnak a hét minden napján. A tanfolyamra jelentkezéshez ELŐKÉPZETTSÉG nem szükséges! Az MSZ EN ISO 9606-1 szabvány szerint lehetőség van magyar illetve német (TÜV) vizsga megszerzésére is. A magyar vizsgákhoz a Magyar Hegesztőminősítő Testület operatív szervezete az MHtE, a német vizsgákhoz a TÜV Rheinland Intercert Kft. biztosítja a vizsgabiztost. Kérésre egyszerre egy vizsgadarab meghegesztésével két bizonyítvány szerezhető, MSz és DIN szerinti is!


Feladva: 2016-01-10    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: tanfolyamokHegesztőnapmindenminősítőhétegyBudapestminősítésselWeldcontrolTÜVszerintszabványszükséges9606nem287ELŐKÉPZETTSÉGindulnak

Forrás: pepitahirdeto.multiapro.com

A bárányhimlő felnőttkorban súlyos szövődményeket okozhat, terhes nőkre nézve pedig különösen veszélyes, mert maradandó károsodást okozhat a magzatnak. A bárányhimlő lefolyása után a szervezet immunis lesz a vírusra, így aki egyszer már elkapta, többet nem fog szenvedni a betegségtől. Főként a téli és a tavaszi hónapokban terjed, lappangási ideje 2-3 hét, ezután jelentkeznek a bőrön a piros pöttyök. Mit tegyünk bárányhimlő ellen? Bárányhimlő ellen sokféle gyógymód létezik, általában csak a ... további részletek >>

tüneteket kell kezelni, azaz a viszketést csillapítani, mert az elvakart hólyagok heget hagyhatnak maguk után.


Feladva: 2016-10-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BárányhimlőutánmertellenokozhatterjedfelnőttkorbanazazmártegyünkkárosodásthónapokbanKittikezelniegyszerMitmaradandótavasziKellérkellakitéli

Forrás: pepitahirdeto.multiapro.com

Az általunk ajánlott technológiával 2 fős személyzettel, egyetlen gépjárművel elvégezhető az aszfaltburkolat javítás, bontási munkálatok nélkül. Ami még fontosabb: a javítás költsége akár 40%-al is kevesebb lehet ezzel a módszerrel, valamint a létrejövő hő-kötés miatt lényegesen tartósabb megoldást nyújt. Végül, de nem utolsó sorban a helyszínen újrahasznosítjuk az összes jelenlévő anyagot, ezáltal hulladékelszállításra sincs szükség. Mi minőséget nyújtunk! Keressen bizalommal!


Feladva: 2014-02-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: télenjavításújrahasznosítjukegyetlenkötésnyújtunkméghelyszínenszemélyzettellétrejövőminőségetamisorbanfősvalamintIlletveutolsótechnológiávalnem

Forrás: pepitahirdeto.multiapro.com

Nagyon komoly és ajánlott szempontok azoknak akik valamilyen módon, de mégis csak legális pénzkeresést, üzletet képzelnek el maguknak az interneten. Tapasztalatok alapján... Első: Keresd folyamatosan azokat az eszközöket, internetes felületeket melyek megmutatják az interneten, amit közölni kívánsz a reménybeli közönségeddel, vásárlóiddal! Mérlegelj! Befektetett anyagiak, idő és energia, szemben a várható kereset! Kerüld az automata eszközöket, melyek mesterségesen küldenek látogatókat ... további részletek >>

arra a webhelyre, ahol a terméked, szolgáltatásod és fontos üzeneteid láthatóak! (Autoblog, linkcserélő, automatának mondott weblap-webáruház, stb.!) Második: Soha se ismételj, duplikálj semmit! Ha valami megváltozik, esetleg szöveg, vagy képhibát tapasztalsz, akkor módosítsd a tartalmat és NE TÖRÖLD! Jellemző a felfogás, hogy hirdetőoldalakat használnak sokan, hogy webhelyükre felfigyeljen a Google, ezáltal kereshetőek legyenek sok-sok ember számára... Ez még rendben is lenne, DE! Nagyon nem taktikus ugyan azt a hirdetést feladni az összes ismert hirdetési oldalon! Pláne nem taktikus az a viselkedés, hogy hagyjuk lejárni a hirdetéseket, ahelyett, hogy módosítanánk inkább! (Amelyik oldal nem engedi, azt felejtsük el!) Harmadik: Mindig tartsuk be a törvényeket és előírásokat! Ezt meg kell követelnünk partnereinktől és vásárlóinktól is! Tudni kell lemondani azokról, akiknek a szabályosság nem fontos! Látni kell, hogy fentiek ugyan hirdetésként jelennek meg, de alapvetően információ, nem pedig felhívás hirdetés feladására a Pepita Hirdető oldalára! Természetesen azért szívesen rendelkezésre állunk! Direkt link a hirdetésfeladáshoz: www.pepitahirdeto.multiapro.com/feladas.php


Feladva: 2017-06-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmegkellNagyonHirdetőPepitaaztugyantaktikussokinternetenfontosinternetesmelyekeszközöketcomakiknekhirdetéstismételjvásárlóiddalMindig

Forrás: pepitahirdeto.multiapro.com

Arany, ezüst felvásárlás! Vásárolunk: Aranyat, ezüstöt, arany érméket, ezüst érméket, ezüst étkészleteket, ezüst tárgyakat, kitüntetéseket, mindent, ami aranyból, vagy ezüstből van!


Feladva: 2016-05-02    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ezüstaranyérméketfelvásárlásétkészleteketvanezüstötezüstbőlAranyatvagyVásárolunkaranybólmindentNyíregyházakitüntetéseketAranybazarkfttárgyakat

Forrás: pepitahirdeto.multiapro.com

Horvát Tengerpart Zadar! Kiadó Tengerparti Apartmanok! Kedvezményes apartman kínálatok! Már most foglalja le Álmai apartmanját Nyári Tengerparti nyaralásához! Akciók már 39 Euro/4 fő/apartman/nap! Felejtse el a Booking.com-ot! Nálunk minősegi garancia van és olcsóbbak vagyunk min. 30%-al mint a Booking. Személyesen adunk át minden apartmant a vendégeinknek és bármikor ott a magyar kolléga Zadarban, ha segítség, vagy információ kell. Alkudni lehet! Ne felejtse el, spórolhat ... további részletek >>

idejekorán megkötött előfoglalásával és a legjobb tengerparti apartmanjaink közül választhat! Közvetlen információs profilunk ajánlatokkal: www.facebook.com/zadarkiadoapartmanokraczattila Ha szeretné hogy a barátai is lássák a hirdetést, ossza meg az idővonalán is. Kiadó Tengerparti Apartmanok Már 10 Euró/fő-től! Nyaralást, vagy örök tengeri hajóvezetői jogosítványt szeretnének? Akár Egy nap alatt? Esetleg Tengerparti Ingatlant Vásárolnának Magyar zadari ügyintézéssel? Keressen! Ha tetszik a Horvát Tengerpart, Hirekért, kedvezményes Szállás ajánlatokért, ingatlanvásárlásért-tanácsadásért jelöljön ismerősnek bennünket, vagy a honlapon az információs profilunk linkje: www.facebook.com/zadarkiadoapartmanokraczattila Honlapunk: www.horvatapartman.eu Ha szeretné hogy a barátai is lássák a hirdetést, lájkolja és ossza meg az idővonalán is!


Feladva: 2016-10-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: TengerparticomvagywwwApartmanokKiadófelejtseosszaMagyarfacebookhirdetéstlássákprofilunkkedvezményesbarátaiZadarbookinghogyTengerpartszeretné

Forrás: pepitahirdeto.multiapro.com

Eladó egy 23 négyzetméteres, összkomfortos üzlethelyiség forgalmas, budai metrófeljáróval szemben. Naponta minimum 25–35 ezer ember halad el az üzlet előtt, tehát az extra nagy forgalom garantált. Irányár: 1,5 millió Ft/m2. Az üzletnek jelenleg tartós bérlője van, tehát befektetésnek is jó, mert magas havi jövedelmet eredményez. Ajánlati szám: VSZ/00151/16/07


Feladva: 2017-12-01    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: tehátbudaiVSZüzlethelyiségEladónagymetrófeljáróvalextra00151vanelőttforgalmasbérlőjeüzletszámtartóshaladAjánlatiösszkomfortosjelenlegember

Forrás: pepitahirdeto.multiapro.com

Olyan pénzügyi szakmát szeretnél tanulni, amivel vállalkozások alapításával, adóügyekkel és hitelügyintézéssel is foglalkozhatsz? Szeretnél pénzügyi szakértőként dolgozni és ügyintézéssel foglalkozni? Szívesen lennél Pénzügyi asszisztens, Banki könyvelő vagy Számviteli előadó? Jelentkezz Budapesten induló Pénzügyi-számviteli ügyintéző OKJ-s tanfolyamunkra! A tanfolyam árát több részletben is fizetheted. A tanfolyamot kevesebb, mint 1 év alatt is elvégezheted és pályakezdőként, akár 200.000 Ft-os ... további részletek >>

fizetésre is számíthatsz. A tanfolyamhoz szükséges szakmai előképzettség: Érettségi végzettség. Ha úgy döntöttél, hogy ez a Te szakmád, akkor jelentkezz weboldalunkra kattintva: www.tanfolyamokj.hu/penzugyi-szamviteli-ugyintezo-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: penzugyiszámvitelibudapestentanfolyamokjugyintezotanfolyamokjSzeretnéljelentkezz200amivelárátszamvitelifoglalkozniúgyakártanulnitanfolyamunkra000

Forrás: pepitahirdeto.multiapro.com

Sportszerek nyári és téli sportokhoz, kerékpározáshoz, felnőttek és gyermekek részére. Kínálatunk több sportszermárkát tartalmaz: WORKER, Fila, Galaxy, DHS, 4EVER, Kellys. Választhat széles sportszer kínálatunkból gyermekek részére is: rollerek, futóbiciklik, gyermekbiciklik, korcsolyák.


Feladva: 2017-07-11    [Sport - Kemping - Túra]

Címkék, kulcsszavak: részéregyermekekPepitasportszertöbbáltalszélesKínálatunkgyártóVálaszthatfelnőttekOlcsóbbKellyskerékpározáshozSportboltkorcsolyák4EVERsportokhoz

Forrás: pepitahirdeto.multiapro.com

Születésnap? Évforduló? Esküvő? Sütiben, tortában a Várfok Cuki a nyerő! Sütemények, torták, sós és édes finomságok, fagylaltok, jégkása, üdítő, tea és kávé különlegességek! Előrendelést telefonon is felveszünk!


Feladva: 2017-07-11    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: VárfokjégkásaSütibenfagylaltokEsküvőfinomságokÉvfordulóédesSzületésnapfelveszünksósBudapesttelefonontortákajánlóElőrendeléstSüteményekHirdetőkávé

Forrás: pepitahirdeto.multiapro.com

Portálunkon olyan magánkollégiumokról találsz információkat, melyek a leginkább megfelelnek igényeidnek, ha hosszabb távra keresel lakhatást (nemcsak néhány napra). Ennek érdekében: - a magánkollégiumok Budapest belvárosához közel, metrómegálló mellett helyezkednek el - a kiadó szobák jellemzően egyszemélyesek - a legtöbb szobához a szobából nyíló privát fürdőszoba tartozik - a kiadó szobák árai rendkívül kedvezőek - minden szoba külön bejáratú, berendezett, minden ... további részletek >>

magánkollégium gépesített Reméljük, honlapunk segítségével te is hamarosan megtalálod a számodra ideális kollégiumi szobát!


Feladva: 2017-09-11    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: szobákkiadómindenkollégiumiegyszemélyesekhonlapunknapraáraiinformációkatjellemzőenReméljüknéhánytalálszhelyezkednekgépesítettnemcsakmelletttartozik

Forrás: pepitahirdeto.multiapro.com

A máj tisztítás csak egészséges felnőtteknek ajánlott, mivel igen igénybe veszi a szervezetet. Azok, akiknek fizikai és lelki állapotuk is megfelelő ahhoz, hogy belevágjanak a kúrába, rengeteg előnyét fogják tapasztalni. A májtisztító kúra hatékonysága megmutatkozik az emésztés javulásában, az allergiás tünetek enyhítésében, az energiaszint növekedésében. Sok egészségi problémán segíthetünk ezzel a természetes módszerrel, hiszen a toxikus anyagok a szervezetben számtalan betegségnek adnak kiváló ... további részletek >>

táptalajt. A máj méregtelenítés, azaz máj tisztítás otthon, egyszerű hozzávalókkal is elvégezhető.


Feladva: 2017-03-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: májtisztításhatékonyságakúramájtisztítófogjáktoxikusakiknekenyhítésébenKittielőnyéthiszenAzoktünetekKellérazazrengetegmódszerrelszervezetethogy

Forrás: pepitahirdeto.multiapro.com

Cégünk a nagy múltú olasz Eva Calor termékeit forgalmazza,melyek közt találhatók légbefúvásos és csatornázható pellet kályhák, kandalló betétek, vízteres pellet kályhák. Működésük korszerű elektronikának köszönhetően teljes biztonság mellett automatikusan történik. Pellet kályháink mellett szóló érvek: automatikus gyújtás, működése előre beprogramozható akár a hét mindennapjára, a leggazdaságosabb modern fűtési technológia, a gyorsan elért beállított hőmérséklet után EKO üzemmód vagy STAND BY ... további részletek >>

állapot, rendkívül magas hatásfokú és környezetbarát megújuló tüzelőanyaggal működő készülékek. A ma elérhető automata fűtési rendszerek közül a legolcsóbb a pellettel való fűtés!


Feladva: 2017-09-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: pelletkályháknagyfűtésimellettautomatikusantüzelőanyaggalhétmúltúEKOkandallótörténikműködőmindennapjáraolaszüzemmódbetétekkályháinkkészülékek

Forrás: pepitahirdeto.multiapro.com

Ha túl nagy a lakása, ha inkább a gyermekével foglalkozna, vagy egyszerûen csak nem tudja hogyan fogjon hozzá, de tiszta lakást, átlátható ablakot szeretne, hívjon bizalommal! Kirakatok, ablakok, tükrök, üvegfalak, üvegportálok tisztítása. Üzletek, irodák, csarnokok, lakások, magánházak takarítása. Gyors, tiszta munkavégzés, korrekt árak. Megelégedettségi garancia! Huszka Antal 70/6163797 www.ablaktisztitas.5mp.eu


Feladva: 2017-06-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: AntalHuszkagaranciaMegelégedettségitisztatükrökablaktisztitashogyanGyorsnagyablakokwwwtudjatakarításatúlKirakatok6163797nemmagánházakBudapest

Forrás: pepitahirdeto.multiapro.com

Ha nyaralni, üdülni, vagy egyszerűen kikapcsolódni szeretne a Balatonnál, jó helyen jár, válasszon minket, a 2× 5+1 férőhelyes, két hálóteres, az egész évben nyitva tartó apartman házunkat Siófokon. Az apartman Siófok kertvárosában helyezkedik el, közel mindenhez. A Balaton kb. 15 perc séta, a Galerius fürdő kb. 10 perc autóval. A feltüntetett ár 1 db 5 fős apartmanra értendő főszezonban! Új szolgáltatásunk, dézsafürdőnk is igénybe vehető (egyeztetést igényel). T: 06302760722 ... további részletek >>

Figyelem! Ha bulizó helyet keresnek, akkor ne minket válasszanak!


Feladva: 2016-12-02    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: BalatonnálminketSiófokapartmanpercSiófokonvehetőhelyenfürdőházunkatválasszanakigénybeGaleriustartódézsafürdőnkszeretnesétanyitvaakkorBalaton

Forrás: pepitahirdeto.multiapro.com

Szeretnél sütemény-, torta- vagy bonbonkészítéssel foglalkozni? Mindig is szeretted a különleges desszerteket és oda vagy a főzött, kézműves fagylaltokért? Olyan tanfolyamra jelentkeznél, ahol kulturális környezetben, modern eszközök segítségével tanulhatsz? Jelentkezz Budapesten induló Cukrász OKJ-s tanfolyamunkra! A Cukrász tanfolyam árát, akár részletekben is kifizetheted. A tanfolyam időtartama 9 hónap, így rövid időn belül kezedbe veheted az OKJ-s bizonyítványt. A tanfolyamhoz mindössze ... további részletek >>

alapfokú iskolai végzettség szükséges. Ha érdeklődnél vagy jelentkeznél a Cukrász tanfolyamra, akkor kattints az oldalunkra és töltsd ki az űrlapot: www.tanfolyamokj.hu/cukrasz-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: tanfolyamCukrászokjbudapestenvagytanfolyamokjtanfolyamrajelentkeznélbelülsüteményindulókézművesérdeklődnélidőnSzeretnélJelentkezzhttpsszükséges

Forrás: pepitahirdeto.multiapro.com

A WaveScore egy ingyenes filmmegosztó közösségi videomédia portál, ahol az aktív tagoknak az összpontja alapján fizet! Minden héten, hétfőtől vasárnapig van egy új játék, ahol lehet nyerni. A TOP50 versenyben már jelentős nyereményösszeget érhetsz el! Gyere Te is velünk! Egy új közösségi oldalra, szórakozz, találj új barátokat. Töltsd fel kedvenc videóid, hívd meg barátaid! Próbáld ki, megéri! Használd ki az internet adta lehetőségeket. Érdeklődj!


Feladva: 2017-05-08    [Pénzkeresés - MLM]

Címkék, kulcsszavak: közösségiEgyaholadtahétfőtőlTöltsdingyenesjelentősinternethétenbarátokatWaveScoremárHasználdMindentaláljElviraversenybenmegérifizetszórakozz

Forrás: pepitahirdeto.multiapro.com

Van egy szuper lehetőség! Shoppingoltál már úgy hogy közben pénzt is adtak érte?! A világon Egyedülálló rendszer, extra lehetőség, amelyre jelentkezz most! Várom érdeklődésed, írj mielőbb, mert számít az idő!


Feladva: 2017-11-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: lehetőségegyElviraérdeklődésedadtakSzakálVárompénztshoppingolássalmostközbenProfitáljjelentkezzhogyamelyreúgymáridőextraShoppingoltálszámít

Forrás: pepitahirdeto.multiapro.com

A makett építés egy igen kedvelt és érdekes hobbi. Katonák, harckocsik, repülők, egyéb kiegészítők nagy választéka áll rendelkezésetekre, hogy elkészítsetek egy makettet, vagy akár egy igényesen kidolgozott diorámát. Akik még csak most ismerkednek ezzel, vagy szeretnék elkezdeni, azoknak ajánlom a kisebb, egyszerűbb maketteket, ezeknek az összeállítása nagyon egyszerű. Méretarányuk: 1 : 100 Általában 6-8-10 elemből összeépíthető makettek, amik nem igényelnek nagy szaktudást, de már az első ... további részletek >>

makett összeállítása is nagy élmény lehet a gyermek számára. Bővebben: www.kpjatek.hu/KEZDo-MAKETTEZoKNEK-c63_0_1.htm


Feladva: 2017-08-23    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: nagyegymakettMAKETTEZŐKNEKvagyKEZDŐösszeállításadiorámátnagyonszaktudástazoknakhtmkidolgozottegyszerűkiegészítőkmárelkezdeniJátékigényesenegyéb

Forrás: pepitahirdeto.multiapro.com

Állami támogatás kihelyezésével foglalkozom és mindenféle hitel közvetítésével, valamint biztosításokkal. Ingyenes tanácsadás, igényfelméréssel egybekötve, hogy legalább az információ meglegyen, ami nélkül hozzuk meg sorra a rossz döntéseinket. Kiválasztjuk együtt a legjobb megoldást és elmondom mit hogyan kell csinálni ahhoz, hogy saját otthonod melegét érezd és a saját kertedet szépítsd. Kérjetek visszahívást tőlem itt: www.otthonteremtes-biztonsaggal.webnode.hu vagy itt: ... további részletek >>


Feladva: 2016-11-06    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: hogytámogatásÁllamitanácsadásIngyenesittsajátotthonteremtesegybekötvedöntéseinkethttpigényfelmérésselahhozrossztőlemcsinálniBudapestsorrakell

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés a Konténer Gurutól telefonon és emailben is lehetséges! Hívás előtt az egyik legfontosabb kérdés, hogy hova szeretné elhelyezni a konténert! Vizsgálja meg, hogy befér-e a kapuján vagy csak az utcán marad-e hely a lerakásához. Ez utóbbi esetben ugyansi lehet, hogy területfoglalási engedélyre lesz szükség, ami módosíthatja a leszállítás időpontját. A konténer rendelés a főváros valamennyi kerületébe és Pest megye több településére is lehetséges még hétvégén is. Ha lomtalanítást ... további részletek >>

tervez, hívjon még ma, hogy a feleslegessé vált holmik ne az út szélén végezzék! Kérdések és válaszok konténer rendelés előtt weboldalunkon!


Feladva: 2017-08-16    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: konténerhogyrendelésméglehetségeselőtttervezkonténertidőpontjátKittiválaszokutóbbilomtalanítástelhelyeznileszállításKellérKérdéseklerakásáhozami

Forrás: pepitahirdeto.multiapro.com

Hölgyeim és Uraim! Engedjék meg hogy bemutatkozzam,Ábrahám Zsolt vagyok Esküvői és Parti Dj. Minőségi szolgáltatást nyújtok elérhető áron számlaképesen, országosan! Céges rendezvényre, Születésnapra, vagy egy fergeteges szilveszteri bulira is szívesen megyek. Elérhetőségem: 0620/274-0390 Az Őszi ár akció elkezdődött! 25%kedvezmény, minden Esküvő árából! Leinformálható nívós referenciával, komplett minőségi hang és fénytechnikával,(RCF hang, ledes lámpák fények, Pioneer Dj pult, Shure ill, ... további részletek >>

Sennheiser mikrofonok. Zenéim a hetvenes évektől napjainkig(retro, pop, rock, rock&roll, alternatív, funky, stb. Magyar és külföldi top slágerek, vagy igény szerint mulatós zenéimre táncolhatnak, IDŐKORLÁT NÉLKÜL akár hajnalig.www.edjbier.hu zsoltbraham@freemail.hu Budapest XXII. ker


Feladva: 2017-10-16    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: CégeshangminőségiBudapestrendezvényreZsoltrockÁbrahámvagynyújtokNÉLKÜLUraimMagyarkedvezményZenéimszilveszteriszolgáltatástIDŐKORLÁTRCFHölgyeim

Forrás: pepitahirdeto.multiapro.com

A krill omega 3 gélkapszula magas omega-3 zsírsav tartalmával csökkenti a keringési betegségek valószínűségét. Az idősebbeket és az egyre gyakrabban a fiatalabb korosztályt is érintő vérnyomás-, koleszterinproblémák, érrendszeri betegségek ellen sokat tehetünk, ha rendszeresen pótoljuk az omega-3 zsírsavakat A krill omega 3 gélkapszula kellő mennyiségben tartalmazza ezt az esszenciális tápanyagot, mely a legtöbb ember étrendjéből hiányzik - pedig minden életkorban nélkülözhetetlen. Segíti az ... további részletek >>

idegrendszer egészséges működését, növeli a fizikai és a szellemi teljesítményt, csökkenti a gyulladásokat és helyreállítja a hormonháztartás egyensúlyát. Krill omega 3 gélkapszula ára itt!


Feladva: 2016-09-23    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: omegaKrillgélkapszulacsökkentibetegségeknélkülözhetetlenkeringésieztgyulladásokatérrendszeriéletkorbantartalmávaltartalmazzakoleszterinproblémákminden

Forrás: pepitahirdeto.multiapro.com

Szavazz a Neked tetszőre! Minták a készítők elérhetőségeivel, hogy kapcsolatba is léphess velük... Mindent ezen a honlap oldalon találsz a szavazásról: www.mukorom.hu/mukorom-mintak/porc elan-mukorom-mintak


Feladva: 2017-04-12    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: mukorommintakPepitakapcsolatbamintaporcelanhogyporcelánwwwelérhetőségeivellegszebbszavazásrólkészítőkMelyiktalálszMintákoldalontetszőrehonlap

Forrás: pepitahirdeto.multiapro.com

Daruzással kapcsolatos munkák végzése. Gép, konténer, építőanyag szállítása, daruzása! Kis helyekre 1 tonnás mini darus autónk van!


Feladva: 2017-01-02    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: darusmunkákminikapcsolatostonnásDaruzássalhelyekreDebrecenKisIstvándaruzásaTóthszállításaKCRépítőanyagDaruzáskonténervanGépautónkvégzése

Forrás: pepitahirdeto.multiapro.com

Minőségi 4-8 tojásos leves és köret tészták kaphatók, megrendelhetők. A termékek hagyományos összetétellel, de modern technológiával készülnek! 100% Magyar Termék!


Feladva: 2016-10-10    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: kaphatókTerméktésztákMagyarköret100leveskészülnektojásostechnológiávalMinőségimodernKondorosösszetétellelkondorositesztahagyományosgyártótól

Forrás: pepitahirdeto.multiapro.com

A Pongó Vendégház Gádoros Nagyközség központjában található, a három darab kétszemélyes (pótágyazható) szobában tusoló, WC, franciaágy, kábeltelevízió, wifi elérés áll rendelkezésre. Egy szoba légkondicionált és akadálymentesített. Minden szükséges eszközzel felszerelt közös konyhában készíthetik el a lakók ételeiket. Befogadóképesség: max. 9 fő Szobafoglalás, információ: Bencsik Sándorné: +36703299481 Elérhetőség: 5932 Gádoros, Jókai u. 5. www.pongovendeghaz.oldalunk.hu ... további részletek >>


Feladva: 2017-03-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: GádorosSándornépongovendeghazBencsikVendégházPongówwwoldalunkszobábanBefogadóképességlégkondicionáltJókaipótágyazhatóételeiketszobakétszemélyeslakók

Forrás: pepitahirdeto.multiapro.com

Nem ígérek milliókat, de egy olyan lehetőséget ajánlok, amivel hozzájárulhatsz a családi kasszához hosszú távon. Vásárold meg most a neked tetszőt! 18 terméket 50%-al olcsóbban! Miért várnál kedvezményeket csak az év egy napján? Teremtsd meg a saját Black Friday napodat! Keress a részletekért!


Feladva: 2017-11-17    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 224232242hozkatkasszmilliolcscsalrekketrulhatszNemtermhozzSiófokmegamivelErzsébetroldnlokHajdugetingyenesenvonlehetősszletek249

Forrás: pepitahirdeto.multiapro.com

A születésnapi idézetes papírtekercset minden férfi ismerősünknek ajánljuk, mely egyedi ajándék bármely korosztálynak. Termékleírás: Papírtekercs, színes szalaggal átkötve, fapálcikára feszítve, amelynek végei fagolyócskákkal vannak lezárva. Méret: 21cm X 16cm Itt található: www.dekorkucko.hu/papirtekercs-fer fi-szulinapi-koszonto


Feladva: 2017-04-27    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ferfipapirtekercskoszontoszulinapiátkötveminden16cmszalaggalpapírtekercset21cmszínesidézetesMéretTermékleírásszületésnapilezárvakorosztálynakvannak

Forrás: pepitahirdeto.multiapro.com

Kifeküdt matracok, francia ágy, heverő, kanapék, sarokgarnitúrák, fotelok, székek javítása. Rugó csere, szivacs csere... Vállaljuk bármilyen matrac, franciaágy, ágybetét, heverő, fekvőfelület javítását, újragyártását bármilyen méretben, magasságban, keménységben. Rugócsere, szivacscsere, szövetcsere. EXTRA KEMÉNY matracok hátfájásra,derékbántalmakra. 160 kg/fő! Franciaágyon belül osztott keménység személyenként. 17 év tapasztalat. 2000 féle szövet választható a legjobb ... további részletek >>

anyagminőségben!


Feladva: 2017-12-23    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: javításmatracágybetétfranciaágymatracokheverőbármilyencsereújragyártásátféleszivacs6877480javítását2000RugóKEMÉNY3630fekvőfelülettapasztalatrug

Forrás: pepitahirdeto.multiapro.com

FB like, G+, Retweet, Pin-ek, követők szerzést biztosítja ez a nemzetközi weboldal. Ingyenesen is, ha mások posztjait, oldalait megnézed, lájkolod, esetleg megosztod. A választás a Tiéd, amit nem akarsz, azt nem kell! Viszont ami Neked tetszett, vagy megosztottad, azért pontokat kapsz, amit a saját közösségi oldalad, posztod népszerűsítésére használhatsz. Azt is kiválaszthatod, hogy mely országokból érkezzenek a lájkolók, +1-et adók, követőid kizárólagosan! Sok magyar is van már ...


Feladva: 2016-03-14    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: AztlikeamitnemmagyarválasztásbiztosítjamegosztottadFacebookSokmegosztodhasználhatszszerzéstvagykizárólagosanesetlegnépszerűsítésérekövetőkposztod

Forrás: pepitahirdeto.multiapro.com

LAPRA SZERELT IKEA - KIKA - RETZ BÚTOROK ÖSSZEÁLLÍTÁSA 06209884170. Háztartási gépek bekötése, lakásfelszerelési tárgyak felfúrása beton és tégla falra. Egyedi karnis, előszobafogas, gardrób gyártás, meglévő bútorok otthoni javítása.


Feladva: 2016-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: IKEASZERELTbútorokLAPRAEgyediÖSSZEÁLLÍTÁSAfalraRETZtéglaKIKAjavításabetonotthonifelfúrásatárgyakmeglévőlakásfelszerelésiBudapestgyártásbekötése

Forrás: pepitahirdeto.multiapro.com

A moringa, azaz a csodafa természetes multivitamin, melynek leveléből tápanyagokban bővelkedő étrendkiegészítő készül. Rendszeresen fogyasztva a vitalitás növekedését, az erőnlét fokozódását tapasztalhatjuk. A moringa multivitamin antioxidáns gyerekeknek és felnőtteknek egyaránt segít megőrizni az egészséget, illetve betegség esetén hatékony támogatást nyújt a gyógyulás érdekében. Több mint 40 féle antioxidánssal védi a sejteket és veri vissza a káros szabadgyökök támadásait, ezzel pedig ... további részletek >>

sokat tesz a betegségek és az öregedés ellen. Természetes multivitamin moringa porból - Információk és rendelés 1 perc alatt! www.multivitamin.moringa.bolt.hu/multivitamin


Feladva: 2017-09-15    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: moringamultivitaminTermészeteslevelébőlantioxidánssalcsodafapercilletvesokatnövekedésétféleazazrendelésegészségetpedigvitalitásmintKittimegőrizni

Forrás: pepitahirdeto.multiapro.com

Ha ön egy sok éven át használható és kényelmes garnitúrát szeretne prémium minőségben, jó helyen keresi! Egy szék ára 8000 Ft. Bármennyi készíthető és az asztal mérete és formája is változhat igény szerint, ha egy más garnitúrát szeretne. Új állapotban 2 év garanciát adok rá. Könnyen szállítható, mert egyszerűen szétszerelhető. A garnitúra ára lecsiszolt állapotban, festésre készen értendő, mindenki igényei szerint festheti akár, de megegyezés szerint le is festhetem. Kiszállítás is ... további részletek >>

megoldható.


Feladva: 2017-07-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: szerintegyállapotbanszeretnegarnitúrátáragarnitúramegoldhatókészíthetőfestésresokgaranciátKiszállításBármennyiprolignumfesthetem8000lecsiszoltmás

Forrás: pepitahirdeto.multiapro.com

Érettségizzen Ebesen, a Báthori István Gimnáziumban! Kiváló tanári kar, diákigazolvány, családi pótlék, minimális díj, előzetes tanulmányok beszámítása, ingyenes tankönyvek, jó közlekedés! Indult Vámospércsen is, ne hagyja ki!


Feladva: 2016-11-12    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: IstvánBáthoriminimálisÉrettségizzenhagyjapótlékEbesVámospércsencsaládiGimnáziumIndultdiákigazolványfelnőtteknekközlekedéskarÉrettségitankönyvekdíj

Forrás: pepitahirdeto.multiapro.com

Jégkása készítés, jégkásagép bérlés, rendelhető rendezvényre. Amikor szükség van a Gulliver élménypark egy jó választás velünk népszerűsítse rendezvényét, családi napra, céges rendezvényre lehető legjobb minőségi szolgáltatást nyújtunk.


Feladva: 2016-10-05    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: bérlésjégkásagéprendezvényrekészítésJégkásalegjobbélményparklehetőGullivervancégesszükségnapraAmikorcsaládirendelhetőrendezvényétnépszerűsítseegy

Forrás: pepitahirdeto.multiapro.com

Teljesen új kerti pad lóca eladó a gyártótól! Anyaga fenyő. Kezeletlen, lehetőséget nyújtva bármilyen felületkezelés alkalmazására, így bátran tetszőlegesen színezhető. Mérete: 123,5 x 42,5 x 81 cm. A termék lapra szerelt kivitelben van csomagolva, szállítás szempontjából nagyon kis helyet foglal. Az átvétel történhet személyesen, vagy utánvétes postázással. A termékre 1 év garanciát vállalunk (+ 500 Ft = 2 év) és számlát biztosítunk. www.dbutor.hu/butorok/fenyo-butor/kertibutorok ... további részletek >>


Feladva: 2017-02-09    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: fenyopaddbutorkertitörténhetTeljesenszereltbiztosítunkbármilyenátvételMaglódlapraszámlátnyújtvafoglalgaranciávaltermék500lehetőségethelyet123

Forrás: pepitahirdeto.multiapro.com

24 órás otthoni szakápolás, betegápolás! Otthonában ápolom kifejezetten szakápolást igénylő lábadozó, beteg, vagy idős hozzátartozóját, krónikus belgyógyászati, haematológiai és onkológiai tapasztalattal és több, mint 25 éves gyakorlattal. Szükség esetén 24 órában. Kórház, műtét utáni ápolás. Tumoros betegek otthoni ápolása. Megfelelő végzettséggel és referenciával rendelkezem. Bérezés megállapodástól függően. Tel: 06-30-8834252 kovacsbiren@gmail.com


Feladva: 2017-05-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: otthonibetegápolásMegfelelőszakápolásSzükségidőscomápolásaórásgyakorlattalvagykovacsbiren@gmailBudapestéves8834252betegekIrénmintlábadozóTel

Forrás: pepitahirdeto.multiapro.com

Kitartó, lelkes embereket keresek Bio termékek katalógusból történő árusításához. A munka teljes mértékben otthon végezhető, és nagyon egyszerű, mivel AUTOMATIZÁLT WEBOLDAL segítségével történik, költség és kötelezettségmentesen. Gyes mellett, nyugdíj mellett, de akár munka mellett is, minimális időráfordítással növelheted a bevételed. MUNKATÁRSKÉNT stabil jövedelem lehetősége egy nemzetközi üzlet partnereként - Nincs felső korlát. Annyit kereshetsz, amennyit csak szeretnél. - Az EU ... további részletek >>

országaiban is nyitott a lehetőség! Válassz most BIO készítményeket a mesterséges szemét helyett! Nézd meg a KÍNÁLATOT: www.egeszsegbomba.mylifecare.hu 100% elégedettségi garancia! Regisztrációs és tagsági díj helyett ajándékokkal és folyamatos akciókkal várunk Téged: + AJÁNDÉK utalvány + AJÁNDÉK VIP hűségkártya + AJÁNDÉK katalógus + AJÁNDÉK magazin + AJÁNDÉK termék Hozd létre ingyenesen felhasználói Partner fiókodat és rakd kosárba meglepetéseinket! Ha kedvet érzel hozzá, és szívesen keresnél pénzt ilyen formában, akkor részletesen tájékozódhatsz a weboldalon. Jelentkezzél fel hírleveleinkre is! www.egeszsegbomba.mylifecare.hu A felmerülő kérdéseidre szívesen válaszolok az alábbi e-mail címen: szerencseneked@gmail.com


Feladva: 2016-11-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AJÁNDÉKmellettmunkahelyettszívesenBIOmylifecareegeszsegbombahttphírleveleinkreakciókkalnemzetközikeresekhozzámegcímenHozdszeretnélegyszerűfel

Forrás: pepitahirdeto.multiapro.com

Igényesen kivitelezett vízteres kandallóbetét beszerezhető közvetlenül a gyártótól különböző (10-19kW-os) vízoldali teljesítménnyel. Ráköthető új és meglévő központi fűtésekre is. A kedvező áron túl, adódik egy olcsó beépítési, és egy igen olcsó fűtési lehetőség. Igényre olcsó házhoz szállítás. Honlapunkon 163.830 Ft-tól válogathat kazánlemezből készült, kovácsoltvas díszítésű gyártmányainkból!


Feladva: 2016-04-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: olcsóegyvízteresRáköthetőválogathatIgényesenigenteljesítménnyeltólGyomaendrődvízoldali000Vendelbeépítési19kW159KatonaadódikkülönbözőHonlapunkon

Forrás: pepitahirdeto.multiapro.com

Síremlékek és urnák műanyagból! A Magyar Szabadalmi Hivatal által kizárólagos ipari-jogvédelemmel ellátott műanyag síremlék. Könnyű, akár egyénileg felállítható, szállítható, mozgatható, mosható, csavarozható elemekből áll, névtábla, váza, fed lap, anyagában színezhető, esetleg, külön igény szerint fényezhető, nagyon praktikus, esztétikus és kedvező árfekvésű síremlék! Olyan befektetők jelentkezését várjuk, akiket a termékek gyártási joga érdekel!


Feladva: 2016-05-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: síremlékgyártásiakárpraktikusműanyagbólvázatermékekKönnyűnagyonurnáknévtáblaakiketműanyagfényezhetőSíremlékekállvárjukellátottszerintLászló

Forrás: pepitahirdeto.multiapro.com

Zamárdi kiadó szálláshelyek fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Sok fényképpel a szálláshelyekről és a városról! - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Egész évben nyitva tartó szálláshelyek Zamárdiiban - Weblap: www.zimmerinfo.hu/zamardi/hu.htm


Feladva: 2017-11-16    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfokiadóEgészZAMÁRDIáronhtmapartmanokszállásoklegolcsóbbzamardinyaralóházakelfogadónélkülvillákPihenőkártyadíjwwwvendégházak

Forrás: pepitahirdeto.multiapro.com

New Yorkban játszódik a történet, amelynek főszereplője Kyra, egy doktornő, aki meddősége miatt nem alakít ki tartós kapcsolatot senkivel. Van rá oka: már érte emiatt csalódás. Ám ez az állapot sem tarthat a végtelenségig és egyszer csak találkozik azzal a férfival, aki minden nő álma. Ő azonban továbbra is titkolja meddőségét, ám egy idő után ez a helyzet fenntarthatatlanná válik... www.adamobooks.com/termek-A-sors-i roniaja-86.html


Feladva: 2016-09-29    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: adamobooksakiegysorscomtarthattartósazonbanYorkbansemhttpalakítálmaNewállapotváliknemmindenBudapestcsalódásfenntarthatatlannámiattemiatt

Forrás: pepitahirdeto.multiapro.com

Elégedetlen a könyvelőjével? Új vállalkozást tervez? Adótanácsadásra van szüksége? Ne késlekedjen, keressen bennünket! Szombathely belvárosában több mint 15 éves szakmai tapasztalattal, valamint ügyvédi és könyvvizsgálói háttér biztosításával várjuk leendő megrendelőink jelentkezését Szombathely agglomerációs körzetéből is. Ügyfeleink igénye esetén a könyvelési anyagok a vállalkozás telephelyén történő átadása lehetséges. Teljes körű számviteli szolgáltatás ellátását vállaljuk egyéni ... további részletek >>

vállalkozók, Kkt-k, Bt-k, Kft-k, Rt-k, részére.


Feladva: 2016-10-05    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzombathelyszolgáltatásszámvitelikörűTeljesKftegyénimintkönyvelőjévelvállalkozásleendőtöbbvállaljukElégedetlenanyagokvárjukbelvárosábanellátását

Forrás: pepitahirdeto.multiapro.com

Szépen kidolgozott, kecses 19 colos LCD az LG-től. Az elektronika egy része a talpban és a csatlakozó házában lett elhelyezve, így a monitor oldalról és hátulról is mutatós, nem bumszli. Bekapcsolt állapotban a talpban látható kör pirosan világít, ami nagyon mutatós. Külső tápot igényel, ezt természetesen adom hozzá. Csatlakozása DVI. Bővebben: www.sokcuc.com/list.php?id=29


Feladva: 2017-09-30    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: talpbanmutatósLCDmonitorkörelhelyezvetermészetesenkidolgozottláthatóphpletteztSzépenlistházábanigényelajánlásállapotbancomcsatlakozótápot

Forrás: pepitahirdeto.multiapro.com

Elakadt, balesetet szenvedett, lerobbant? Hívjon és segítünk! Professzionális járműveinkkel akár 1 órán belül a műszaki a mentést megkezdjük. Személyautó, teherautó, kamion, mezőgazdasági járművek mentése daruzással, emelővillával, csörlőzéssel, vontatással. Járművek elszállítása, őrzése, javítása egy helyen ha szükséges, biztosítókkal együttműködő partnerként. Alapdíj: 15000 Ft + óradíj Árainkról bővebb tájékoztatást telefonon adunk.


Feladva: 2017-01-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: KomlókamionJárművekvontatássalműszakiElakadtpartnerkéntcsörlőzésselbelülegyüttműködőemelővillávalóránJánosbiztosítókkaldaruzássalakáradunkTóthegy

Forrás: pepitahirdeto.multiapro.com

Siófok és vonzáskörzetében lévő kiadó szálláshelyek fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Több mint 1000 fényképpel a szálláshelyekről és Siófokról! - Egész évben nyitva tartó szálláshelyek Siófokon - Úszómedencével rendelkező szállások. - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó balatoni szállások, ... további részletek >>

szálláshelyek. - Weblap: www.zimmerinfo.hu/siofok/hu.htm


Feladva: 2017-11-30    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekszállásokkiadózimmerinfoSiófokvilláknyitvatartóközvetítésivendégházakévbenszálláshelynélbalatonipanziókEgészlehetőségelfogadóHotelok

Forrás: pepitahirdeto.multiapro.com

Egyedi póló nyomtatás: legyen akár születésnap, legény- vagy leánybúcsú, vagy bármilyen más alkalom, egy egyedi póló mintázása, feliratozása nagyszerű ajándék. A Pólósaroknál céges pólót is rendelhet, emblémával láthat el, a pólótervezőben meg is tervezheti. Gyors, országos kiszállítás, pamut termékek. Pólósarok.hu


Feladva: 2017-08-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: egyedipólóvagymegmintázásaakárpólótervezőbenlegyenláthatnyomtatásemblémávalegyBudapestrendelhetalkalomPétertermékekpólótmásKisspamutcéges

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! A Szuvorov Kft. édesipari termékek importálásával és forgalmazásával foglalkozik. Szeretnénk, hogy minél több helyen jelenjenek meg termékeink, ezért várjuk viszonteladók jelentkezését! Szerződött partnereinknek akár kizárólagos forgalmazási jogot tudunk biztosítani, terület megjelöléssel! Az ország távolabbi pontjain található kiskereskedelmi egységek számára, (megrendelt mennyiségtől függően) ingyenesen szállíttatjuk ki megrendeléseiket. Termékeink ... további részletek >>

megtekinthetőek a honlapunkon.


Feladva: 2016-10-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TermékeinkSzuvorovtalálhatóUramakárminélpontjainHölgyempartnereinknekhogymegrendeléseikettávolabbiTiszteltSzerződöttSzeretnénkszállíttatjukország

Forrás: pepitahirdeto.multiapro.com

Cégünk vállal minden típusú Viro zárcsere és szerelést az év minden napján gyors határidővel, díjtalan kiszállással. Az VIro zárcsere esetén 1 év garanciát vállalunk. Minőségi professzionális szolgáltatásunkat vegye igénybe akár éjjel vagy nappal. Hétvégén vagy munkaszüneti napokon is. www.zarcsere.eu/viro-zarcsere.html


Feladva: 2017-12-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: virozarcserezárcseremindenvagyhtmlakárdíjtalanigénybehatáridővelvegyegyorswwwszolgáltatásunkatnapjánhttpprofesszionálisnapokonMinőségiszerelést

Forrás: pepitahirdeto.multiapro.com

Vízcsapok javítása, mosogatók, mosdók, WC-kagylók cseréje, WC tartályok javítása, mosogató gépek és mosógépek bekötése! Szifonok, lefolyó vezetékek tisztítása, javítása.


Feladva: 2016-02-09    [Lakossági szolgáltatás]

Címkék, kulcsszavak: javításatisztításamosdókvezetékekMosogatóklefolyóVízcsapokSzifonokBudapestbekötéseIstvánmosógépekSzabógépek2525mosogató252tartályokVÍZSZERELŐ

Forrás: pepitahirdeto.multiapro.com

Szolgáltatások / akár azonnali kiszállítás: -Páncélszekrények, lemezszekrények, irodatechnikai eszközök számítógép-konfigurációk szállítása -Selejtezés, lomtalanítás -Építőanyag szállítás -Épületen, lakáson belüli átrendezés -Zongora, pianínó, valamint egyéb súlyos, nagy kiterjedésű hangszerek szállítása -Szoba vagy konyha bútorát -Lapra szerelt bútorait, Valamelyik háztartási gépét, Kerti bútorait -Irodák költöztetése -Múzeumi tárgyak biztonságos szállítása -Pénztárcabarát ... további részletek >>

szállítási árak -Tehertaxi olcsón: fix szállítási ár felárak nélkül Plató mérete: 420x220 Zárt Dobozos!3,5 tonnás alatti szállításra alkalmas! Rakodó/Rakodók: Biztosítva! Nyíregyházi Telephellyel! Szolgáltatási Terület: Magyarország egész területén! Szállítási idő: 0-24h Szombat/Vasárnap is! Hívjon bizalommal! Tóth Attila +36-30/945-2252


Feladva: 2016-12-06    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: szállításaSzállításibútoraitAttilaTehertaxiTóthTerületháztartásiakárDobozossúlyosbizalommalPénztárcabarátlomtalanításSzolgáltatásiValamelyikZárt24h

Forrás: pepitahirdeto.multiapro.com

Készbeton szivattyúzásához rendelhet nálunk beton pumpát vagy pumix-ot huszonhárom méteres gémhossztól egészen ötven méteresig, melyeket igény esetén meg is lehet hosszabbítani földre fektetett csövek összeszerelésével. Készbeton szivattyúzási óradíjainkat megtalálja weboldalunkon!


Feladva: 2014-07-04    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: Készbetonbetonarhosszabbítanihuszonháromwwwlehetpumixweboldalunkonmegvagymegtaláljaeseténpumpátóradíjainkatigénybetonszivattyúzásimelyeketnálunk

Forrás: pepitahirdeto.multiapro.com

A Nash H-Gun botzsákban egyszerre 3 darab 360-as bojlis/pontyozó horgászbotot tárolhatunk. Az extrán párnázott belsőnek köszönhetően botjaink és orsóink is tökéletes biztonságban vannak. 12 hónap garancia, számlaadás. A kiszállítás ingyenes! Webshopunkban azonnal megrendelhető: www.globalstore.hu/shop/nash-h-gun-12ft-3-rod-holldal-botzsak/ További jellemzők: - Nagyméretű külső cipzáras zseb, mely merítőszák vagy ernyő tárolására alkalmas. - Külső cipzáras zseb, melyben például ... további részletek >>

leszúrók tárolhatók. - Erős anyagokból készült, megerősített dupla varrásokkal, megbízható hosszú életű cipzárakkal. - Párnázott fogantyú, állítható vállpánt. - Alumínium merevítő a megfelelő stabilitás miatt.


Feladva: 2017-10-04    [Sport - Kemping - Túra]

Címkék, kulcsszavak: zsebcipzárasKülsőgunPárnázottnashmerítőszákpontyozócipzárakkalshopHorgászbotleszúrókvannakmelybojliséletűglobalstorepéldáulbiztonságbanmiatt

Forrás: pepitahirdeto.multiapro.com

Terhelhető aljzat szigetelés polisztirol EPS100 2cm 392Ft/m2 3cm 588Ft/m2 4cm 784Ft/m2 5cm 980Ft/m2 6cm 1176Ft/m2 7cm 1372Ft/m2 8cm 1568Ft/m2 10cm 1960Ft/m2 12cm 2352Ft/m2 15cm 2940Ft/m2 A készletről telefonon, vagy honlapunkon keresztül, emailon érdeklődjön. Országos szállítás!


Feladva: 2017-04-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: szigetelés6cm15cm980Ftaljzatszállítás2352Ft5cmTerhelhetőOrszágos12cm784Ftajánlóérdeklődjön1960Ft4cmHirdetőemailon10cm588FtPepitakeresztül

Forrás: pepitahirdeto.multiapro.com

KAMIONOS állásunk van Rosenheim környékén Általános infóink a sofőr állásokról: www.nemetmunka.hu/sofor.html Konkrétumok- SOFŐR Szerződött Bajor Speditőr partnerünk (NEM Zeitfirma, nem török, román, stb- hanem német cég) részére keresünk gépkocsivezetőt CE jogosítvánnyal és 95-ös bejegyzéssel és a kamionos álláshoz szükséges némettudással. Próbamunka nincs. Személyes állásinterjú után azonnali munkakezdés van. A telephely egy Rosenheimtől nem messze lévő faluban van. A fizetés ... további részletek >>

2000-2200€ bruttó. A cég Németországi és Olaszországi fuvarozást végez. A napidíj Németországi fuvaroknál 24€/nap nettó, Olasz fuvaroknál 34€/nap nettó. A fizetés és a napidíj együtt adókategóriától és fuvaroktól függően kb. 1800-2000€ nettóra jön ki. A telephely és Budapest között kb 600km a távolság. Hétvégi hazautazás gyakorlatilag 2 hetente lehetséges, mert az egyik héten 2 fuvar van hétfőtől péntekig, a másik héten pedig 3 fuvar van hétfő kora reggeli indulással és szombat délelőtti visszaérkezéssel. Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1./ E-mailben: info@nemetmunka.hu 2./ Ingyenes regisztrációval a következő linkre kattintva: www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3./ Telefonon munkaidőben a magyar 06 1 920 3433 ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9,00-17,00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs)


Feladva: 2017-10-14    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: Németvan8364SOFŐRnemnemetmunkawwwkamionoscégtelephelyMunkafizetésnettóhtmlnincsnapfuvaroknálmailben2000péntekigvagyhétfőtőlNémetországi

Forrás: pepitahirdeto.multiapro.com

Szeretném eladni ezt a szekrényt! Több, mint 100 éves, fából készült! Hibátlan állapotú! 40.000.- Ft. (a kombinált rész három vízszintes részből áll, szállítható!) Egerben található! Érdeklődni: 20/9680-016.


Feladva: 2017-10-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 100mintTöbbEgerbenévesELADÓrészbőlSZEKRÉNYvízszintesháromrészszekrényt016kombináltezt9680000eladniÉrdeklődniállapotúSzeretnémtalálhatóáll

Forrás: pepitahirdeto.multiapro.com

Csempézés, padlólapozás és egyéb hideg-burkoló munkák: 06/20/824-2880 és 06/30/643-6121. Kérem tekintse meg honlapomat is, amelyet a www.szladek.gportal.hu címen talál!


Feladva: 2017-06-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megCsempézéstekintseIstvánKéremSzládek6121javításatalál643Hidegburkolatcímen2880Hidegburkológportal824Hidegburkolásszladekmunkákwwwhidegburkó

Forrás: pepitahirdeto.multiapro.com

Két szintes, önálló vendégházunk a Balatontól kb. 600 méterre, a Knézich utcában található. A ház 10-13 személyes, tökéletesen alkalmas családok, baráti társaságok számára. - 5 kétszemélyes háló, - két nappali, - felszerelt konyha-étkező, - emeleti melegítő konyha, - földszinti, emeleti fürdő, - fedett terasz, - parkolás az udvarban, - grillezési, bográcsozási lehetőség, - gyermekjátékok (hinta, homokozó) - díjtalan internet csatlakozás (wifi) OTP, MKB és K&H SZÉP kártyát ... további részletek >>

elfogadunk. A szálláshelyre kutya díjtalanul hozható. A ház csak egyben bérelhető, külön szobákat nem tudunk kiadni. Létszám és a foglalni kívánt időszak megjelölésével kérje ajánlatunkat.


Feladva: 2017-12-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: házkétemeletikonyhaönállószemélyeskívántparkolásCsikóscsatlakozásutcábanfoglalniteraszközelébenhozhatóhálóinternetKnézichLétszámfedettstrand

Forrás: pepitahirdeto.multiapro.com

Nemesgulácsra keresünk több műszakba: - műanyag termékek összeszereléséhez - fröccsöntő szerszámok karbantartására - tamponnyomáshoz: gépbeállítókat, operátorokat Önéletrajzokat a HE – PA Hungary Kft. 8284 Nemesgulács, József A. u. 80. címre kérjük vagy Érd.: 0036 70 379 1602


Feladva: 2017-11-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: KftHungaryNemesgulács8284összeszereléséheztermékek1602műanyag3798211műszakba0036ÖnéletrajzokattöbbÉrdoperátorokatkeresünkvagygépbeállítókat

Forrás: pepitahirdeto.multiapro.com

1997 óta sikeresen működő balatonfüredi ingatlaniroda keres és kínál eladó ingatlanokat Balatonakarattyától Szigligetig, valamint a Balaton felvidéken és a Káli medencében.


Feladva: 2016-11-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: ingatlanokatkereskeresünkmedencébeningatlanirodaBalatoniKálibalatonfüredifelvidékenműködőBalatonsikeresenvalamintótaSzigligetig1997Balatonfüred

Forrás: pepitahirdeto.multiapro.com

Amerikában (Pennsylvania és New York államokban) szállodai és bentlakásos házvezetőnői állások, pároknak és hölgyeknek egyaránt” Leinformálható, megbízható, segítőkész!


Feladva: 2016-09-16    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: LeinformálhatóAmerikábanYorkNew8221PennsylvaniaegyaránthölgyeknekBudapestpároknakKleinállásokMirjamházvezetőnőimunkákbentlakásosszállodaisegítőkész

Forrás: pepitahirdeto.multiapro.com

Kútfúrást vállalok! Szigetszentmiklós, Szigethalom, Tököl,Halásztelek, Dunaharaszti, egész Csepel Szigeten és környékén,Délegyháza,Dunavarsány, Alsónémedi, Bugyi,Ócsa, Áporka, Kiskunlacháza, Apaj,Majosháza Budapesten és környékén,Érd, Göd,Sződ, Dunakeszi. ZÁRT ALJJAL. Minőségi szűrőkkel. A jó vízhozamú és homokmentes kút érdekében. KÉZZEL acélcsőben és helyszínen összeszerelt GÉPPEL.40mm-tõl-125mm-ig. Szivattyú telepítéssel is. SZAKMUNKA. Megfizethető árak, garanciával! Hívjon bizalommal


Feladva: 2016-05-31    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GÉPPELgaranciávalkútfúrásKÉZZELkörnyékénMinőségibizalommalKiskunlacházaHalásztelekALJJALáronHívjonÁporkaösszeszereltTökölZÁRTreálisÓcsahelyszínen

Forrás: pepitahirdeto.multiapro.com

Szeretnél egy szép tetoválást? Vagy egy régebbit javíttatnál ki? Igen? Akkor válaszd a Zen Tattoot Győrben!


Feladva: 2017-06-15    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: GyőrZenegyvagytetoválástszépGyőrbenSzeretnélTattootBarbaraválaszfotórólAkkorRajzolásjavíttatnálPortrérégebbitTetoválás

Forrás: pepitahirdeto.multiapro.com

100%-os hidegen sajtolt mákolaj eladó a préselőtől: - 1 liter 4.900 Ft. - 0,5 liter 2.500 Ft. - 0,2 liter 1.250 Ft. Bővebb információ honlapunkon...


Feladva: 2016-12-25    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: litereladómákolaj100BővebbPéter250Balogh500900préselőtőlsajtolthonlapunkonhidegeninformáció

Forrás: pepitahirdeto.multiapro.com

Már előre tart a téltől? Fázik vagy szigetel? Egy gyors, hatékony és tiszta módszert ajánlunk. Korszerű fújható szigetelés, ami nem szúr, akár 1 nap alatt, felfordulás nélkül elkészíthető. Hova ajánljuk? Borított fafödémek, padlás, könnyűszerkezetű épületek falai, födémei, nehezen elérhető épületrészek, tetőtér beépítés esetén a ferde tetőszerkezet és a gipszkarton között, gépészeti szigetelésekkel ellátott födém, ahol nehezen elérhető részek vannak. Kontaktbau - a Knauf Insulation ... további részletek >>

megbízható partnere.


Feladva: 2015-08-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: KontaktbaupadláselérhetőszigetelésnehezenépületekSzigeteléscentrumKnaufakárközöttgyorskönnyűszerkezetűszúrgipszkartonEgyvannaknemtetőszerkezetami

Forrás: pepitahirdeto.multiapro.com

Leszakadt a redőnye? Hívjon! 0670 68 08 268 Szorul? Hívjon! 0670 68 08 268 Akadozik? Hívjon! 0670 68 08 268 Gyors redőnyjavítás akár azonnal egész Győr-Moson-Sopron megye területén, szükség esetén hétvégén is. Új és régi redőnyök szerelését vállaljuk rövid határidővel (egy hét), kedvező áron. Szalag függöny, Zsalúzia, Reluxa, Napellenző, Szúnyogháló +36 70 68 08 268 Új árnyékolástechnikai berendezést szeretne, de nem tudja, kihez forduljon? Hívjon bizalommal: 15 éves tapasztalatommal ... további részletek >>

készséggel állok rendelkezésére.


Feladva: 2017-04-25    [Lakossági szolgáltatás]

Címkék, kulcsszavak: Hívjongurtnicsereredőnyjavítás268redőnyszerelés0670szúnyoghálónapellenzőhupontreluxahttpajtóműanyagGyőrredonyszredőnyökazonnalfüggönyrégiakár

Forrás: pepitahirdeto.multiapro.com

Lakókocsiját, lakóautóját és hajóját tárolja nálunk! Mi vigyázunk rá, hogy Ön nyugodtan gondolhasson a következő nyárra! Vállajuk még járművének javítását is: www.lakokocsidepo.hu/egyeb-szolgal tatasok


Feladva: 2016-08-04    [Autó - Motor - Jármű]

Címkék, kulcsszavak: hajójátlakokocsidepolakóautójáthttpLakókocsijátnyárraSzigetszentmiklóskövetkezőKftgondolhassonkenyérnyugodtanKalászhogylehetőségvigyázunktárolási

Forrás: pepitahirdeto.multiapro.com

Balatonlellén családi ház már 5 személytől max 16 főre kiadó. Családoknak ideális. Ingyenes wifi, biztonságos parkolás zárt udvarban. Ár megegyezés szerint.


Feladva: 2015-10-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: családiBalatonlellénkiadóházudvarbanzártparkolásBalatonlellebiztonságosJánoswifiSzabóIngyenesideálisCsaládoknakszerintfőremegegyezés

Forrás: pepitahirdeto.multiapro.com

Ez a vergődés ismétlődik már több éve hónapról hónapra? Változtasson rajta! Változtatás nélkül nincs változás! Ha nem változtat az életén, akkor mitől vár változást? Élni akarja az álmait vagy álmodni a céljait? Ugye nagyszerűnek tűnik, hogy hetente akár több ezer Dollárt is kereshet játszi könnyedséggel? Minden internetes munkával foglalkozó ember álma egy ilyen lehetőség, de a helyzet az, hogy az álom ez esetben mindenképpen csak álom marad. Több átveréssel is lehet találkozni az internetes ... további részletek >>

munka lehetőségek közt. Ha ilyen kétes kimenetelű ajánlatot keres, akkor csalódni fog. mert nem Önn ek szól. Munkát ajánlunk kiemelten magas fizetésért. Az okos ember előre gondolkodik, a buta a múltban él, és a még butább azt gondolja, hogy ha nem tesz semmit sem, akkor sokkal jobb lesz Neki! Sajnos ezért is sok család fog úgy élni, mint most, sok év múlva is, sőt sokkal rosszabbul! Ajánlat azoknak, akiknek komoly céljai vannak és olyan havi jövedelemre van szükségük, amelyből kényelmesen biztosíthatják családjuk megélhetését: / kb. 500.000,- / hónap / Pl: Első sorban több szabadidővel rendelkezők, kiskeresetűek széles kapcsolatokkal rendelkezők vagy több gyermekes családok, stb. Munkaidő: Heti 30 – 40 óra Egyedülálló, rendkívülien magas jutalékkal keresek olyan embereket, akik széleskörű ismeretséggel és kapcsolatokkal rendelkeznek! Jelentkezzen ha konkrét céljai vannak, mindenben segítek. Kérem, hogy az email címemen jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-05-08    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogytöbbnemakkorolyanélnivannakembercéljaimagasspórolvagyfogálombárrendelkezőkfizetésébőljelentkezzenilyenkapcsolatokkalsokkalvégéigjön

Forrás: pepitahirdeto.multiapro.com

Eladó XVI. Kerületben, egy 6-lakásos társasház alatt, főútvonalon, az Örs vezér tér közelében (Nagyiccén) 20 m2-es, komfortos garázs WC-vel, mosdóval, saját vízórával és villanyórával. Két ablak nyílik a főútvo-nalra. A billenő garázsbejáraton még egy külön nyitha-tó személybejárat is van. Ára: 3.900.000.- Ft. Tel: 06302226247


Feladva: 2017-12-25    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egygarázsXVIEladóközelébenvankerablaktérszemélybejáratBudapestKétvezérnyithaGyulavillanyórávalÖrskülönMolnárvízórávalfőútvonalonsajátmég

Forrás: pepitahirdeto.multiapro.com

Divatos női karkötők karperecek óriási árkedvezménnyel a Lili Ékszer webáruházban akár ingyenes házhoz szállítással. www.liliekszer.viltor.hu/tcslista/ karkotok


Feladva: 2018-01-11    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÉkszerLilikarkötőkházhozDivatosingyenesWEBÁRUHÁZakárAkcióswebáruházbanárkedvezménnyelóriásikarperecekszállítássalnői

Forrás: pepitahirdeto.multiapro.com

Valósítsd meg a saját projectedet szerezz támogatási összeget magán, üzleti, vagy szociális terved megvalósításához. www.youtube.com/watch?v=F4cwkaunLJ k www.bit.ly/2mZHw3Q


Feladva: 2017-05-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: httpssajátmegvalósításáhozmegtervedValósítsdszociálisNoémivagyKáldorüzleti