0.79 kis - MultiApro.com hirdetések - Ingyen apróhirdetés, egyszerűen több apróhirdető oldalra

kis

Jó vétel, Jó helyen. XXII. Kerület Kertvárosi részén 557 nm-es telken Családi Ház fele eladó. Azonnal költözhet. Az eladó Házrész 57 nm-es téglából épült, 2017-ben csatornázott, önálló – külön bejáratú Családi Ház. Fűtése egyedi fűtés. A Ház alatt 22 nm-es szuterén van. Utca felől kiskert és 16 x 14 méteres hátsó kert is van. Az eladó rész 2 külön bejáratú lakásból lett egybenyitva, bármikor 2 külön lakásként is használható. Az egyik lakás 1965-ben, a másik lakás ... további részletek >>

1981-ben épült. Ebből a 2 Lakásból áll a külön bejáratú, eladó Házrész. Mindkét lakás műszaki és esztétikai szempontból karbantartott. 2017.-ben a kerti vízórától Lakásig a víznyomócső ki lett cserélve. Mindkét lakás frissen festve. Utcai és bejárati homlokzatrész újra színezve. Utcai kerítés újrafestve. Tető utca felől újra cserepezve. Az eladó részen új eresz csatorna van. Az eladó részen új hőszigetelés van. Az eladó rész összes ablakán biztonsági rács van. A ház és telek egy 9 kamerás megfigyelő rendszerrel és riasztóval védett. A két egybenyitott lakás belső tere egyéni igények szerint bármikor átalakítható. A padlástérre 1 szint ráépíthető. A felújításra szoruló szigetelt-száraz szuterénből (valamikor Lakás volt) + 1 garzon, konditerem, varroda, műhely, iroda, szauna, kazánház, mosókonyha kialakítható. A Ház mögötti Telekrészen Hangulatos Sziklakert, Halastó, Medence, Napozó, Grillező, Kemence építhető. Igény esetén a Tetőterasz és a Padlástér is megvásárolható. Magánszemélyeknek kitűnő lakhatási lehetőség. Cégeknek kitűnő iroda, székhely, raktározási, befektetési lehetőség. Jó közlekedés, Zöldövezet, Tiszta levegő, Távol a Város zajától . Optimális pihenési-kikapcsolódási lehetőség a mindennapi rohanás után. Az Eladó Házrész vételára alku nélkül 30 Millió forint. Szuterén + 2 Millió forint. További fényképek a weboldalon...


Feladva: 2017-12-16    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: EladóLakásHázvankülönbenCsaládilehetőségrészenHázrészbejáratúrészMillióbármikorUtcaiforintLakásbólirodakitűnőépült2017szuterénújraalatt

Forrás: pepitahirdeto.multiapro.com

Szia! Szeretném a nyáron nagyon kedvelt automata váltós, klímás bérautóimat bemutatni. A www.plusautorent.hu oldalon Opel, Suzuki, Renault, Ford Cvt automatic bérautóim megtekinthetőek akár 30% mennyiségi kedvezménnyel kiadók, bérelhetők. Autókölcsönzéssel 1992-tõl foglalkozom. 100% megbízhatóság, 24 év tapasztalat az autókölcsönzésben. Bérautóimat kiszállítom a bérlőnek a címére. Tel: +3630 9488730 Hello! I would like the summer is very popular with automatic transmission, air ... további részletek >>

conditioned rent a car present. The www.plusautorent.hu page Opel, Suzuki, Renault, Ford CVT automatic rent a car viewed by up to 30% volume discount publishers hired. Car rental deal since 1992. 100% reliability, 24 years of experience in car rental. I rental cars deliver the address of the tenant. Tel: +3630 9488730 Rent a car in Hungary, Budapest Hallo! Ich möchte den Sommer sehr beliebt ist mit Automatik-Getriebe, Klimaanlage Mietwagen vorhanden. Die www.plusautorent.hu Seite Opel, Suzuki, Renault


Feladva: 2017-12-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: carthe245RenaultSuzukirentalOpelRentplusautorentautomaticwwwBudapestBérautóimat9488730CVT3630100FordTel1992tenantHellovorhandensince

Forrás: pepitahirdeto.multiapro.com

Olcsó bérautónk sokkal tisztább és biztonságosabb, mint a tömegközlekedés MÁV, Volán, BKK, BKV igénybevétele. Autókölcsönzõnk májusi akciójában Renault Clio bérautónkat napi csak 3.000,- Forintért adjuk az átvételtõl számítva 24 órára. Bérautónk www.pluszautorent.hu autókölcsönzés oldalon. Automataváltós olcsó bérautók. Autókölcsönzõnket megbízhatóság, pontosság, jellemzi. Opel Ford Suzuki, Renault, Skoda, Chevrolet bérautók jó áron. Tel: +3630 9488730 www.plusautorent.hu Car hire ... további részletek >>

in Budapest. Válasszon a tiszta, jó, szervizelt, karbantartott olcsó bérautókból. Hosszú autóbérlés esetén akár 30% kedvezmény is igénybe vehetõ. Rövidebb bérlésnél is lehet 10%, és 20% akciós árat igénybe venni. Autóbérlés Budapesten, Pest megyében és a Ferihegyi Liszt Ferenc Nemzetközi repülõtérre kiszállítással. Válasszon bérautóink közül amelyek, 3, 4, 5, 6, 7 személyes, klímás, automata vagy kézi váltós, személyautó vagy kis tehergépkocsi, Kicsi economy, nagy luxus bérautók kölcsönzése. Bérelhetõ autótípusok Opel Corsa C 1.2, a hölgyek kedvenc bérautója. Kicsi helyre is könnyû parkolni vele. Suzuki Ignis 1.3, erõs fürge, pörgõs bérautó. Opel Vectra B 1.6 automata váltós, nagy 4 ajtós kölcsönautó. Ford Focus C-MAX 1.6 HDI Dízel fokozatmentes automataváltós CVT, egyterû. Nagyon alacsony a fogyasztása. Autókölcsönzõ Magyarországon kiszállítással. Suzuki Swift 1.3, a MI autónk a magyarok kedvence. A legolcsóbb bérautó klíma nélkül. Renault Clio 1.4, erõs 74 kw-os motorral.Renault Scenic1.6 Automataváltós egyterû bérautó. Kombi van. Opel Vectra C 2.2 nagy 114 kw szedan, erõ és biztonság jellemzi. Gépjármûkölcsönzés 1992-tõl. Chevrolet Aveo 1.2 kicsi gazdaságos, ezüst bérautó. 5 személyes. Skoda Fabia 1.2 Benzin Gáz LPG üzemû, hatchback 5 ajtós. Személyautó bérbeadás. Opel Vivaro 1.9 dízel 6 személyes kisteherautó. Az ülések gyorsan, könnyedén kiszedhetõek, így a rakodó tér kétszeresére növelhetõ. B személygépkocsi jogosítvánnyal vezethetõ. Renault Espace 2.2 dízel automata váltós 7 személyes bérautó. Klíma, cd tár, navigáció stb. A felsorolás nem teljes kérem, nézze meg a www.plusautorent.hu autókölcsönzõ weboldalunkat is.


Feladva: 2017-12-09    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 245251RenaultOpelbérautóautókölcsönzszemélyesolcsóSuzukiAutomataváltóskiszállítássalwwwAutóbérlésbérautókváltósnagyautomatakicsidízelChevrolet

Forrás: pepitahirdeto.multiapro.com

Az ekcéma okai nagyon változatosak, hiszen külső és belső tényezők egyaránt vezethetnek a kellemetlen tünetekkel járó bőrbetegség kialakulásához. Egyes anyagok, genetikai hajlam, túlérzékenység is állhat a hátterében. Az ekcéma tünetei ellen a Manuka Derma Krémben megtalálható orvosi manuka méz alkalmazása ajánlott a komplex kezeléshez. Ha rendszeresen használjuk, nemcsak a tüneteket - viszketés, bőr kipirosodása, kiszáradása, gyulladása - enyhíthetjük, de a fertőzések kialakulását is ... további részletek >>

megelőzhetjük. Ebben a manuka méz rendkívüli antibakteriális hatásáé a főszerep. Az ekcéma okai és tünetei bővebben weboldalunkon! www.atopias-dermatitisz.ekcemakrem.hu/ekcema-tunetei


Feladva: 2017-12-04    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ekcémamanukaméztüneteiokaiorvosiellenrendszeresenállhatfertőzésekvezethetnekkezelésheztúlérzékenységenyhíthetjükegyarántkomplexfőszerephajlambőr

Forrás: pepitahirdeto.multiapro.com

Nagyszabású lakóparki beruházások kivitelezéshez keresünk építőipari és építőipari kiegészítő-tevékenységet végző, tapasztalt alvállalkozókat, valamint szakipari munkákhoz vállalkozásokat, szakembereket a kisebb munkákhoz is. Ajánlati szám: VSZ/00160/16/07


Feladva: 2017-12-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: VSZmunkákhozépítőiparikeresünklakóparkiNagyszabásúalvállalkozókatkivitelezőt00160tapasztaltberuházáshozvégzőszámtevékenységetAjánlatikiegészítőkisebb

Forrás: pepitahirdeto.multiapro.com

Megszaporodnak a hamis internetes áruházak - figyelmeztet G DATA. Ezek jó esetben csak silány minőségű terméket szállítanak, rossz esetben viszont bankkártyaadatainkat is ellopják, e-mail címünket pedig levélszeméttel árasztják el. Tipikus átverési forgatókönyv, hogy a Facebookon találkozunk egy rendkívül kedvezőnek látszó hirdetéssel – a legnagyobb közösségi oldal az átverős hirdetések egyik legaktívabb kiszolgálója lett... A teljes cikk: ... további részletek >>


Feladva: 2017-11-24    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: megszaporodtakesetbenwwwkeresőnkbenTipikusteljesszállítanakhirdetésselMegszaporodnaktartalmakárasztjáklettterméketlátszóajánlóhasonlólevélszeméttel

Forrás: pepitahirdeto.multiapro.com

Azonnali bőröregedés-csökkentés! Mindössze 20 perc alatt - Serox csodamaszk! Azonnal látható és érezhető bőröregedés-csökkentő hatás, mindössze 20 perc alatt. - Aktiválja a bőrt - Kisimítja és rugalmasabbá teszi a bőrt - 12 óráig tartó hatás! - 3 fázisos technológia Az azonnali hatás titka: A csalán kivonat már rögtön a maszk felvitele után serkenti a vérkeringést. Hűsítő, viszkető érzést fogsz tapasztalni. A bőröregedés-csökkentő hatóanyagok optimálisan szívódnak fel ... további részletek >>

és fejtik ki hatásukat. A bőrkép frissebb és fiatalosabb lesz. Az ásványi anyagok a 20 perces hatóidő alatt azonnal láthatóan és érezhetőn rugalmasabbá varázsolják a bőrt. Az értékes protein-komplex pedig szabadjára engedi a hírvivőanyagokat, melyek az idegvégződéseket és az idegpályákat átmenetileg blokkolják. Így az izmok ellazulnak, a mimikai ráncok pedig kisimulnak. Simább és rugalmasabb bőrmegjelenés. Ha hosszú távon fiatalos megjelenésre vágysz...


Feladva: 2017-11-22    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: Zeitgard990csökkentőbőröregedéskrémzselébőrhatásKívánságlistáraSzéptartótenniCikkszámbőrképakárszeretnélSystemSzebbóráigkosárbaBeautyalatt

Forrás: pepitahirdeto.multiapro.com

ALOE VERA BABAÁPOLÁS! A szett tartalma: - Aloe Vera baba arc és testápoló érzékeny bőrre - 100 ml - Aloe Vera habfürdő és sampon érzékeny bőrre - 250 ml - Aloe Vera baba krém érzékeny bőrre - 100 ml A három termék együtt: 7990 Ft A babák és a gyerekek gyengéd bőre nagyon érzékeny, hiszen még fejlődik! Ahhoz, hogy megfelelően védjük, fontos az alapos ápolás. A termékcsalád ápoló termékei 40%, a tisztító termékei pedig 30% aloe verát tartalmaznak. Kíméletesen ápolják az érzékeny ... további részletek >>

bőrt. A bio calendula kivonat regenerálja és védi a bőrt. A bőrbarát termékek nem tartalmaznak parabént és ásványi olajokat. Védik a bőrt a kiszáradással szemben, hiszen elegendő nedvességgel látják el. A mamák teljes körű ápolására is gondolva: a termékcsalád egy masszázs balzsamot is tartalmaz, melyet az anyukák terhességtől megviselt bőrére lett kifejlesztetve. A balzsam ideálisan ápol és támogatja a bőr rugalmasságát. A babák bőrén is használható!


Feladva: 2017-11-22    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: aloeveraérzékenybabacalendulaBABAÁPOLÁStermékcsaládbőrrebőrtbabáktartalmaznakmelyetbőrmártermékeihiszen100ápolókrémelterjedtfejlesztettünk

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Tökéletesen tisztítja a többféle felületet. Univerzális alkalmazású: fürdőszoba, konyha, terasz és erkély. Használja fazekakhoz, odaégett maradékokhoz, mosogatókhoz, üvegekhez, porcelánhoz. Erős és biztonságos - a biológiailag lebomló. Nagyon szennyezett, pl. kenőanyagokkal szennyezett kezet is lehet vele mosni 500 g-os kiszerelésben. ERŐS ÉS BIZTONSÁGOS - KÉZKÍMÉLŐ - KÖRNYEZETBARÁT Azért is foglalkozom vele, mert én is használom a saját háztartásomban. Emellett keresek pénzt is vele, ... további részletek >>

mert megismertetem mindazokkal, akiket szintén érdekel...


Feladva: 2017-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: veleBIZTONSÁGOSERŐSUniverzálisszennyezettmertkonyhapasztabiológiailagfürdőszobapénztlebonthatóporcelánhozalkalmazásúkeresekkiszerelésbenzöld500

Forrás: pepitahirdeto.multiapro.com

Cégünk személyszállítást vállal kényelmes, 9 személyes mikrobuszokkal. Extra nagy csomagtérrel, dupla klímával, állítható ülésekkel, TV-vel, DVD lejátszóval. Buszainkon 220 voltos töltés lehetőség. Kedvező, 0% os áfás számlás árak. Fiatal korszerű, Euro 4-es motorral felszerelt, biztonságos kisbuszok, képzett hivatásos sofőrök, komoly referenciák.‪


Feladva: 2017-10-10    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: áfáscsomagtérrelképzettmikrobusszalKedvezőnagykisbuszokSzemélyszállítástöltésExtrabiztonságosvoltosmikrobuszokkalfelszerelt220személyesmotorralvel

Forrás: pepitahirdeto.multiapro.com

Miért érdemes még hozzánk jönni? ⋅ mert ha valamit nincs nálunk, azt 24-48 órán belül megszerezzük ⋅ mert termékigényét eljuttathatja hozzánk a webáruházon keresztül, vagy e-mail-en, amit aztán célba juttat egy futár, esetleg átveheti egy PickPackPont-on, de akár személyesen is ⋅ mert üzletünkben van: spirálozás, fénymásolás, laminálás, nyomtatás, bélyegzőkészítés és szkennelés, (e-mail-ben juttassa el hozzánk dokumentumait majd a kész kötészeti anyagot vegye át a ... további részletek >>

futártól, vagy a PPPonton. ⋅ mert szakmai tanácsot is adunk (térítés nélkül!). Aki inkább a hagyományos vásárlást részesíti előnyben, azt szeretettel várjuk kiskereskedelmi üzletünkben: 1133 Budapest, Dráva u. 5/d. H - CS: 9.00 - 17.00; P: 9:00 - 16:00 óra között.


Feladva: 2017-10-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: mert8901hozzánkaztvagymailBudapestegyüzletünkbennélkülesetleganyagotbelülnyomtatásajánláskiskereskedelmitérítésfutárkötészetióránlaminálás

Forrás: pepitahirdeto.multiapro.com

A Nash H-Gun botzsákban egyszerre 3 darab 360-as bojlis/pontyozó horgászbotot tárolhatunk. Az extrán párnázott belsőnek köszönhetően botjaink és orsóink is tökéletes biztonságban vannak. 12 hónap garancia, számlaadás. A kiszállítás ingyenes! Webshopunkban azonnal megrendelhető: www.globalstore.hu/shop/nash-h-gun-12ft-3-rod-holldal-botzsak/ További jellemzők: - Nagyméretű külső cipzáras zseb, mely merítőszák vagy ernyő tárolására alkalmas. - Külső cipzáras zseb, melyben például ... további részletek >>

leszúrók tárolhatók. - Erős anyagokból készült, megerősített dupla varrásokkal, megbízható hosszú életű cipzárakkal. - Párnázott fogantyú, állítható vállpánt. - Alumínium merevítő a megfelelő stabilitás miatt.


Feladva: 2017-10-04    [Sport - Kemping - Túra]

Címkék, kulcsszavak: zsebcipzárasKülsőgunPárnázottnashmerítőszákpontyozócipzárakkalshopHorgászbotleszúrókvannakmelybojliséletűglobalstorepéldáulbiztonságbanmiatt

Forrás: pepitahirdeto.multiapro.com

Sok menyasszony nem tudja, hogy egy parfümvásárlás sokkal összetettebb annál, minthogy a drogéria polcáról leemeljük a pénztárcánkhoz illő, külsőre a leglátványosabbnak bizonyuló kis üvegcsét. Egy illatnak lelke, ereje, és története van. Minden esszencia megkomponálása során szakértő parfümőrök együttes erővel dolgoznak azon, hogy minőséget, harmóniát és szépséget zárjanak egy-egy fiolába. Ilyen illatmágusok készítik a világ luxusmárkáinak, a nagy divatcégeknek illatait, és (bármilyen lelombozó) ... további részletek >>

a sztárok nevével fémjelzett parfümöket is... Itt többet is olvashatsz: www.eskuvoclassic.hu/menyasszony-parfum-kisokos-talald-meg-illat-ami-az-oltarhoz-kiser


Feladva: 2017-10-03    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: egyhogyillatmenyasszonyzárjanakösszetettebbeskuvoclassicsoránillataitbizonyulószépségetsokkalwwwmegkomponálásadivatcégeknekleglátványosabbnakkiser

Forrás: pepitahirdeto.multiapro.com

Ha Hévízre kíván jönni, nálunk kényelmes családias elhelyezésben részesül. Közel a belvároshoz, 500 m-re a tótól kínálunk kétágyas, fürdőszobás, erkélyes szobákat. Reggeli, kisebb étkezések elkészítésére lehetőség van, az udvarban pedig parkolási lehetőség. Részletesebben honlapunkon, illetve az elérhetőségeinken. Keressenek bennünket telefonon, vagy e-mailben, egész évben szeretettel várjuk vendégeinket!


Feladva: 2017-10-02    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: 245séglehetségeinkenkívánvanvendégeinkettótólHévízreelkészítésérevárjuk500elérhetHévizétkezésekszeretettelbelvároshozillZoltánnékisebbévben

Forrás: pepitahirdeto.multiapro.com

RYOBI láncfűrész RCS4235B 5133001880 * Erőteljes PoWR XT 2 ütemű 42 cm3 motor * 3 pontos anti-vibrációs védelem a kezelő kényelméért és csökkenti a fáradtság érzetét a hosszan tartó munka során * Automatikus rugós láncfék a megnövekedett biztonságért * Szerszám nélküli láncfeszesség állítás * Átlátszó burkolat az olajtartályon, hogy a lánc és a vezetőlap kenése mindig meglegyen * Kulcs Hengerürtartalom: 42 cm3 Teljesítmény: 2.3 Le Láncvezető hossza: 35 cm Lánc sebessége: 23.8 ... további részletek >>

m/s Láncfeszesség állítás: szerszám nélkül Üzemanyagtartály: 0.34 l Olajtartály: 0.192 l Súly: 4.7 kg Garancia: 3 év Bruttó eladási ár: 64 900 Ft. Ingyenes kiszállítás! Megrendelhető: www.ryobi.hu/lancfuresz/ryobi_rcs4235b.html


Feladva: 2017-09-30    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: ryobicm3szerszámláncfűrészállításLáncfeszességLáncrcs4235bSúlytartóLáncvezetőmotorburkolat192hosszanTeljesítményüteműlancfureszÁtlátszóérzetét

Forrás: pepitahirdeto.multiapro.com

CSOMAG TARTALMA: - 1 db Xbox One S konzol 500GB tárhellyel, fehér festéssel - 1 db újfajta Xbox One vezeték nélküli kontroller fehér festéssel - 1 db Forza Horizon 3 letölthető játékszoftver - 1 db tápegység - 1 db tápkábel - 1 db HDMi kábel - 2 db AA ceruzaelem az irányítóhoz - USB 3.0 port, 2 db HDMI port, beépített Wi-Fi vezeték nélküli kapcsolat - Dokumentációk, üzembe helyezési útmutató - 14 napos Xbox Live arany próba tagság Az Xbox One S kisebb és takarékosabb ... további részletek >>

formában hozza el az újgenerációs játékokat TV készüléked képernyőjére! 40%-kal kisebb méretével, beépített tápegységével és megújult vezeték nélküli kontrollerével az Xbox One S még kívánatosabb, ráadásul olyan új funkciókkal került kibővítésre, mint a HDR támogatás, amely még teltebb színeket biztosít, valamint az infravörös adóvevő. További információ: www.mkonzol.hu/xboxone/xbox-one-s-500gb-forza-horizon-3


Feladva: 2017-09-30    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: xboxonevezetékhorizonforza500gbnélkülifestésselportfehérbeépítettHDMIkisebbmégüzembetámogatásjátékszoftverajánlásinformációhozzaDokumentációk

Forrás: pepitahirdeto.multiapro.com

Hölgyeim, Uraim! Engedjék meg, hogy fegyelmükbe ajánljam ezt az új építésű lakást, melynek LEGYEN Ön az első új tulajdonosa. Először is hadd vezessem körbe leendő otthonában. Kezdjük hát körutazásunkat. Miután be jöttünk a kapun és kényelmesen le parkoltunk a házunk előtt a saját parkolónkba már csak néhány lépést s bent is vagyunk a lakásunkban. Itt egy kényelmes elő térben találjuk magunkat, ahol kényelmesen le vehetjük a cipőket és kabátokat. Balra fordulva találjuk a lépcsőt, amin kicsit ... további részletek >>

később a felső szintre fogunk fel menni. A lépcső mellett találunk egy kicsi tárolót ahol akár a kabátokat tárolhatjuk. Forduljunk jobbra ahol egy másik ajtó található ahol is a háztartási gépeknek adhatunk otthont. Majd tovább haladva egyenesen egy tágas Amerikai konyhás nappaliban találhatjuk magunkat. Itt van elég hely, hogy kényelmesen tudjunk sütni, főzni, sőt egy étkező asztal is kényelmesen elfér. Innen nyílik továbbá egy kisebb terasz is ahol igazán remekül élvezhetjük a reggeli adta ébredés idejét. Hiszen fontos, hogy jól induljon a napunk. De nézzük meg a felső szintet is ahol az éjszakánkét töltjük. Itt a felső szinten három kényelmes szoba található, amit kényünk kedvünk szerint használunk. Mind A három szoba világos és tágas is. Így kényelmesen tudjuk elhelyezni a bútorainkat. Ami elengedhetetlen a tökéletes pihenéshez. Tetszett? Nézzük meg személyesen is.


Feladva: 2017-09-28    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egyaholkényelmesenhogyfelsőIttmegtalálhatóNézzüktágaskényelmeskabátokatszobahárommagunkattaláljukigazánjobbraparkolónkbaKihagyhatatlanÍgy

Forrás: pepitahirdeto.multiapro.com

Szeretettel várok minden új és régi vendégemet újonnan nyílt szalonban :) Bejelentkezni ezen a telefonszámon tudtok : +36 70 626 1434


Feladva: 2017-09-28    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: régi1434minden626vároktudtokSzeretetteltelefonszámonBudapestezenÉvaBejelentkezniGázerszalonbanVicuskutyakozmetikanyíltújonnanvendégemet

Forrás: pepitahirdeto.multiapro.com

Webáruházunkból a kiszállítás 1-2 munkanap. A termék rövid leírása: - kötött - 95 % poliészter - 5% elasztán - Nincs méretezve S/M kis L méretre ajánlott (36-38 kis 40) A termék készleten: www.adryfashion.hu/Bezs-fekete-cir tas-atlapolt-noi-tunika-kotott


Feladva: 2017-09-28    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: feketeBézskisterméktunikakötöttnőicirtásNincsméretezvekiszállításméretreWebáruházunkbólmunkanapajánlottajánláskészletenHirdetőrövidwwwPepita

Forrás: pepitahirdeto.multiapro.com

Egy világméretű üzletet már ellehet kezdeni 15.000 forinttal! Te szeretnél pénzt keresni, vagy még dolgozni akarsz apró pénzért? Ez egy vásárlói közösség. Ha tovább ajánlod a kártyát, milliós jövedelmed származik abból is. A lehetőség korlátlan, te döntöd el mit választasz a pénz kereset szempontjából, 12 féle lehetőség közül választhatsz!!!! Skype: kollar.klara a további információ itt: www.forevergreen.cafeblog.hu/2017/ 09/27/van-egy-jo-munka-en-ezt-megle ptem


Feladva: 2017-09-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: egylehetőségmárüzletetvilágméretűforinttal000kezdeniellehetszármazikakarszjövedelmeddolgoznifélemilliósmégszempontjábólkártyátittvagykereset

Forrás: pepitahirdeto.multiapro.com

Nem érzed magad biztonságban? Úgy érzed veszélyben van az életed? Van megoldás!!! Egy különleges harcművészet. A leghatékonyabb önvédelmi technikák. Az alapok 6 hónap alatt elsajátíthatóak. A támadó erejét használd fel a győzelemhez! - Önvédelmi tanácsok - Utcai szituációk kezelése - Jogtalan támadások elhárítása - Pszichikai felkészítés Ne legyél áldozat!


Feladva: 2017-09-26    [Sport - Kemping - Túra]

Címkék, kulcsszavak: BajaÖnvédelmiVanönvédelemérzederejétmegoldástámadásokNemtámadó06304670677JogtalanBajánelsajátíthatóakInfoválságindulkezelésealattvégéighónap

Forrás: pepitahirdeto.multiapro.com

Szeretettel várunk minden négylábú barátunkat! Egyszerre 3 kistestű és 1 nagytestű kutya gondozását, foglalkoztatását és elszállásolását tudjuk vállalni.


Feladva: 2017-09-23    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: vállalninégylábúCSIMAbarátunkatTANYAEgyszerreKutyapanziókistestűPepitanagytestűHirdetőkutyaajánlógondozásátVérteskethelyfoglalkoztatásátSzeretettel

Forrás: pepitahirdeto.multiapro.com

Mindennemű régiség felvásárlása azonnali készpénz fizetéssel: antik bútor, festmény, szőnyeg, szobor (fa, bronz), óra,(kar, asztali és fali álló), ezüst tárgy, (gyertyatartó, cukordoboz, tálca, evőeszköz, hiányos is) porcelán (Herendi, Zsolnay, Meissen) arany ékszer (fél drága, drágaköves, törtarany is), csillár (asztali, álló, fali lámpa) zongora, régi tv, rádió, bélyeg, kitüntetés, képeslap, írógép, varrógép! Lakásokat, házakat hagyatékkal együtt is megvásárolunk! Cim: BP. 1137. SZENT ... további részletek >>

ISTVÁN KRT. 12 ARANY-EZÜST VÉTEL: NE ADJA EL ÉKSZEREIT TÖRT ARANY ÁRBAN, MERT MI FAZONARANYKÉNT MAGASABB ÁRON MEGVÁSÁROLJUK ÖNTŐL, TOVÁBBÁ ÜZLETÜNK VILÁGPIACI ÁR FÖLÖTT VÁSÁROL TÖRT ARANYAT, BEFEKTETÉSI ÉRMÉT, FOGARANYAT, ILLETVE BÁRMILYEN ARANYAT, KARÁTSZÁMTÓL ÉS MENNYISÉGTŐL FÜGGETLENÜL!!! BUDAPESTEN ÉS VIDÉKEN IS. A KISZÁLLÁS DÍJTALAN. Tel.: 06702862076,


Feladva: 2017-09-22    [Régiség - Művészet]

Címkék, kulcsszavak: ARANYTÖRTARANYATfaliállóEZÜSTasztaliantikVIDÉKEN1137cukordobozbélyegfizetésselMERTdrágaBUDAPESTENCimgyertyatartóVÁSÁROLrádiókészpénzÁRBAN

Forrás: pepitahirdeto.multiapro.com

PC játékok óriási választéka a Konzolvilágban, pénztárcabarát árak és speciális kiadások. Kiemelkedő kiszolgálás, gyors és megbízható futárszolgálat.


Feladva: 2017-09-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: játékokpénztárcabarátKonzolvilágbanválasztékafutárszolgálatóriásimegbízhatógyorsajánlókiszolgálásHirdetőKiemelkedőPepitakiadásokKonzolvilágspeciális

Forrás: pepitahirdeto.multiapro.com

Vásároljon első kézből a Devon fürdőszobabútorok magyarországi forgalmazójától, nagy és kiskereskedelmi kiszolgálás, kedvező ár! Fürdőszobabútoraink széles választékával várjuk önöket csepeli raktár áruházunkban. Bútoraink festett fényes fehér MDF előlappal rendelkeznek, lapraszerelt állapotban, karton dobozban kerülnek átadásra. www.majerszerviz.hu/furdoszobabuto r.html


Feladva: 2017-09-19    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: furdoszobabutorDevonválasztékávalkézbőlMDFszélesmajerszervizelsőfehérFürdőszobabútorainkwwwVásároljonfényeskedvezőátadásraajánlófestettkiszolgálás

Forrás: pepitahirdeto.multiapro.com

Azok számára állítottuk össze kezdő csomagjainkat, akik most vágnak bele a kisállat tartásba. A csomag tartalmaz minden, a felelős állattartáshoz szükséges kelléket. A Cavie 60 a Ferplast több éves fejlesztése. Strapabíró, praktikus és rendkívül esztétikus tengerimalac ketrec. Magas peremmel rendelkezik, így a kiszemetelés esélye minimális. Tálcája erős minőségi műanyagból készül, tisztán tartása könnyű. A csomag tartalmazza: -Felszerelt Cavie 60 ketrec /1db 300ml-es csepegésmentes ... további részletek >>

önitató, 1db szénarács/ -Fogkoptató kő /Panzi,55gr/ -Tengerimalac eledel /Panzi, 1000ml/ -Réti széna /350g/-Fenyőforgács /5L/ Színekről érdeklődjön elérhetőségeinken.


Feladva: 2017-09-18    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: tengerimalacketrecCaviePanzicsomag1dbtengerimalacnakkezdocsomagmindenerősállítottukkisallatokpraktikus1000mltartalmazTálcájaszámárawebshopAzok

Forrás: pepitahirdeto.multiapro.com

Grundig Vch 9131 2-in-1 14.4V típusú akkumulátoros porszívó. - Nagy teljesítményű és hosszú élettartamú 14,4 V-os NiMH újratölthető akkumulátor - Nagy teljesítményű elektromos kefe - Működési idő: Kb 25perc - Portartály: 500ml - Hatékony szűrőrendszer ciklontechnológiával és mosható HEPA szűrővel - Kivehető morzsaporszívó - Számlával, fél év jótállással és 14 napos pénz visszafizetési garanciával. Ingyenes házhoz szállítással megrendelhető az alábbi linken: ... további részletek >>


Feladva: 2017-09-18    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: akkumulátorosporszívó9131teljesítményűVchNagyGrundigporszivokIngyenesKivehetőakkusMűködésiházhozszűrővelkefetípusúszállítássalHEPAelektromoswww

Forrás: pepitahirdeto.multiapro.com

Fürjtápot keres? Nálunk az is van: 159,- Ft/kg A holland De Heus takarmányokat már Magyarországon is megvásárolhatja. Kiváló minőség és széles áruválaszték jellemzi. A fürjtáptól a lótápokig minden állatfajnak tudunk tápot biztosítani. Kiszállítás megoldott, viszonteladókat is kiszolgálunk.


Feladva: 2017-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: keresKiszállításKiválóFürjtápottápotmegoldottmegvásárolhatjaPadragkúttudunkviszonteladókatMagyarországonAjkaállatfajnakkiszolgálunkmárajánlóminden

Forrás: pepitahirdeto.multiapro.com

Tobozalapokat készítünk, ami lehet: tányéros, púpos. Készítünk tobozból készült koszorúkat is. Áraink: 10.-, 11.- és 12 Ft/cm. Ez attól függ, hogy kell-e lakkozni, vagy nem.


Feladva: 2017-09-17    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: TobozalaphogyLászlófüggEndrődiés12FTkoszorú303887027telElérhetőségpúpostnemtányérostvagykészítünklakkoznikellLadánybene

Forrás: pepitahirdeto.multiapro.com

Fürdőszoba átalakítás, felújítás, tetőtér beépítés, laminált padlóburkolás rövid határidővel. Kisebb munkák, tetőpárkány, homlokzatfestés, javítás.


Feladva: 2017-09-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: homlokzatfestésátalakítástetőpárkányFürdőszobamunkákCsornaKisebbFerenchatáridővelErdészrövidparkettázáspadlóburkolásfestéslamináltBurkolásbeépítés

Forrás: pepitahirdeto.multiapro.com

Munkatársakat keresek vásárlói közösségbe, azonnali kezdéssel interneten vagy katalógusból ajánlással történő munkára! Nincs kötelező havi vásárlási kényszer. Fő és mellékállásban is végezhető, rugalmas időbeosztásban! Csak egy számítógép vagy okostelefon kell hozzá! A bevételed a befektetett munkával arányosan növekszik! Sokan el sem tudják képzelni, hogy átlag fizetésnél többet vigyenek haza, pedig ez lehetséges csak jó helyen kell dolgozni. Ha valós internetes munkát keresel és ... további részletek >>

tényleg szeretnél dolgozni, keress bátran! Írj a üzenetet, vagy regisztrálj a megadott oldalon.


Feladva: 2017-09-14    [Pénzkeresés - MLM]

Címkék, kulcsszavak: vagykellcsakdolgozniregisztráljmunkávalkényszerkereselazonnalitöbbetbefektetettvásárlásimunkátközösségbefizetésnélcímrebevételedhaviinternetes

Forrás: pepitahirdeto.multiapro.com

Neked most fáj a hátad? Nem érsz rá, mikorra kapnál időpontot? Vagy csak most lenne időd egy kis masszázsra? Hívj! Vagy mentsd el a számomat, hogy kéznél legyen, amikor kell! imerít a mindennapos rohanás? Vagy fásulttá tesznek a szürke hétköznapok? Már régen érezted szeretve magadat? Ha olyan masszázsra vágysz, ahol érzed, hogy szeretettel vagy érintve, akkor jó helyen jársz :) Ebben az órahosszában a figyelmem csak a tiéd, aminek hatására teljesen kipihentnek, ... további részletek >>

ellazultnak fogod érezni magadat. A relaxált állapot már önmagában is beindítja a szervezet regeneráló folyamatait, aminek hatására gyógyulások mennek végbe a legkülönbözőbb területeken. Ezt még fokozhatjuk azzal, hogy a kezelés elején immunerősítő energiákat indítok el, ami a masszírozás ideje alatt végig dolgozik a test izmaiban, sejtjeiben. Aki erre vágyik, szívesen jön vissza újra és újra és újra ... Ha kipróbálnád Te is, szeretettel várlak Kecskeméten a Széchenyivárosban csendes környezetben.


Feladva: 2017-09-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vagyhogyújramostszeretettelmagadathatásáraaminekcsakmármasszázsraolyanLauravárlakmennekrelaxáltkellizmaibanEbbenelejénszeretveTündeamikor

Forrás: pepitahirdeto.multiapro.com

Budapestiek figyelem! Ha szeretne egy csendes kisvárosban élni, vagy nyaralót venni, itt a lehetőség! Gyomaendrődön, a vizek városában, 20 m-re a holtághoz közel - ami intenzíven telepített (harcsák, amurok, pontyok és más ragadozó halak vannak) 80 nm-es ház eladó. Az ingatlan a 60-as években épült, vegyes a falazata tégla, illetve vályog 50 cm-es falvastagsággal. Nyáron hűvös, télen meleg... Nem repedezett, penészes, 2006-ban nyílászáró csere, burkolás, festés és háromfázisú áram ... további részletek >>

lett bevezetve. Az udvari rész 1400 nm, melyben sok gyümölcsfa, alsó épület, garázs található. Családoknak is ajánlom, CSOK igénybe vehető. Az ingatlan per és teher mentes. Nos kíváncsiak, hogy mennyi az ára? Bútorral is eladó 10 millió forint, bútor nélkül 9 millió forint. Komoly érdeklődés esetén az árból engedek!


Feladva: 2017-09-11    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóvárosábanvizekingatlanházmennyi2006holtághozárbólajánlomilletvekisvárosbanudvarihalakbútorralhogypenészes20mengedekcsaládoknaktéglaegy

Forrás: pepitahirdeto.multiapro.com

A Penda 1997. februárjában a Betéti Társaság-ból Kft.-vé alakult, mely a mai napig is 100%-ban magyar tulajdonban van. A vállalat immár 20 éve a termelőeszköz forgalmazók és felhasználók igényeinek kielégítésére törekszik. Húzó termékeink: rendsodrók, szárzúzók, ekék, traktorok, rendkezelők, kaszák, bálázók, pótkocsik, permetező gépek, vetőgépek. Négy telephelyen, Békéscsabán, Kecskeméten, Kiskunmajsán és Nagykőrösön szerződéses partnereink raktározzák és adják ki áruinkat.


Feladva: 2017-08-31    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: PendaKftekékszárzúzókrendsodrókáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetétitörekszik

Forrás: pepitahirdeto.multiapro.com

Megbízható józan életű villanyszerelő brigád munkát vállal. Lakás, házak teljes elektromos hálózatának kiépítése (akár szükséges ELMÜ ügyintézéssel), igény szerint internetes hálózat, riasztók, kamerák, kaputelefonok telepítése. Budapest területén és vonzáskörzetében.06203535368 Kivitelezők jelentkezését is várjuk. 06203535368


Feladva: 2017-08-30    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 06203535368LakásKivitelezőkigényvállalvonzáskörzetébenügyintézésselmunkátterületénELMÜbrigádBudapestszükségesvillanyszerelőtelepítéseakáréletűjózan

Forrás: pepitahirdeto.multiapro.com

Paprikakrémek és chili szószok fantasztikus kínálata a Kolbászáruházban! Minden termékünk kistermelői, kézműves termék! Kóstold meg finom szószainkat! Az édestől az extra csípősig! Házhozszállítás, utólagos fizetés!


Feladva: 2017-08-29    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: chiliPaprikakrémektermékBudapestfizetéskézművesKolbászáruházutólagoskistermelőiszószHázhozszállítástermékünkKolbászkrémcsípősigMindenextraédestől

Forrás: pepitahirdeto.multiapro.com

A fogyókúra étrend követése során el kell felejtenünk a cukrot. Míg korábban a kávét, a kakaót, a teát előszeretettel cukroztuk, nem beszélve a házilag készült süteményekről, melyekből szintén nem sajnáltuk a fehércukrot, a fogyókúra étrend valami egészen másnak a kezdete. Egy olyan életmódnak, melyben a cukrot egészségesebb édesítővel váltjuk fel vagy hozzáadott formában teljesen kiszorítjuk a mindennapjainkból. Érdemes vásárláskor is odafigyelni arra, hogy az egyes termékek címkéjén mennyi ... további részletek >>

hozzáadott cukor van feltüntetve. Meg fogunk lepődni, hogy még az egészségesnek vélt paradicsompüré is nagy mennyiségben tartalmazza! Fogyókúra étrend tanácsok itt!


Feladva: 2017-08-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: étrendFogyókúracukrotnemhozzáadottméghogyfogyókúrásfeltüntetveÉrdemeskávéttartalmazzamelybenittvanszinténmindennapjainkbólkorábbanmennyiségben

Forrás: pepitahirdeto.multiapro.com

Rövid- és hosszú ujjú bababody rendelhető kiváló minőségben és mosást tűrő nyomással, felirattal, többféle mintával. Rocker és motoros babáknak is, online rendeléssel. Webáruházunkban leadott rendelését 3-5 napon belül kiszállítjuk az ország bármely területére. www.rockpont.polomania.hu/termekek /4857_Babaruha-Rocker_es_motoros_be bibody


Feladva: 2017-08-24    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: motorosbababodyRockerujjúkiszállítjukmintávalhosszúbelültöbbféleRövidnaponfelirattalBudapestrendelésétnyomássalRockPontleadotttűrőbébiknek

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés Budapest minden kerületébe és Pest megye több településére is lehetséges nálunk! 10 éves tapasztalattal várjuk hívását, ha sitt szállítást, zöldhulaldék vagy háztartási szemét elszállítását szeretné hatékonyan megoldani! A konténer rendelés szemét és sitt számára nálunk 1 perc alatt lebonyolítható! Telefonon, emailen és a weboldalunkon található űrlapon keresztül is leadhatja rendelését! 1 munkanapon belül leszállítjuk a hulladékgyűjtőt az Ön által megjelölt címre! Kisebb ... további részletek >>

felújításokhoz, kerti munkákhoz és építkezésekhez, bontásokhoz is van megfelelő méretű konténerünk! Konténer rendelés Budapest!


Feladva: 2017-08-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: rendelésKonténernálunkBudapestsittszemétstoptalálhatókonténerünkmegoldaniévesmegjelöltnonweboldalunkonméretűhatékonyanlehetségesáltalemailenvan

Forrás: pepitahirdeto.multiapro.com

A makett építés egy igen kedvelt és érdekes hobbi. Katonák, harckocsik, repülők, egyéb kiegészítők nagy választéka áll rendelkezésetekre, hogy elkészítsetek egy makettet, vagy akár egy igényesen kidolgozott diorámát. Akik még csak most ismerkednek ezzel, vagy szeretnék elkezdeni, azoknak ajánlom a kisebb, egyszerűbb maketteket, ezeknek az összeállítása nagyon egyszerű. Méretarányuk: 1 : 100 Általában 6-8-10 elemből összeépíthető makettek, amik nem igényelnek nagy szaktudást, de már az első ... további részletek >>

makett összeállítása is nagy élmény lehet a gyermek számára. Bővebben: www.kpjatek.hu/KEZDo-MAKETTEZoKNEK-c63_0_1.htm


Feladva: 2017-08-23    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: nagyegymakettMAKETTEZŐKNEKvagyKEZDŐösszeállításadiorámátnagyonszaktudástazoknakhtmkidolgozottegyszerűkiegészítőkmárelkezdeniJátékigényesenegyéb

Forrás: pepitahirdeto.multiapro.com

Építőioarban jártas embereket keresek. Segédmunkást, festőt, burkolót. Csapatok, brigádok ne jelentkezzenek! Csak egy-egy embert keresek mindegyik szakmában! Heti fizetéssel. Azonnali munka. Teljes munkaidőben. További részletekért hívja : Tel :06203535081 vagy 06209674893


Feladva: 2017-08-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresekburkolótfestőtSegédmunkástegyCsakBernátTeljesjelentkezzenekKissmunkabrigádokAzonnaliCsapatok06209674893fizetésselvagyHeti06203535081Tel

Forrás: pepitahirdeto.multiapro.com

Egyedi póló nyomtatás: legyen akár születésnap, legény- vagy leánybúcsú, vagy bármilyen más alkalom, egy egyedi póló mintázása, feliratozása nagyszerű ajándék. A Pólósaroknál céges pólót is rendelhet, emblémával láthat el, a pólótervezőben meg is tervezheti. Gyors, országos kiszállítás, pamut termékek. Pólósarok.hu


Feladva: 2017-08-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: egyedipólóvagymegmintázásaakárpólótervezőbenlegyenláthatnyomtatásemblémávalegyBudapestrendelhetalkalomPétertermékekpólótmásKisspamutcéges

Forrás: pepitahirdeto.multiapro.com

Turkálósok, piacosok, magánvállalkozók figyelmébe ajánlom cégünket, amely több éves tapasztalattal kínálja Önnek használtruha termékeinket. 20 kg-os kiszereléstől az 500 kg-os kiszerelésig biztosítjuk a szezonális ruházatot. I. osztálytól a cream minőségig megtalál nálunk mindent egy helyen. Minden megrendelést ingyenesen kiszállítunk garancia vállalással. Kínálunk gyerek ruházatot, felnőtt használt ruházatot, bálás ruhákat, válogatott extra használt ruházatot, pólós bálákat, melegítős - ... további részletek >>

jogging használt ruha bálákat, lakástextilt, fajtára válogatott extra minőségű ruházatot. Kérje részletes ajánlatunkat!


Feladva: 2017-08-02    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: 224232236zatotruhextra242kathasznhasználttunkcégünketminőségűcreamOrigin20kgkisznlommelegkeinketingyenesenfigyelmválogatottosztályt

Forrás: pepitahirdeto.multiapro.com

Minden erőfeszítése ellenére sem tudja leadni a fölösleges kilóit? Nincs ideje,energiája edzőterembe járni? Megoldást ajánlunk. Biorezonanciával beállítjuk - az anyagcsere korrekcióját - a sejtszintű zsírbontást - étvágy csökkentést Már az első alkalommal beindul a fogyás. Heti 1 kezeléssel a folyamat fenntartható. A biorezonanciát ajánljuk,kisiskolás kortól,idős korig. A túlsúlyos gyermeket csúfolják a társaik és nem fogadják be. Ettől magányos,magábaforduló,sérült lesz,aki ... további részletek >>

evéssel és magányos játékokkal vigasztalja magát. Ebből a kiút az ésszerű fogyás. A túlsúlyos idősebbek - izületei nehezen cipelik a fölösleges súlyt, - a szívműködésük és - a vérnyomásuk fogyásért kiált. Alkalmanként egy 20 perces alakformáló masszázst ajánlunk,hogy a kilók onnan szívódjanak fel,ahol Önnek a legfontosabb. A normál súly - egészséget, - önbizalmat, - munkabírást, - boldog életet biztosít. Bővebb információért,időpont egyeztetésért hívjon a 06 30 907 47 86 telefonon. eletmod-debrecen.hupont.hu


Feladva: 2017-08-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogyásajánlunkfölöslegesmagányostúlsúlyosdebrecennemkilóithívjonfolyamatsúlyvigasztaljakorrekciójátmasszázsttársaikleadniegyeztetésértcipelikHeti

Forrás: pepitahirdeto.multiapro.com

Kimerít a mindennapos rohanás? Vagy fásulttá tesznek a szürke hétköznapok? Már régen érezted szeretve magadat? Ha olyan masszázsra vágysz, ahol érzed, hogy szeretettel vagy érintve, akkor jó helyen jársz :) Ebben az órahosszában a figyelmem csak a tiéd, aminek hatására teljesen kipihentnek, ellazultnak fogod érezni magadat. A relaxált állapot már önmagában is beindítja a szervezet regeneráló folyamatait, aminek hatására gyógyulások mennek végbe a legkülönbözőbb területeken. Ezt ... további részletek >>

még fokozhatjuk azzal, hogy a kezelés elején immunerősítő energiákat indítok el, ami a masszírozás ideje alatt végig dolgozik a test izmaiban, sejtjeiben. Aki erre vágyik, szívesen jön vissza újra és újra és újra ... Ha kipróbálnád Te is, szeretettel várlak Kecskeméten a Széchenyivárosban csendes környezetben. www.egeszseg-wellness.hu/masszazsok


Feladva: 2017-07-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: újravagymárszeretettelmagadathatásárahogyaminekvégigfogodKutiazzalakkorvisszafolyamataithétköznapokalattellazultnakmasszázsfokozhatjukérintve

Forrás: pepitahirdeto.multiapro.com

A GÁL-60® típusú kopasztógéppel óránként hatvan csirkét lehet megtisztítani. A gép egyéb baromfiakhoz (liba, kacsa, gyöngytyúk, fácán stb.) is használható. Kétféle méretben készül. Pulykák pucolásához célszerű a pulykapucoló változatot megrendelni. Egy perc alatt egyszerre egy csirkét lehet megpucolni, melyet közben fogni kell. A tokokat és az erős tollakat is kiszedi, ezért kézi utópucolásra nincs szükség. A géphez számos kiegészítő berendezés tartozik (pl.: kábító, vágó, forrázó, ... további részletek >>

bontó, csöpögtető, stb.), melyek alkalmazásával biztosítható az optimális kiszolgálás, csökkenthető a pucolási idő, növelhető a feldolgozott darabszám. (Kérjen árajánlatot a kiegészítőkről!) www.csibekopaszto.hu/magyar/index.html


Feladva: 2017-07-24    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 174stbGÁLlehetgépcsirkétegyhatvanwwwtollakategyszerreoptimálisKétféleberendezésóránkéntkiegészítőkrőlerősalattbiztosíthatóhasználhatótokokat

Forrás: pepitahirdeto.multiapro.com

Víz, gáz és duguláselhárítás Budapest és környékén. Mi a Fűtésszerelő Mesternél úgy kívánjuk végezni tevékenységünket, hogy boldogan és büszkén tekinthessünk vissza elégedet ügyfeleink hosszú sorára. Több, mint 20 éve a szakmában vagyunk és már mindenféle meghibásodással találkoztunk ennyi idő alatt. Tudjuk honnan szerezzük be a legjobb alkatrészeket, tudjuk milyen típushibákkal találkozhatunk. Egy szóval: fel vagyunk készülve mindenre. Szakembereinktől ugyanezt várjuk el. Kizárólag magasan ... további részletek >>

képzett, sok éves tapasztalattal rendelkezdő munkatársakkal dolgozunk és felkutattuk a legjobb minőségű alkatrészeket, hogy a piacon elérhető legjobb minőségű szolgáltatást tudjuk biztosítani. Ennek köszönhetjük, hogy több tízezer elégedett ügyfelet tudhatunk ma magunk mögött. Ha elvégeztük a munkát, akkor bátran biztosítjuk a garanciát, mert tudjuk, hogy nem lehet semmi baja. Ha ön is szeretné biztonságba érezni magát nincs más dolga, mint tárcsázni a +36 (20) 238 57 20 telefonszámot és segítséget kérni. Akár azonnali kiszállással megoldjuk bármilyen meghibásodást is tapasztalt.


Feladva: 2017-07-23    [Lakossági szolgáltatás]

Címkék, kulcsszavak: hogytudjuklegjobbgázVízalkatrészekettöbbvagyunkBudapestmintminőségűduguláselhárításképzettbüszkénmegoldjuktudhatunkEgymáselérhetőmindenféle

Forrás: pepitahirdeto.multiapro.com

Győr - Pápa - Kisbér - Tata - Csorna térségébe biztonsági őr, portás munkatársakat keresünk főállásban, bejelentve, szabadság, betegszabadság kifizetéssel. Jelentkezni lehet önéletrajzzal, a bi.technika@gmail.com e-mail címre.


Feladva: 2017-07-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: portásbiztonságiIldikómailkeresünkOrbáncommunkatársakatGönczinétechnika@gmailállásönéletrajzzallehettérségébeJelentkezniCsornakifizetésselTata

Forrás: pepitahirdeto.multiapro.com

Szállítás, költöztetés, árufuvarozás és minden más egyéb, ami belefér egy 1.5 t-ás Mazda dobozos kisteherautóba, azt korrekt, áfamentes fuvarköltséggel elszállítja Önnek a Thomka Trans fuvarozó cég. Hívjon bizalommal, akár hétvégén is!


Feladva: 2017-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: fuvarozásThomkaköltöztetésSzállításHívjonkorrektmáscégaztmindenfuvarozóautóbacomTransteheherárúwordpresskisthomkatransönnekdobozoshttpGöd

Forrás: pepitahirdeto.multiapro.com

Ha ön egy sok éven át használható és kényelmes garnitúrát szeretne prémium minőségben, jó helyen keresi! Egy szék ára 8000 Ft. Bármennyi készíthető és az asztal mérete és formája is változhat igény szerint, ha egy más garnitúrát szeretne. Új állapotban 2 év garanciát adok rá. Könnyen szállítható, mert egyszerűen szétszerelhető. A garnitúra ára lecsiszolt állapotban, festésre készen értendő, mindenki igényei szerint festheti akár, de megegyezés szerint le is festhetem. Kiszállítás is ... további részletek >>

megoldható.


Feladva: 2017-07-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: szerintegyállapotbanszeretnegarnitúrátáragarnitúramegoldhatókészíthetőfestésresokgaranciátKiszállításBármennyiprolignumfesthetem8000lecsiszoltmás

Forrás: pepitahirdeto.multiapro.com

A FÉRFI DIVATNAK NINCS TÖBBÉ TITKA A SPARTOO ELŐTT! 2006-ban elindulva, a Spartoo először is cipőkre specializálódott. Az éves alatt kiszélesítettük kínálatunkat, számos divatos táskával valamint egy szuper elegáns ruhakollekcióval Mottónk: a divat. Ennek köszönhető, hogy jelenleg széles választékban megtalálhatja férfiaknak kínált modelljeinket, melyek természetesen a 100% divatot képviselik! NÉZZE MEG ONLINE FÉRFIAK SZÁMÁRA KÍNÁLT SZÉLES CIPŐ-, TÁSKA- ÉS RUHAVÁLASZTÉKUNKAT! ... további részletek >>

Bármilyen legyen is a stílusa: rocker, laza vagy inkább divatos, a SPARTOO.HU-n biztosan megtalálja az Önnek tetsző darabot. Férficipő kínálatunkban több száz tornacipőt, bakancsot, sportcipőt, városi- vagy deszkás cipőt ajánlunk figyelmébe. Továbbá rendelkezésére bocsájtunk egy teljes kollekciót férfiruházatból (farmerek, nadrágok, pulóverek, ingek...). valamint a legutóbbi divattrendeknek megfelelő táskákat is. TALÁLJA MEG HONLAPUNKON A LEGJOBB MÁRKÁKAT! Nike, Converse, Pataugas, Birkenstock, Vans... A Spartoo a legjobb márkákat sorakoztatja fel férfidivat világából. Nézze át újdonságok rovatunkat és felfedezze a divat legújabb trendjeit, melyekre mindenki ráharap. Ne felejtse el átnézni tippjeinket sem, ahol találhat cipőket olcsón, melyek a 100%-os divatot képviselik. www.spartoo.hu/ferfi.php


Feladva: 2017-07-15    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: spartoo100férfidivatdivatotMEGvagymelyekmárkákategySZÉLESlegjobbdivatosdivatKÍNÁLTvalamintNézzeképviselikvilágábólcipőtmodelljeinketTÁSKÁK

Forrás: pepitahirdeto.multiapro.com

Befektetési arany termékeinket azonnal, a fizetéssel egyidőben, készpénzért veheti meg Bp. 1085 József krt. 40. alatti központunkban és az oldalunkon felsorolt pénzváltókban. A pénzváltókban a választék és készlet mennyisége is kisebb mint a központban. Fizethet átutalással is, ilyen esetben hívjon minket telefonon! Központunkban és a készlettel rendelkező pénzváltókban (a budapestiek kivételével) el is adhatja aranyát, a központ mellett már Debrecenben is azonnal megkapja az ... további részletek >>

ellenértéket! A feltüntetett árakon kívül nincs semmilyen más költség. A vételi ár csak a fényképen látható és sérülésmentes csomagolású aranytömbökre, illetve a sérülésmentes érmékre vonatkozik. A listában nem szereplő aranytömböket és érméket is megvásároljuk egyedi ár alapján. www.correctgold.hu/befektetesi_arany


Feladva: 2017-07-14    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: pénzváltókbanaranybefektetesisérülésmentesazonnalKözpontunkbansemmilyenválasztékwwwközpontfizetésselhívjonnincsfelsoroltalapjánaranyáttermékeinket

Forrás: pepitahirdeto.multiapro.com

Az 8in1 márka teljes mértékben az állatok érdekeit tartja szem előtt. Az 8in1 termékek olyan gazdiknak ajánljuk, akik imádják a kisállataikat! Kutya- és macskaeledel, jutalomfalatok, rágócsontok, kutyapelenka, vitaminok Táplálékkiegészítők · Teljes értékű táplálékok · Gyors kiszállítás · Széles termékválaszték


Feladva: 2017-07-14    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8in1183TeljestermékválasztékPepitarágócsontokSzéles8206jutalomfalatokelőtttólmacskaeledelszemkiszállítás7000KutyatartjaGyorsszállításérdekeit

Forrás: pepitahirdeto.multiapro.com

Kiemelt specifikációk: - Rendszermemória (RAM) 2 GB - Operációs rendszer verzió Android 7.1.1 (Nougat) - Kijelző átlója 5.2 - Kijelző felbontás 720 x 1280 - Fényképező felbontása, tulajdonságai 13 MP, f/2.0, phase detection autofocus, 1/3 - Processzor sebessége Octa-core 1.4 GHz Cortex-A53 - Akkumulátor kapacitása 3000 mAh Ingyenes kiszállítás 24 hónap garancia Minden gyári tartozékkal Magyar nyelvű készülék VIP Phone szaküzlet 1138 Budapest, Váci út 136/c. +3670-930-4414 ... további részletek >>


Feladva: 2017-07-12    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: mobiltelefonnokiavipkeksimKijelzőphone3000PepitadetectionnyelvűAndroidkapacitásakártyafüggetlenphasewwwMagyarverzióAkkumulátorDual4414A53

Forrás: pepitahirdeto.multiapro.com

Régiséget szeretne eladni? Minket mindig megtalál: Budapest V. ker. Kálvin tér 1 - Korona Antikvitás AZONNALI KÉSZPÉNZFIZETÉS történik ÜZLETÜNKBEN ÉS HELYSZÍNEN IS!!! AKÁR 20%-KAL TÖBBET FIZETÜNK MINT MÁS KERESKEDŐ! KIEMELT MAGAS ÁRON VÁSÁROLUNK: RÉGISÉGET, ANTIK-HAGYATÉKOT, ANTIK-GYŰJTEMÉNYEKET, MINDENFÉLE ANTIK LAKBERENDEZÉSI DÍSZ- ÉS HASZNÁLATI TÁRGYAKAT! A KISZÁLLÁS MINDEN ESETBEN DÍJTALAN!


Feladva: 2017-07-11    [Régiség - Művészet]

Címkék, kulcsszavak: ANTIKRÉGISÉGETÁRONMAGASAZONNALIszeretneLAKBERENDEZÉSIMÁSAntikvitásajánlóMINTKoronaHirdetőMINDENFÉLEFIZETÜNKtérPepitaGYŰJTEMÉNYEKETTÖBBETKálvin

Forrás: pepitahirdeto.multiapro.com

A Desigual színes. Vidám. Játékos! Ezek azok a szavak, amelyek tökéletesen leírják a Desigual márkát, amely a szenvedélyes Spanyolországból származik. Első pillantásra is látszik, hogy a Desigual táskái, cipői és kiegészítői különböznek a többiekétől. Minden egyes darab egy műalkotás, amely ötvözi a legújabb technológiákat, alapanyagokat és művészi kreativitást. A Desigual márka a sokszínűségéről híres és csak Önön múlik, hogy mit mivel párosít. Hagyja magát kísértésbe ejteni ... további részletek >>

játékosságával és különcségével! Szemlélje a divatot és a ruhákat egy teljesen új nézetből! www.lifestyleshop.hu/markak/desigual


Feladva: 2017-07-11    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: desigualhogyamelyegyalapanyagokatPepitakiegészítőiruhákatmittökéletesentechnológiákatkiegészítőkcipőidivatotamelyeklegújabbcipőtáskáiSzemlélje

Forrás: pepitahirdeto.multiapro.com

Béreljen, vagy vegyen! Miért éri meg a Fiscal Online pénztárgépet választani? - Kisméretű - Akkumulátoros - Érintőkijelzős - Könnyű, gyors papírcsere - Kis és közepes forgalmú üzletekben megállja a helyét - Felhasználó barát kezelés - Végösszeg korlát az elütések elkerülése végett - Nyugta sztornó, hogy felejtse el a sztornó füzetet - Átszemélyesíthető A bérlésről itt olvashat többet: ... további részletek >>


Feladva: 2017-07-11    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: sztornópapírcsereéribérlésrőlVégösszegATCgyorsMiértÁtszemélyesíthetőkezelésakcióKönnyűvegyenfüzetetbarátPénztárgépÉrintőkijelzősvagyFelhasználó

Forrás: pepitahirdeto.multiapro.com

Szeretettel várom minden lazítani vágyó vendégemet egy kellemes kikapcsolódásra Gyenesdiáson, a Balaton északi partján. Nálam hangulatos szobában, egyedi 1 órás teljes testes, meleg olajos lágy relax masszázsra van lehetőség. Amit lágy keleti zene kíséretében kényelmes matracon végzek el minden hozzám betérő személyen. Engedje meg magának ezt a lehetőséget, mert egy kis kényeztetés mindenkinek jár! Elérhető vagyok a hét minden napján reggel 8:00-22:00 0620/978/9568 Alex


Feladva: 2017-07-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: mindenlágyAlexrelaxegyGyenesdiásonElérhetőegyediEngedjevágyóAmitjárszobábanszemélyenlazítanilehetőségmindenkinekhangulatosbetérővárom9568

Forrás: pepitahirdeto.multiapro.com

A Puli sétányon, Csepel kiemelt zöldövezetében, néhány lépésre a Katalin horgásztótól és az Akácfa utcai kiserdőtől egy pompás lakás eladó. A lakás felújított, 70 nm-es, 2+2 szobás, 1. emeleti, loggiás, csendes, világos, cirko fűtésű, jó beosztású, tiszta levegőjű. A lakáshoz egy pince is tartozik. A beépített konyhabútor és a háztartási gépek a vételár részét képezik. Ne az árat nézze, hanem a lakást! Hívjon még ma! Fotókat tudok még küldeni.


Feladva: 2017-07-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: PuliegylakásmégHívjonAkácfabeépítettAndrascsendeslakásthorgásztótóltartoziksétányloggiáshanemKatalinpinceemeletinézzelépésreszobásárat

Forrás: pepitahirdeto.multiapro.com

Golosi Kitten speciális táp a kiscicák számára, 1 hónapos kortól 1 éves korig. Ebben az életszakaszban könnyű, mégis gazdag beltartalmú táplálékra van szükség, mely elősegíti a fiatal kismacska kiegyensúlyozott, egészséges fejlődését. A könnyen emészthető csirkehús olyan fehérjeforrás, mely nagy mennyiségben tartalmazza a növekedéshez elengedhetetlenül fontos aminosavakat. A frukto-oligoszacharid (FOS) tartalmú prebiotikumok elősegítik a tápanyagok megfelelő felszívódását, mivel egészséges ... további részletek >>

táptalajt biztosítanak a bélflórának. Ugyanakkor a krokett forma a kiscica igényeinek megfelelően lett kialakítva, elősegítve ezzel a rágást. Teljes értékű állateledel csirkével és rizzsel kiscicáknak 1 hónapos kortól 12 hónapos korig. www.golosipetfood.hu/katalogus/macska/golosi-kitten


Feladva: 2017-07-01    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: golosikittenhónaposkortólmelykorigegészségesajánlóaminosavakatemészthetőlettgazdagmivelHirdetőkiscicáknakfontoskönnyenmegfelelőenmégisPepita

Forrás: pepitahirdeto.multiapro.com

Ponyvák széles választéka! Cégünk napellenző termékekre szakosodott weboldalt hozott létre, melyen különböző napellenző terméket töltöttünk fel. Megtalálható könyökkaros napellenző, állványos napellenző, illetve számos napellenző ponyva közül választhat. Budapest és környékén ingyenes kiszállással vállaljuk munkáinkat. Elrepedt vagy eltört? Nem gond megjavítjuk- Hívja a 061 445 42 31


Feladva: 2017-06-27    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: napellenzőBudapestbeépítésElrepedtszámoshozottszerelésmunkáinkatilletveweboldaltjavításvállaljukállványosszakosodott445kiszállássalkönyökkaros061

Forrás: pepitahirdeto.multiapro.com

Ismerkedj biztonságosan személyiség központú társkeresőnkön rejtett költségek nélkül. Miért biztonságos a LoveBuzzler? Beépített funkcióinkkal lehetőséged van tiltani, jelenteni a zaklatókat, továbbá beállításainkban egyéb eszközök is rendelkezésedre állnak, hogy távol tartsd magadtól őket. Személyiség központú, ez mit jelent? Szakértőnkkel - Habis Melinda, klinikai szakpszichológus, pár-és családterapeuta jelölt, személyközpontú terapeuta- segítségével létrehoztunk egy speciális kérdőívet, ... további részletek >>

amely kitöltése során személyiségi diagramot rajzol programunk a legfontosabb emberi személyiségjegyekről pl. megbízhatóság. A kérdésekre adott válaszokat kiszemelted adatlapján megnézheted egyesével. Minden kérdésünk párkapcsolat alapjául szolgáló konfliktushelyzeteket térképezi fel. Ennek köszönhetően már az előtt tudod, miben különböztök, hasonlítotok, mielőtt még elmélyülne a kapcsolatotok. Valamint, azt is, hogy mint veszekednétek már a kezdetektől fogva, amik valószínűleg csak később derülne ki, így megóvhatod magad a csalódásoktól is. Továbbá önmagadat is jobban megismerheted! Szakértői segítség révén online felteheted kérdéseidet, amelyekre kiváló szakemberünk Habis Melinda és kollégái válaszolnak. Nem hagyunk magadra! Megéri kipróbálni! 3 napig minden új regisztrálónk használhatja a LoveBuzzler társkereső minden funkcióját, úgy mintha fizetős tagja lenne oldalunknak. Ha lejár a három nap akkor ugyanúgy ingyen használhatod tovább, csak korlátozottan, amelyet feloldhatsz havi fix. egyszeri tagsági díj megfizetése után. Nincsenek csomagjaink csak egyszeri díj, így mindenki egyenlő esélyek mellett ismerkedhet!


Feladva: 2017-06-24    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: lovebuzzlerközpontúSzemélyiségmindencsakhogytárskeresőMelindaHabisígydíjmárbiztonságosTovábbáegyszeribeállításainkbancsomagjainkmagadraprogramunk

Forrás: pepitahirdeto.multiapro.com

Nagykereskedelmi cégünk, kiskereskedelmi forgalomban eladásra kínál Meiller Kipper, Meiller, FX Meiller teljes típuscsaládjának minden hidraulikus és kapcsolódó alkatrészét, felújító készletét, felépítmény fő és részegységeket a lehető legkedvezőbb áron. Vállaljuk továbbá minden típusú hidraulika rendszer alkatrészének raktárról és nemzetközi beszerzésből való pótlását, kiváltását, beszerzését, javítását, felújítását.


Feladva: 2017-06-06    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: Meillerhidraulikamindenrendszerkészletétfelújításátforgalombanfelújítójavításátkiskereskedelmitípusúalkatrészétbeszerzésétcégünkkapcsolódókiváltását

Forrás: pepitahirdeto.multiapro.com

Meg sem kell hirdetni a láthatatlansági versenyt, mert eszméletlen jó benne mindenki! Akadhatnak renitens weboldal készítők, bloggerek és hirdetők, akik nemet mondanak a láthatatlanságra, mert ŐK LÁTSZANI AKARNAK! Igazából őket szeretnénk kiszolgálni, hiszen csak ők szeretnének valamit, amit a többiek nem... Hogy miért van ez így, erről többet a Google oldalán többet is lehet olvasni, a címe: A spam elleni küzdelem - ... további részletek >>


Feladva: 2017-06-03    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: láthatatlanságigooglespammerttöbbetakikcomígykiszolgálniállunkhirdetőkvanhirdetniszeretnénkrendelkezésérebloggerekwwwmiértkellőketigényli

Forrás: pepitahirdeto.multiapro.com

Nem árulok zsákbamacskát, sem ”legyél milliomos fél nap alatt” című e-könyveket sem. Egyszerű, bárki által könnyen érthető, INGYENES és fizető oldalakra szeretném a hangsúlyt fektetni. Egészítse ki a fizetését, keressen pénzt az interneten! Maximalizálja a profitot és költse arra amire szeretné! Látogasson el a blogoldalamra!


Feladva: 2017-05-31    [Pénzkeresés - MLM]

Címkék, kulcsszavak: sem8221félpénztkönnyenmilliomoskeressenáltalblogoldalamralegyélfizetésétbárkiLátogassonzsákbamacskátEgészítseEgyszerűszeretnéárulokfektetniNem

Forrás: pepitahirdeto.multiapro.com

Paleo Gluténmentes csoki, édesség termékek nagy választékban a NaturTéka webshopban. Rendeljen online vagy telefonon akár ingyenes kiszállítással!


Feladva: 2017-05-22    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: NaturTékaédességcsokiGluténmentesPaleoRendeljenHirdetőwebshopbanPepitawebáruházválasztékbannagykiszállítássaltermékekingyenesakártelefononvagy

Forrás: pepitahirdeto.multiapro.com

Számlaképes cégünk vállalja lakások, házak, irodák, komplett költöztetését, lomtalanítását, épületen belüli átrendezését. Igény szerint csomagolunk vagy csomagolóanyagot kiszállítunk, rakodási, szerelési feladatokat is végzünk. Minőségi, gyors munka több éves tapasztalattal, referenciával, hétvégén is hétköznapi árakon! Akár lakáscsere lebonyolítását is vállaljuk. T: +36 (70)23 53 403, +36 (1) 787 0230


Feladva: 2017-05-22    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: csomagolunkvállaljuklakásokmunkaszerintlebonyolításátvállaljagyorsIgénylakáscserecégünkMinőségiátrendezésétAkárSzámlaképesvégzünkbelüliárakon0230

Forrás: pepitahirdeto.multiapro.com

Kizárta magát? Nem nyílik az ajtó? Akad, szorul a zár? Hívjon és megoldjuk! Minden jellegű zár probléma gyors megoldása Budapest és Pest megye területén. Díjtalan kiszállás Budapest területén. www.zarcsere.eu Zárcsere - Zárcsere gyors szerviz éjjel-nappal.


Feladva: 2017-05-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: ZárcsereBudapestzarcserezárterületénnyílikgyorsNemproblémamagátwwwKizártahttpjellegűZárnyitásMindenZárszervizmegoldjukkiszállásHívjonDíjtalan

Forrás: pepitahirdeto.multiapro.com

Hajsütővas, gőzállomás, waffelsütő, gofrisütő, melegszendvicssütő, porszívó, páraelszívó, fagyasztó, hűtő, szárítógép, mosógép, hősugárzó, olajradiátor, olajsütő, kenyérpirító. A tökéletes nászajándékok, karácsonyi ajándékok széles választéka! Személyes átvétel Budapesten. Link: www.stacioshop.hu Facebook: www.facebook.com/stacioshop Tel: 36704551969 E-mail: in fo@stacioshop.hu


Feladva: 2017-05-16    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: stacioshopfacebookwwwátvételhősugárzóinfo@stacioshopHajsütővasSzemélyesmosógépmailajánlóválasztékaszárítógép36704551969HirdetőszéleshűtőTelPepita

Forrás: pepitahirdeto.multiapro.com

Továbbá gyártunk különböző méretű, huzalvastagságú horganyzott és műanyagos drótfonat, vadvédelmi háló, vadháló, tüskéshuzal, tüskésdrót, szögesdrót, vezérdrót, kerítés háló, kerítésháló, feszítőhuzal, feszítő huzal, kerítésdrót, tüskés szöges vezér drót, vadkerítés, kerítés építés, kerítésépítés, kerítésfonat ,kiskapu, nagykapu, huzalfeszítő csavar, vibropréselt zsalukő, lábazati elem, fémoszlop, faoszlop, natodrót nato drót, fém fa beton kerítés oszlop, kerítéspanel, kerítéselem, kutyakennel, ... további részletek >>

drótháló, drótkerítés, kis nagy vas kapu, kutya kennel, szőlőoszlop, kerítésoszlop, betonoszlop, kutya kenel, szőlőkaró, kutyakenel, szőlő oszlop karó. Vállalunk az ország egész területén vadhálóval, vagy dróthálóval komplett kerítésépítést 1000 Ft/m áron. (Csak drótkerítéseket és vadvédelmi kerítéseket építünk, fakerítést nem!!!)Rengeteg terméket gyártunk és forgalmazunk a kerítésdróton és betonoszlopokon kívül, amit egy hirdetésben nehéz lenne felsorolni, ezért kérem, látogasson el honlapunkra www.kerites.hupont.hu oldalra, vagy telephelyünkre, a KÓTAJI DRÓTFONAT, VADHÁLÓ és BETONOSZLOP CENTRUMBA ahol személyesen akár további kedvezményekre is van lehetőség.


Feladva: 2017-05-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keriteswwwvadvédelmibetonBETONOSZLOPdrótVADHÁLÓDRÓTFONAToszlopgyártunkhálóvagyhupontkutyakerítéseketkerítéspaneltüskéshuzalaholegészkívülfém

Forrás: pepitahirdeto.multiapro.com

Ez a vergődés ismétlődik már több éve hónapról hónapra? Változtasson rajta! Változtatás nélkül nincs változás! Ha nem változtat az életén, akkor mitől vár változást? Élni akarja az álmait vagy álmodni a céljait? Ugye nagyszerűnek tűnik, hogy hetente akár több ezer Dollárt is kereshet játszi könnyedséggel? Minden internetes munkával foglalkozó ember álma egy ilyen lehetőség, de a helyzet az, hogy az álom ez esetben mindenképpen csak álom marad. Több átveréssel is lehet találkozni az internetes ... további részletek >>

munka lehetőségek közt. Ha ilyen kétes kimenetelű ajánlatot keres, akkor csalódni fog. mert nem Önn ek szól. Munkát ajánlunk kiemelten magas fizetésért. Az okos ember előre gondolkodik, a buta a múltban él, és a még butább azt gondolja, hogy ha nem tesz semmit sem, akkor sokkal jobb lesz Neki! Sajnos ezért is sok család fog úgy élni, mint most, sok év múlva is, sőt sokkal rosszabbul! Ajánlat azoknak, akiknek komoly céljai vannak és olyan havi jövedelemre van szükségük, amelyből kényelmesen biztosíthatják családjuk megélhetését: / kb. 500.000,- / hónap / Pl: Első sorban több szabadidővel rendelkezők, kiskeresetűek széles kapcsolatokkal rendelkezők vagy több gyermekes családok, stb. Munkaidő: Heti 30 – 40 óra Egyedülálló, rendkívülien magas jutalékkal keresek olyan embereket, akik széleskörű ismeretséggel és kapcsolatokkal rendelkeznek! Jelentkezzen ha konkrét céljai vannak, mindenben segítek. Kérem, hogy az email címemen jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-05-08    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogytöbbnemakkorolyanélnivannakembercéljaimagasspórolvagyfogálombárrendelkezőkfizetésébőljelentkezzenilyenkapcsolatokkalsokkalvégéigjön

Forrás: pepitahirdeto.multiapro.com

Zárszerviz Budapesten non-stop elérhető Zárszerviz gyors szolgálat éjjel nappal várja hívását ha Zár probléma akadt. Budapest területén egy órán belül és kiszállási díj nélkül végezzük munkáinkat. Szolgáltatásaink: Zárszerviz Zárcsere Ajtónyitás Zárnyitás Betörés utáni helyreállítás Lakatos munka Hisec ajtó zárszerviz Kínai ajtó zárszerviz Műanyag ajtó zárszerviz Biztonsági ajtó zárszerviz Ha zár probléma akadt mi vagyunk a megoldás kulcsa! Rejtett ... további részletek >>

költségek nélkül garanciával állunk rendelkezésére az év minden napján. Bővebben: www.zarszervizmester.hu


Feladva: 2017-05-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: zárszervizajtózarszervizmesterakadtproblémazárnélkülköltségekhívásátMűanyagSzolgáltatásainkRejtettvárjaKínaimunkáinkatwwwkulcsanappalHisechttp

Forrás: pepitahirdeto.multiapro.com

Hogy miért? Regisztrációkor leadott első 100 PV pontot meghaladó rendelésnél a következő AJÁNDÉKOKBA részesül: - 1 doboz ganodermás müzli - 1 doboz ganodermás fogkrém - Ingyenes regisztrációs díj - Ingyenes kiszállítás Ezen ajándékok értéke: 11.660,- Ft Legyen törzsvásárlónk


Feladva: 2017-05-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ganodermásdobozIngyenesfogkrémelsőtörzsvásárlóitörzsvásárlónkleadottExcelLegyenRegisztrációkorGano660müzlimiértregisztrálniértékerészesülHogy

Forrás: pepitahirdeto.multiapro.com

Izgalmas meséskönyv gyerekeknek e-könyv és nyomtatott könyv formában. Elérhető a www.publioboox.com/hu_HU/allati-to rtenetek1 oldalon.


Feladva: 2017-05-01    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: könyvkönyElérhetőformábannyomtatottgyerekeknekoldalonmeséskönyvtortenetek1IzgalmasallatiBudapestcomKisspubliobooxVirághttps

Forrás: pepitahirdeto.multiapro.com

Romániai kapcsolatokkal keresünk olyan agilis embereket Nemzetközi piacvezető Törzsvásárlói Rt.-hez akik Romániában partneri vezető Referensként tevékenykednének. Vannak Erdélyben ismerősei? Kiemelten várjuk 25-45 év közötti felsőfokú végzettséggel rendelkező céltudatos, sikerorientált munkatársak jelentkezését, akik nyitottak a tudatos vásárlási tanácsadó területre. Díjmentes, teljes körű magas színvonalú duális átképzést biztosítunk. Karrierlehetőség: • Kiemelkedő, ... további részletek >>

teljesítményarányos nemzetközi jövedelem • Életpálya program • Szakmai oktatások • Biztos háttér • Gépkocsi támogatás • Bónuszok Feladat: Az embereket és a cégeket informálni arról, hogyan tudnak tudatosan és felelősen vásárolni, ott, ahol eddig, azt, amit eddig, hogyan tudnak jelentős visszatérítéseket kapni készpénzben. A Vásárlási Tanácsadók feladata, hogy olyan plusz pénzeket tegyenek az emberek zsebébe, amely eddig is meg volt, de senki nem jutott hozzá, mert nem tudta, hogyan kell! A munkához tartozó elvárások:  Felső vezetéssel kapcsolattartás  Képzéseken való megjelenés Gondolja át, hogy Romániában hányan vásárolnak nap, mint nap, és ennek megfelelően kiszámolhatja a havi jövedelmét is!!!! Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet! Üdvözlettel: Rózsa László vásárlási tanácsadó E-mail cím: rozsabusiness@gmail.com Telefon: 06 – 20 – 432 – 2549 Skype: rozsalaszlo3


Feladva: 2017-04-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8226vásárlásieddighogyan8211akikRomániábanjövedelemhogyVannakRomániaiMagyarországtanácsadótudnakembereketmegnemnemzetköziLászló61656napott

Forrás: pepitahirdeto.multiapro.com

GALÉRIAÁGYAK, EMELETESÁGYAK masszív tömörfából. Gyerekágy, ágyrács, matrac - EGYEDI méretek és igények alapján is gyártunk. Országos kiszállítással, kedvező árú összeszereléssel. Webáruházunk: galeriaagyak.hu GALÉRIAÉPÍTÉS fából, országosan (Budapestre kiszállási díj nélkül), 10+ év tapasztalattal. Szerződéssel, garanciával, referenciákkal gyártunk és építünk galériákat (egyedi fa szerkezeteket, beépített bútorokat). További információkért látogasson el honlapunkra!


Feladva: 2017-04-24    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: masszívGALÉRIAÁGYAKegyediországosangyártunkGALÉRIAÉPÍTÉSösszeszerelésselTovábbitömörfábóltapasztalattalárúbútorokatnélkülkedvezőbeépítettEMELETESÁGYAK

Forrás: pepitahirdeto.multiapro.com

Varázslatos gyermek ruhák – Vásárolj olcsón otthonról! Új tavaszi,nyári kollekció amivel kislány álmok válhatnak valóra! Gyors szállítás! Új és használt kislány alkalmi és ünneplő ruhák elérhető áron.


Feladva: 2017-04-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: ruhákkislányáronelérhetőhasználtolcsónszállításVásároljGyors8211valóragyermekválhatnakVarázslatosálmokBudapestamivelButikkollekcióManóruha

Forrás: pepitahirdeto.multiapro.com

Online Parfümök 30-50%-al olcsóbban. Ingyenes parfüm átvétel Bp-en. Ritka és új parfümök széles választékban kaphatók Expressz kiszállítással - Parfüm Divat


Feladva: 2017-04-18    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: parfümökParfümDivatRitkaátvételIngyenesolcsóbbanOnlinekiszállítássalféláronExpresszMinőségikaphatókválasztékbanszéles

Forrás: pepitahirdeto.multiapro.com

Területi Igazgatókat Keresünk! Közép-Európa (Magyarország, Ausztria, Románia, Szlovákia, Ukrajna, Szerbia, Szlovénia, Horvátország, Csehország) területéről keresünk vállalkozókat, vállalkozásokat az Intercontact Marketing Network Kft. információs rendszerének további kiszélesítésére és szervezői munkáira. Amit kínálunk: Eredményes próbaidő után kizárólagos területi képviseleti jogot adunk. Bérezés, juttatások: Kiemelkedően magas jutalékot biztosítunk. Akiket keresünk: Elsősorban ... további részletek >>

azok jelentkezését várjuk, akik kapcsolatban állnak az ipar, a mezőgazdaság, a kereskedelem és a szolgáltatás ágazataiban tevékenykedő vállalatokkal, cégekkel, vállalkozásokkal. Főbb területek: Árualap és szabad gyártói kapacitás felkutatása, nemzetközi anyagos és bérmunka kihelyezése. Főleg a fémipar - faipar - építőipar - élelmiszeripar gyártói kapacitás lekötés, valamint a beruházás, export-import, projekt finanszírozás, vegyesvállalat alapítás profiljában vagyunk érdekeltek. Elvárások: Maximális megbízhatóság és szorgalom. Előnyt jelent már meglévő közép - nagyvállalati ügyfélkör, de nem alap elvárás. Fő célunk: Minél több gazdasági, üzleti információt biztosítani, üzleteket létrehozni a magyar gazdaság szereplői számára. Az üzleti lehetőségek, megrendelés, befektetés, ingatlan és cég adás-vétel üzleti ajánlatok ismertetése. Tevékenységünk: Külföldi üzleti partnerközvetítés, nemzetközi gazdasági stabil üzleti kapcsolatok, folyamatos megrendelések létrehozása. Kiemelten fontos tevékenységünk a magyar áruk és termékek külpiaci bevezetése, külföldi piackutatás. Feladat: Piacképes magyar gyártók és árualapok felkutatása. Nagyon sok esetben konkrét minták és műszaki dokumentációk is rendelkezésünkre állnak. Elsősorban profi és minőségi szinten lévő, komoly munkákra képes üzletembereket, cégeket keresünk. Jelentkezés: Még ma jelentkezzen ! Csatlakozzon hozzánk ! Várjuk megbízható, profi üzletemberek, cégek, vállalkozások jelentkezését ! Legyen Ön is egy 27 éve sikeresen működő cég munkatársa! Részletesebben: www.intercontact.hu/kepvis/kepvis1.html További információ: Tel: +36 30 449 7559 imn@t-online.hu


Feladva: 2017-04-17    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: üzletiintercontactkeresünkmagyarkapacitásközépprofigyártóicégwwwVárjukkülföldihttpterületigazdaságifelkutatásaElsősorbannemzetközijelentkezését

Forrás: pepitahirdeto.multiapro.com

Csípős Mangalica parasztkolbász. A feltüntetett ár 30 dkg-ra van kiszámolva A pontosan lemért súly alapján számlázunk. www.kolbaszaruhaz.hu/mangalica-kol basz/282-kover-tanya-csipos-mangali ca-kolbasza.html


Feladva: 2017-04-16    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: mangalicacsipostanyakoverpontosankiszámolvavan282dkgkolbaszfeltüntetettkolbaszaruhazparasztkolbászwwwajánlószámlázunkHirdetőhtmlalapjánPepita

Forrás: pepitahirdeto.multiapro.com

”B” kategóriás jogosítvánnyal vezethető kisteherautók bérbeadása Budapesten és környékén rövid távra, vagy hosszú távra is tartós bérlettel, akár külföldre is. www.teherautorent.hu +3630/298-4353


Feladva: 2017-04-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: távra8221rövidbérlés3630környékénTeherautóteherautorentBudapestenwwwbérbeadásakülföldrekisteherautókakárvezethetőbérletteljogosítvánnyaltartós298

Forrás: pepitahirdeto.multiapro.com

A Lada Vesta stílusos, merész és ragyogó – pont, mint amilyennek egy új generációs Ladának lennie kell. A szedán sziluettje korszerű és harmonikus, az X forma egységként kíséri végig a karosszériát. Az új, bátor stílus könnyen felismerhető a részleteiben: a fekete színnel kiemelt radiátor borításban, a lenyomatokban az oldalakon, a hátsó fényszórók fényvisszaverőin. A megemelt öv vonalának, meghosszabbított motorháztetőnek illetve lejtős tetőnek köszönhetően a Vesta külsőre is sportos és ... további részletek >>

dinamikus. Egy ilyen autóval nehéz észrevétlennek maradni az utakon. Vesta. A LADA új arca. www.ladaszolnok.hu/vesta_sedan_ismerteto


Feladva: 2017-04-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: vestaLADAEgymeghosszabbítottmintsedanszínnelilyenformavonalánakpontfeketeharmonikusmegemelt8211ladaszolnokrészleteibendinamikuskorszerűragyogó

Forrás: pepitahirdeto.multiapro.com

Az ABS kocka (hidraulika tömb) meghibásodása esetén a teljes egység javításával, újra élesztésével tudjuk javítani, amelynek ára 45.000 Ft (Suzuki Swift/Ignis estében) - Suzuki SX4 esetében 55.000 Ft – 2 év garanciával. Műhelyünkben ezeket a tömböket plusz 10.000 Ft ellenében be is szereljük, ami magában foglalja az új fék olajat, illetve a fékrendszer légtelenítését, beüzemelését. A javítás pár órát vesz igénybe, vagy a kiszerelt tömböt juttatja el hozzánk, vagy mi szereljük ki és ... további részletek >>

be autójába a hibás alkatrészt. Vidéki megrendelők esetén csomagküldéssel is intézhető. Suzuki Swift, Splash, Ignis, Opel, Chevrolet, Renault, Peugeot stb... Ha beesik a pedál, ereszt a tömb, világít az ABS lámpa. Hívjon bizalommal! Audi, VW, Skoda, Seat típusok ABS elektronikájának feltanítása, kormányszög jeladó feltanítása, hibakód olvasás.


Feladva: 2017-04-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: SuzukiABS000tömbfeltanításaIgniskockajavításszereljükSwiftvagyeseténChevroletmagábanhibakódalkatrésztSX4meghibásodásaHívjonórátOpelamipár

Forrás: pepitahirdeto.multiapro.com

Hozzávalók a tésztához: 2 tojás 1 bögre cukor 200 g tehéntúró 1 kiskanál szódabikarbóna 1/2 kiskanál só 2 bögre liszt kókuszreszelék (a díszítéshez) Hozzávalók a krémhez: 3 tojássárgája 6 evőkanál cukor 5 evőkanál liszt 7 dl tej vaníliaaroma 200 g vaj Verjük fel a tojást a cukorral, majd adjuk hozzá a tehéntúrót, a szódabikarbónát, a sót és egy bögre lisztet, keverjük össze habverővel vagy kézi robotgéppel. Adjunk hozzá még egy bögre lisztet és keverjük össze. Tegyük ... további részletek >>

hűtőszekrénybe 60 percre a tésztát. Készítsük el a krémet: Keverjük ki a tojássárgáját a cukorral majd tegyük bele a lisztet és a tejet, kavarjuk össze habverővel vagy robotgéppel, lassú tűzön kezdjük főzni. Közben folyamatosan kavargassuk, amikor elkezd főni vegyük le a tűzhelyről és ízesítsük vaníliaaromával, hagyjuk hűlni. A vajat alaposan habosítsuk fel és keverjük hozzá a krémet. Vegyük ki a hűtőből a tésztát és osszuk 6 egyenlő részre, nyújtsunk belőle 6 lapot. Előmelegített sütőben, vajjal kikent tepsi hátulján süssük mindegyik lapot pár percig, amíg egy kis színt kapnak. A tortalapokat kenjük meg a krémmel és tegyük őket egymásra, szórjuk meg kókuszreszelékkel. Hagyjuk állni pár órát, majd szeleteljük. Jó étvágyat! www.webcukraszda.hu/bogres-raffaello-torta/


Feladva: 2017-04-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: keverjükbögrelisztettegyükmajdegyhozzáösszemegliszttésztáthagyjukevőkanálcukorVegyükkrémetcukorralrobotgéppelHozzávalókvagytortahabverővel

Forrás: pepitahirdeto.multiapro.com

Ausztriai kapcsolatokkal keresünk olyan agilis embereket Nemzetközi piacvezető Törzsvásárlói Rt.-hez akik Ausztriában partneri vezető Referensként tevékenykednének. Kiemelten várjuk 25-45 év közötti felsőfokú végzettséggel rendelkező céltudatos, sikerorientált munkatársak jelentkezését, akik nyitottak a tudatos vásárlási tanácsadó területre. Díjmentes, teljes körű magas színvonalú duális átképzést biztosítunk. Karrierlehetőség: • Kiemelkedő, teljesítményarányos nemzetközi jövedelem ... további részletek >>

• Életpálya program • Szakmai oktatások • Biztos háttér • Gépkocsi támogatás • Bónuszok Feladat: Az embereket és a cégeket informálni arról, hogyan tudnak tudatosan és felelősen vásárolni, ott, ahol eddig, azt, amit eddig, hogyan tudnak jelentős visszatérítéseket kapni készpénzben. A Vásárlási Tanácsadók feladata, hogy olyan plusz pénzeket tegyenek az emberek zsebébe, amely eddig is meg volt, de senki nem jutott hozzá, mert nem tudta, hogyan kell! A munkához tartozó elvárások:  Felső vezetéssel kapcsolattartás  Képzéseken való megjelenés Jövedelmi lehetőségek: Vásárlónként havonta 500-3000 forint lehetséges, teljesítményarányos jövedelem, amely kimagaslóan magasabb, mint amit Magyarországon bármilyen területen és pozícióban megkereshető! / Pl. 1000 vásárlónál 500.000-3.000.000,- millió forint havonta, EGYSZERI MUNKÁVAL!!!! / Gondolja át, hogy Ausztriában 8 588 584–en élnek és hányan vásárolnak nap, mint nap, és ennek megfelelően kiszámolhatja a havi jövedelmét is!!!! Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet! Email: rozsabusiness@gmail.com


Feladva: 2017-04-04    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8226eddigVásárlásihogyanjövedelem000AusztriaiteljesítményarányosakikAusztriábanmeghogynapmintemberekethavontatudnakforintnemzetköziamitnem

Forrás: pepitahirdeto.multiapro.com

VENDÉGLÁTÓS állásaink Németországban: szakács, felszolgáló, szobalány, főzőasszony. SZAKÁCS végzettséggel és valamennyi némettudással, szállással és ellátással. 1800-2400€ Bruttó. FELSZOLGÁLÓ (végzettség nélkül is) Wirshausba (kocsma) 900€ nettó + borravaló (kb 1600-1800€ nettó lesz a vége), szállással és ellátással. (valamennyi némettudással-A1-től) 35 éves korig. SZOBALÁNY és konyhai kisegítő (50-50%) egy kis Panzióba ( 8 szoba van) 1000-1200 € nettó, ... további részletek >>

szállással és ellátással. (B1 némettudástól) BeiKoch – segédszakács, KUKTA- (főzőasszonyt- főzni tudó személyt keresünk) vendéglőbe valamennyi némettudással, szállással és ellátással. 1000-1200€ nettó. További infók a www.nemetmunka.hu/gastro.html weboldalunkon, ahol regisztrációs lehetőség is van. Érdeklődni munkaidőben a +36 1 920 3433 vagy a +49 8641 6949 000 vezetékes számokon lehet. Várjuk jelentkezését! Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban)


Feladva: 2017-03-26    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 8364ellátássalszállássalnettónémetnémettudássalvalamennyi1000állásainkSZOBALÁNYVENDÉGLÁTÓSFELSZOLGÁLÓTeamMunka1800SZAKÁCSvan1200számokonkonyhai

Forrás: pepitahirdeto.multiapro.com

Olcsó, gyors személyszállítást végzünk Ausztriába, Németországba


Feladva: 2017-03-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: NémetországbavégzünkszemélyszállítástgyorsOlcsóBudapestEutaxiKisbusszalAusztriába

Forrás: pepitahirdeto.multiapro.com

Angol használt ruhák kaphatók bálás kiszerelésben, kiváló minőségben. A ruhák Manchester részéről háztól-házig gyűjtésből valók. Többféle bálából és árkategóriából választhat. A bálák eredeti csomagolásban vannak, így a minősége 100%-ig garantált! További kínálatunk: fajtára válogatott ruházat, munkaruhák, lakástextil, big-bag gyűjtőzsákos, játék, plüss, fehérnemű kiszállítás már 100 kg-tól! 20 éves tapasztalattal várjuk minden régi és új vásárlóinkat! Érdeklődés-rendelésfelvétel: ... további részletek >>

06307819494


Feladva: 2017-03-09    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: ruhák100használtígytapasztalattalházigbigAngolvannakévesháztóllakástextilBálagoldcsomagolásbantólrészérőlmunkaruhákmárkáseredetiManchestermár

Forrás: pepitahirdeto.multiapro.com

Minden számitógépünk akcióban! ÚJ számítógép, használt számítógép, többnyire 3 év garanciával! Új Gamer gépeink szintén óriási akcióban! Akcióink: www.pcfactory.hu/shop_artspec.php?artspec=1 Keresse a PcFactory oldalát a Facebook-on is, minden héten új nyereményjátékkal! Minden számítógépünk gyártás utáni teszteknek vetjük alá és 3, illetve 5 év GARANCIÁT vállalunk rájuk. Rendeljen, akár ingyenes kiszállítással, az egész ország területén! Nézzen be weboldalunkra! Játsszon velünk a ... további részletek >>

Facebook-on! www.pcfactory.hu - www.facebook.com/pcfactoryhu Érdeklődjön telefonon: 06 20 57 67 906


Feladva: 2017-02-27    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: pcfactoryMindenszámítógépakcióbanszámítógépünkfacebookGARANCIÁToldalátNézzenilletve906KeresseterületénakcióalátelefononországvetjükÉrdeklődjön

Forrás: pepitahirdeto.multiapro.com

Költöztetéssel, szállítással, megrendelőink nagy megelégedettségére! Tevékenységünk köré tartozik a Pianínó és Zongora szállítás is. Bízunk benne hogy minket választ. Kérem tekintse meg a költöztetés kalkulátorunkat, amivel ön előre ki tudja számítani a költöztetés árát! Nem csak Budapesten, hanem Vidéken is költöztetünk.A Költöztetés Budapest oldalon, További Információ: www.koltoztetesbudapest.eu vagy www.pianinoszallitas.eu Főbb tevékenységi területeink: Budapest, Budaörs, Budakalász, ... további részletek >>

Budakeszi, Dunakeszi, Dunaharaszti, Érd, Fót, Göd, Gödöllő, Gyál, Halásztelek, Kistarcsa, Mogyoród, Nagytarcsa, Őrbottyán, Pécel, Pilisvörösvár, Pomáz, Ráckeve, Szentendre, Szigethalom, Szigetmonostor, Szigetszentmiklós, Tököl, Törökbálint, Üllő, Vác, Vecsés, Veresegyház.


Feladva: 2017-02-26    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KöltöztetésBudapestwwwVácTevékenységünkPécelcsakDunaharasztiválasztÜllővagymegelégedettségéreŐrbottyánNemDunakesziminketTörökbálintnagyNagytarcsa

Forrás: pepitahirdeto.multiapro.com

Budafok kertvárosi részén családi házrész korrekt áron eladó. Külön bejárat, önálló épület, jó műszaki állapot. Az eladó részhez kiskert és szuterén is tartozik. - További infó a weboldalon


Feladva: 2017-02-26    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóTovábbiKülönifjtartozikáronköltözhetszuterénkorrektAzonnalkiskertházrészrészhezcsaládirészénállapotkertvárosiműszakiBudafoképületönálló

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! Van a környezetében, rokoni, baráti, ismerősi körében munkanélküli, közmunkás, kisnyugdíjas, kis jövedelemért sokat dolgozó modern kori rabszolga, vagy aki folyamatosan hitelekből él és nehezére esik befizetni a számlákat? Ezek az emberek példaképek az Ön számára, vonzónak találja az életüket? Biztos benne, hogy Önnek is ezt a forgatókönyvet írta meg az élet, amelyen nem szabad változtatnia? Úgy érzi, hogy a szerencse folyamatosan elkerüli, és hogy Ön mindig a rossz ... további részletek >>

oldalra kerül? Ismer olyan embereket, családokat, akiknek szívesen elfogadná az életszínvonalát? Sokat álmodozik arról, hogy milyen jó lenne, ha Önnek is jobb élete lenne anyagilag? Sokkal egyszerűbb, mint gondolná! Van egy rossz hírem! Most egy életre elveszem Öntől azt a kifogást, hogy soha sincs szerencséje, hogy soha sincs jó időben jó helyen! Van egy jó hírem! Élete legnagyobb lehetősége kopogtat az ajtaján, amelyet sem a múltban nem kaphatott eddig meg, és a jövőben sem fog soha megkapni máshol! Miért különleges ez a lehetőség és miért teljesen más, mint amikkel eddig megkeresték Önt? Nem kell egy fillért sem befizetnie semmire sem, nem kell megvennie felesleges termékeket, szolgáltatásokat, nem kell MLM rendszerben eladnia semmit sem, nem kell külföldiek zsebét tömni, nincsenek vásárlási és egyéb kötelezettségei! Ezzel szemben már az ingyenes regisztrációjánál kap 12.000,- forintot ajándékba, amelyet felhasználhat a mindennapi vásárlásainál, nyereség részesedést kaphat több mint 10.000 kereskedő és szolgáltató forgalmából, Ön kereshet minden külföldi ember mindennapi vásárlásából, számtalan lehetőség közül választhat szabadon, kap egy ingyenes bankszámlát, kap két ajánlói weboldalt, melyeken regisztráció nélkül is minden információ megtalálható, kap egy webirodát, ahol követheti a bevételeit, tanulhat és fejlődhet nem csak üzletileg, hanem emberileg is! Amit garantálni tudok, hogy kizárólag több pénze lehet, kevesebb nem, ez által semmilyen kockázata nincs, és ha más területen tevékenykedik, akkor továbbra is foglalkozhat vele szabadon, ha szereti azt, amit csinál. Továbbá garantálom, hogy minden segítséget megkaphat, amely szükséges lehet ahhoz, hogy megvalósíthassa minden célját és álmát, amelyet elképzelt magának! Túl szépen hangzik? Ha megismer, ennél még sokkal többet is fogok mutatni Önnek! Email: rozsabusiness@gmail.com Kérdéseivel keressen bizalommal!


Feladva: 2017-02-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemegysemmindenkapkellmégSokatsohamintÖnnekamelyetsokkalmiértmáskörnyezetébenamitÉletedolgozóingyenesVannakazthíremjövedelemért

Forrás: pepitahirdeto.multiapro.com

Non-stop bútorszállítás, költöztetés, lomtalanítás! Ügyfeleink időbeosztásához rugalmasan igazodunk, hétvégén és éjszaka is dolgozunk, telefonon a nap minden órájában elérhetőek vagyunk! Több éves tapasztalattal, jó referenciákkal, gyors és pontos munkavégzéssel hétvégén is hétköznapi árakon állunk rendelkezésükre! Igény szerint csomagolunk csomagolóanyagot kiszállítunk, szerelést is vállalunk! Tel: +36 70 2353403


Feladva: 2017-02-20    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: költöztetéshétvégénmindenbútorszállításcsomagolunkBudapestreferenciákkaléjszakaszerintCsacsitransztapasztalattaligazodunkIgénynapjánévesrugalmasanhét

Forrás: pepitahirdeto.multiapro.com

Több mint ezer féle divatékszer és kiegészítő, mobil és táblagép kiegészítő, kozmetikai cikkek, ásványok, csillámtetoválás, pénztárca, tetoválás, óra, piercing és még sok minden más a lehető legjobb árakon. Rengeteg állandó és aktuális, egymással összevonható kedvezmény! Törzsvásárlói program és ingyenes kiszállítás! Ez mind és még sok minden más a LILI BIZSU Webáruházban. Ilyen olcsón még nem vásárolt....


Feladva: 2017-02-18    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: mégsokkiegészítőBIZSULILImásmindenlegolcsóbbanRengetegvásároltkozmetikaimindkiegészítőkárakonnemkiszállításÉkszereklegjobbtáblagépingyenesóra

Forrás: pepitahirdeto.multiapro.com

10 éve működő tánc tanfolyam várja új kis tanítványait! 4-14 éveseknek. Helyszínek: XVI. kerület (Erzsébetligeti Színház, és Mltc Sportklub. XIV. kerületi Németh I. Ált.Isk. Korosztály szerint több csoportban: balett alapok, táncelőkészítő gimnasztika, videoklip táncok,divattáncok, színpadi show táncok, musicalek ... Fellépések, nyári napközis tánctábor. 5200 Ft/hó.


Feladva: 2017-02-17    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: kistánctáncokXVIvideoklipNémeth5200tanítványaitgimnasztikakerületitánctábortáncelőkészítőXIVnapközisvárjaalapokSportklubnyáritanfolyambalett

Forrás: pepitahirdeto.multiapro.com

Asztalos munkát, egyedi bútorok készítést, ajtó-ablakszigetelést, ablakfelújítást, mázolást, üvegezést, zár javítást vállalunk Pest megyében! Munkáink: - galériaépítés, beltéri tolóajtó készítés - gardrób szekrény gyártás, beépítés - lambériázás - szalagparkettázás - laminált burkolatok - zár javítás - egyedi bútorok készítése (konyha-, szoba-, irodabútorok) - nyílászárók gyártása, cseréje, mázolása, javítása és hőszigetelt üveg berakása - ajtó-, ablakszigetelés (hő-, por-, hang ... további részletek >>

ellen) A szigetelés svéd bemarásos technológiával, szilikon gumi felhasználásával történik. Előnyei: huzatmentesség, hőmérséklet emelkedés, porzárás. Bejárati beltéri-, kültéri ajtók javítása passzítása, pótlását, festése, záraik cseréje. Foglalkozunk műanyag ablakok (hagyományos nyíló-bukó és amerikai toló- és emelőpaneles), bejárati ajtók és erkélyajtók, beépítésével, cseréjével. Az ablakcsere utáni helyreállítást is vállaljuk, így Önnek nem kell külön kőműves szakembert megbíznia a régi ablakok bontása során - a falon - keletkezett sérülések javítása miatt. Rövid határidő, ingyenes kiszállás.


Feladva: 2017-02-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: javításaegyedibeltérizárablakokAsztalosajtókcseréjebejáratiajtóbútorokgumigardróbsoránhelyreállítástberakásaablakfelújítástbukóígyszilikonnem

Forrás: pepitahirdeto.multiapro.com

Minőségi, bontatlan bálás használtruha, számos fajtáit kínáljuk, értékesítés céljából, különböző kategóriákba sorolva. Friss gyűjtésű, szezonális, minőségi import, gyerek használtruha, felnőtt használt ruha, használt munkásruha, és lakástextil, valamint ágynemű. Nyers bálásruha, és válogatott, zsákos kiszerelések! Érintetlen, eredeti csomagolások! Nagykereskedelmi árak, magánszemélyek részére is! Ingyenes házhoz szállítás országosan. Tel: 0670-579-1452 (Viber is!) Web: ... további részletek >>


Feladva: 2017-02-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: használtruhaminőségibáláshasználtimportNagykereskedelmibontatlanlakástextil1452FrisscsomagolásokGyulamunkásruha579sorolvaeredetiangol0670ruha

Forrás: pepitahirdeto.multiapro.com

Német egyéni és kiscsoportos nyelvoktatás, korrepetálás, vizsgafelkészítés veszprémi, központhoz közel fekvő családias nyelvstúdióban. Részletek és jelentkezés: www.nyelvstudio.hu/#/start


Feladva: 2017-02-06    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: NémetVeszprémcsaládiasfekvőNyelvstúdióközelVölgyhídközponthozmagánoktatásveszpréminyelvstudiovizsgafelkészítéswwwkorrepetáláshttpnyelvoktatásegyéni

Forrás: pepitahirdeto.multiapro.com

A torokgyulladás a torok égő, kaparó érzésével, nyelési nehézséggel jelentkezik. Ezt gyakran kíséri köhögési inger, hőemelkedés, de kisgyermekeknél akár láz is kialakulhat mellette. A torokgyulladás többnyire vírusos eredetű, a kórokozó kimutatása gyorsteszttel és tenyésztéssel is történhet. A mandulagyulladás és a torokgyulladás kezelése heveny esetekben megkívánja az antibiotikumok szedését. Ez a terápia teljes gyógyulást hoz, de mellette érdemes olyan étrendet is folytatni, ami kíméli a torok ... további részletek >>

nyálkahártyáját. Torokgyulladás és mandulagyulladás kezelése weboldalunkon!


Feladva: 2017-02-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: TorokgyulladásmandulagyulladásmellettetorokkezelésekaparótenyésztésselhőemelkedéshozégőgyorsteszttelingergyógyulástKittikimutatásanyálkahártyájátami

Forrás: pepitahirdeto.multiapro.com

Első mini gurtni csere ára 6000 Ft, a többi 3000 Ft/db. Első maxi gurtni csere ára 7000 Ft, a többi 4000 Ft/db áron tudjuk vállalni. Pest megye egész területén ingyenes kiszállással. Munkáinkra garanciát vállalunk! A szolgáltatás megrendeléséhez hívja a 061 445 11 81 telefonszámot. Adja meg ügyfélszolgálatunknak nevét, címét, elérhetőségét és egyeztessen egy időpontot, amikor szakembereink kicserélhetik a gurtnit. Telefonszám: 061 445 11 81 Email: ajanlatkeres@redony-szereles.org ... további részletek >>


Feladva: 2017-01-05    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megcsereszerelesgurtniElső445061többiáraorgredonyidőpontotmegrendeléséhezWebvállalniegy3000Ftszolgáltatásajanlatkeres@redonytudjukegyeztesen

Forrás: pepitahirdeto.multiapro.com

Szolgáltatások / akár azonnali kiszállítás: -Páncélszekrények, lemezszekrények, irodatechnikai eszközök számítógép-konfigurációk szállítása -Selejtezés, lomtalanítás -Építőanyag szállítás -Épületen, lakáson belüli átrendezés -Zongora, pianínó, valamint egyéb súlyos, nagy kiterjedésű hangszerek szállítása -Szoba vagy konyha bútorát -Lapra szerelt bútorait, Valamelyik háztartási gépét, Kerti bútorait -Irodák költöztetése -Múzeumi tárgyak biztonságos szállítása -Pénztárcabarát ... további részletek >>

szállítási árak -Tehertaxi olcsón: fix szállítási ár felárak nélkül Plató mérete: 420x220 Zárt Dobozos!3,5 tonnás alatti szállításra alkalmas! Rakodó/Rakodók: Biztosítva! Nyíregyházi Telephellyel! Szolgáltatási Terület: Magyarország egész területén! Szállítási idő: 0-24h Szombat/Vasárnap is! Hívjon bizalommal! Tóth Attila +36-30/945-2252


Feladva: 2016-12-06    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: szállításaSzállításibútoraitAttilaTehertaxiTóthTerületháztartásiakárDobozossúlyosbizalommalPénztárcabarátlomtalanításSzolgáltatásiValamelyikZárt24h

Forrás: pepitahirdeto.multiapro.com

Tűzifa? Szén? Szilárd tüzelő? Ha tűzifára (ömlesztett köbméterben, vagy mázsára), vagy szénre (lengyel feketeszén, cseh barnaszén, német brikett) van szüksége, hívjon bennünket! A tüzelő kiszállításán kívül vállaljuk a behordást, illetve megbeszélés alapján a tűzifa felrakását (sliht) is.


Feladva: 2016-11-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tűzifaSzéntüzelővagynémetSzilárdbehordástbarnaszénvállaljukcsehBudapestkívülfeketeszénGáborkiszállításánlengyelFeketeszénreSZÁLLÍTÁSslihtvan

Forrás: pepitahirdeto.multiapro.com

Bontási és kőműves munkákkal foglalkozom. Felújítandó lakások és más helységekben, továbbá családi házakban stb... Falak, burkolatok nyílászárók kibontásával panel lakásokban is. Fűtés és gépészet megszüntetése radiátorok és csövek lebontása. Kádak, zuhanytálcák megszüntetése. Szaniterek és csaptelepek leszerelése. Fém szerkezetek bontása és épület bontás. Válaszfalak építése és vakolása aljzatbetonozás. Kisebb javító és helyreállító munkálatokat is elvégzem. Budapesten és környékén.


Feladva: 2016-11-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megszüntetésebontáskőművesleszereléseXIXlakásokbanGáborKisebbmáscsaptelepekXVIIIpanelNovákaljzatbetonozáslakásokSzaniterekXVIIkibontásávalXVI

Forrás: pepitahirdeto.multiapro.com

Méhészek F I G Y E L E M! Méhész huzal / keretdrót AKCIÓ! Akár INGYENES szállítással! Ø 0,4 és 0,5 mm-es lágy huzalok dobra csévélve: Horganyzott fényes: 1.250,-Ft/kg - Rozsdamentes/ inox: 2.500,-Ft/kg. Kiszerelés: 1, 2, 3, 4, 5 kg, igény szerint, de lehet nagyobb is- drótspecial.hu 1-2 kg. vásárlás esetén a szállítási díj: 1,270,-Ft/csomag 3-5 kg. vásárlás esetén a szállítási díj: 1,000,-Ft/csomag 5-9 kg. vásárlás esetén a szállítási díj: 500,-Ft/csomag 10 kg, és a fölötti ... további részletek >>

vásárlás esetén, a szállítás INGYENES! Utánvétes szállítás esetén, az utánvétkezelési díj 400,-Ft/csomag -Megrendelésre gyártunk más méreteket és termékeket is ! (acélhálók, méhész huzalok, vágott drótok drótspecial.hu) Kereskedőket, viszonteladókat is kiszolgálunk!


Feladva: 2016-11-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: huzaldobonszerinthorganyzottdrótkeretMÉHÉSZKereskedőketKfthuzalraPluszinoxdíjszabásDrótszálcsévéltROZSDAMENTESpostázásaAKCIÓdobra250termék

Forrás: pepitahirdeto.multiapro.com

Melyek a szájszárazság okai? A szájszárazság oka lehet stresszes helyzet, idegeskedés, ilyenkor természetes, hogy a szervezet így reagál. Azonban, ha gyakran észleljük a száj kiszáradását, érdemes alaposabban utánanézni, mi lehet a háttérben. A szájszárazság ellen akkor tudjuk megtalálni a megfelelő terápiát, ha ismerjük a kiváltó okot. Amennyiben rendszeresen gyógyszert szedünk, olvassuk el a mellékhatásokat, hiszen sok fájdalomcsillapító, gyulladáscsökkentő, vérnyomáscsökkentő gyógyszer is ... további részletek >>

okozhatja a nyáltermelődés csökkenését. A szájszárazság oka ugyanakkor lehet betegség is, pl. cukorbetegség vagy Parkinson-kór.


Feladva: 2016-11-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: szájszárazságlehetokaokaiMelyekugyanakkorszájhiszenhelyzetmegfelelőészleljükmellékhatásokatstresszesmegtalálnigyakranolvassuktudjukcsökkenésétkór

Forrás: pepitahirdeto.multiapro.com

Minőségi Taktikai, outdoor, sport, vadász ruházat, kiegészítők és felszerelések nagy választékban! Webshopunkban több 100 termékkel, kedvező árakkal és folyamatos akciókkal várunk! Országos kiszállítás.


Feladva: 2016-10-30    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: FreskaZonetermékkeloutdoor100TaktikaitöbbMinőségiWebshopunkbanBudaörskiszállításválasztékbanNetOrszágosnagyvárunkfelszerelésekWebáruházakciókkal

Forrás: pepitahirdeto.multiapro.com

Minden gépjárműre, személyautóra, kisteherautóra, kamionra traktorra, buszra készítünk méret pontos üléshuzatot. Legalább 100 fajta anyag minta közül választhat. UV álló anyagok, gyári kárpit anyagok, utángyártott anyagok, elasztikus anyagok, szövetek, között válogathat. A különböző színű, mintájú, vagy minőségű anyagok összevariálásának csak az ön fantáziája szabhat határt. Vásárolhat nálunk trikó üléshuzatokat, valamint univerzális üléshuzatokat is. Várjuk szeretettel. Tekintse ... további részletek >>

meg weboldalunkat: huzatkiraly.hu Bán&Vincze BT Kecskemét, Jókai utca 41 Telefon: 0630/911-1277 - 0630/4853749


Feladva: 2016-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: anyagokVinczeBán0630üléshuzatokatKecskemétkárpitvalamintpontosminőségűüléshuzatgyáritrikóméretvagyMéretpontoshuzatkiralyállónálunkkészítünk

Forrás: pepitahirdeto.multiapro.com

Autóbontók bontott alkatrészei egy helyen, az ország legnagyobb bontott alkatrész webáruházában: - Több, mint 80.000 db bontott alkatrész! - Pénz-visszafizetési garancia 15 napig - Házhoz szállítás másnapra - Magánszemélyek és viszonteladók kiszolgálása. A www.bontoplaza.hu webáruházban magyar autóbontók kínálatából vásárolhat karosszéria, fék, futómű, elektromos és motorikus alkatrészt., jelenleg az alábbi modellekhez: Alfa Romeo, Audi, BMW, Chevrolet, Chrysler, Citroen, Dacia, Daewoo, ... további részletek >>

Daihatsu, Fiat, Ford, Honda, Hyundai, Infiniti, Iveco, Jaguar, Jeep, Kia, Lada, Lancia, Land Rover, Lexus, Man, Mazda, Mercedes-Benz, Mini, Mitsubishi, Nissan, Opel, Peugeot, Porsche, Renault, Rover, Saab, Seat, Skoda, Smart, Ssangyong, Subaru, Suzuki, Toyota, Volvo, VW Volkswagen.


Feladva: 2016-10-15    [Autó - Motor - Jármű]

Címkék, kulcsszavak: bontottautóbontókhttpRoverhelyenegyalkatrészeialkatrészbontoplazaMazdafékHyundaiszállításAudiwebáruházábanMankarosszériaVolkswagenHondaHázhoz

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! A Szuvorov Kft. édesipari termékek importálásával és forgalmazásával foglalkozik. Szeretnénk, hogy minél több helyen jelenjenek meg termékeink, ezért várjuk viszonteladók jelentkezését! Szerződött partnereinknek akár kizárólagos forgalmazási jogot tudunk biztosítani, terület megjelöléssel! Az ország távolabbi pontjain található kiskereskedelmi egységek számára, (megrendelt mennyiségtől függően) ingyenesen szállíttatjuk ki megrendeléseiket. Termékeink ... további részletek >>

megtekinthetőek a honlapunkon.


Feladva: 2016-10-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TermékeinkSzuvorovtalálhatóUramakárminélpontjainHölgyempartnereinknekhogymegrendeléseikettávolabbiTiszteltSzerződöttSzeretnénkszállíttatjukország

Forrás: pepitahirdeto.multiapro.com

MI AZ AGYKONTROLL? A Stanford-i egyetem kutatói szerint elménk adta képességeinknek csupán mintegy 2%-át használjuk ki. A Silva-féle agykontroll egy tudományosan megalapozott, egyszerű, praktikus, könnyen elsajátítható önfejlesztő módszer, ami lehetővé teszi, hogy ennél lényegesen nagyobb mértékben használjuk ki istenadta lehetőségeinket, s így sikeresebben oldjunk meg mindenfajta problémát. Egyik fontos eszköze a relaxáció avagy lazítás, ami egyúttal a bizonyítottan megbetegítő hatású ... további részletek >>

stresszt is levezeti. Az agykontroll nem vallás. Ateista ember ugyanúgy megtanulhatja elméje hatékonyabb használatát, mint az istenhívő, ahogy világnézetétől függetlenül mindenki megtanulhat például úszni is. Az agykontroll nem mágia, hanem elménk sokak által ma még kevéssé ismert, s emiatt kevéssé kiaknázott képességeinek okos – tehát nem kishitű és nem is fanatikus – használata, ami kiegészíti a cél elérése érdekében tett cselekedeteinket! Jelszavunk: egyensúly. MIRE JÓ AZ AGYKONTROLL? – A stressz levezetésére, – alvászavar megszüntetésére, – ébresztőóra nélküli, időzített ébredésre, – élénkítőszer nélküli felfrissülésre (például autóvezetéskor), – a fejfások 90%-ának és a migrénnek gyógyszer nélküli elmulasztására, – a minket foglalkoztató kérdések – bölcsebb tudatalattink és az „összemberi tudás”* bevonásával történő – megválaszolására, – a memória fejlesztésére, – gyorsabb és hatékonyabb tanulásra, – a jó döntéshozatal megkönnyítésére, – céljaink elérésére (magunk és szeretteink gyógyulását is beleértve), – a fájdalom és a vérzés gyors uralására, – szokásaink (pl. dohányzás, alkoholizálás, túlzott evés, lustaság, rendetlenség) akaraterő és kínlódás nélküli megváltoztatására, – gyerekeink és felnőtt szeretteink szavak nélküli megsegítésére, – a misztikusnak hitt, ám valójában természetes és hasznos intuíció avagy megérzőképesség rendkívüli fokozására. Tudományosan is bizonyított tény, hogy az emberi elmék között láthatatlan szálakkal kapcsolat van. Az egyes emberek tudása így bizonyos értelemben „összemberi tudássá” válik. Többnyire ez magyarázza, hogy felfedezők, feltalálók sokszor egyszerre álltak és állnak elő azonos ötletekkel. Nem véletlenül mondja hát a módszerről a világhírű amerikai orvos, dr. Clancy D. McKenzie: „Ha valaki megtapasztalja az eredményeket, amiket ezen a tudatszinten el lehet érni, akkor a későbbiekben már meg se kísérel ennek használata nélkül fontos döntéseket hozni vagy problémákat megoldani.”


Feladva: 2016-10-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 8211AGYKONTROLLnemnélküli8222amiméghogy8221kevésséhasználjukhatékonyabbfontoshasználatapéldáulMIREtudományosanszeretteinkelménkígyavagyának

Forrás: pepitahirdeto.multiapro.com

Mezőgazdasági szaküzleteknek, iparcikk boltoknak, virágüzleteknek és még sok hasonló kiskereskedőnek ajánljuk közel 5.000 termékünket. Saját gyártmányaink is vannak, mint pl. a képen látható temetői szett. Látogasson el raktárunkba Halásztelekre, ahol minden termékünket megtekintheti, kipróbálhatja. Támogassa a magyar gyártókat és gyártmányokat!


Feladva: 2016-10-08    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: termékünketboltoknakiparcikk000MezőgazdaságiraktárunkbaközelgyártmányokatHalásztelekLátogassonajánljukgyártókatgeogallszettkiskereskedőnekmagyarsok

Forrás: pepitahirdeto.multiapro.com

14 év iskolai angol tanítás után rádöbbentem, hogy csak egy helyben toporgok, nem jutottam közelebb a céljaimhoz. Elegem lett a hónapról-hónapra élésből, ezért elkezdtem keresgélni, mit is lehetne tenni annak érdekében, hogy több pénzt keressek, és több szabadidőm legyen. Ekkor találkoztam a Ganoderma kávéval a DXN online üzlet keretében. Bárki tudja csinálni és komoly befektetés nélkül elkezdhető, mindenféle diploma és előképzettség nélkül. Engem nagyon megfogott a személyre szabható honlap ... további részletek >>

is, amit a csatlakozáskor kaptam: http://kavekiraly.hu/uzleti_lehetoseg Rólam bővebben itt olvashatsz a honlapomon: http://kavekiraly.hu/az_en_tortenetem Csatlakozni itt tudsz: http://kavekiraly.hu/member_registration_private Keress bátran, ha kérdésed van: http://kavekiraly.hu/kapcsolat


Feladva: 2016-10-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kavekiralyhttptöbbnélkülhogyittszabhatólehetnevankomolyközelebbhonlapomonEkkoriskolaiszemélyremitkérdésedcsinálnijutottamolvashatszlegyen

Forrás: pepitahirdeto.multiapro.com

Cégünk vállalja autók-motorok mentését szállítását Budapesten és Magyarországon belül. Hívjon bizalommal! Gyors, pontos, precíz kiszolgálás, versenyképes árak. Autómentés - Motormentés www.csupiautomentes.hu tel.:06 70 62 62 777 ALFA ROMEO AUDI BMW CHRYSLER CITROEN DACIA FIAT FORD HONDA HYUNDAI KIA LANCIA LAND ROVER MAZDA MERCEDES MITSUBISHI NISSAN OPEL PEUGEOT RENAULT SEAT SKODA SSANGYONG SUZUKI TOYOTA VOLKSWAGEN VOLVO


Feladva: 2016-09-19    [Autó - Motor - Jármű]

Címkék, kulcsszavak: AutómentésMotormentés777TOYOTAMAZDAMagyarországonCHRYSLER6262SUZUKIROVERBudapestenBMW24hSSANGYONGárakLANDszállításátAUDIszállításSKODALANCIA

Forrás: pepitahirdeto.multiapro.com

Válassz kutyádnak nyakörvet széles választékunkból, legyen szó akár kistestű, akár nagy testű kutyáról.


Feladva: 2016-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: akárszóKutyalegyenválasztékunkbólszélesnyakörvetkutyádnakkutyárólVálassztestűgubanagyebengyártásakistestűnyakörvek

Forrás: pepitahirdeto.multiapro.com

Bontott kisméretű tégla 75 Ft/db Országos kiszállítás! www.bontott-tegla.co.hu


Feladva: 2016-09-12    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: teglabontottkisméretű75FtÉrdKöveswwwkiszállításOrszágos

Forrás: pepitahirdeto.multiapro.com

Amiért érdemes figyelemmel kísérnie minket: • 60-70-80 % kedvezmény! • Kifutó szériás bútorok, amíg a készlet tart! • Hetente megújuló választék! • Konyhabútor, 4-6 elemes 29.000 Ft-tól • Szobai szekrénysor 29.000 Ft-tól • Hálószobai szekrénysor 29.000 Ft-tól • Tükrös gardrób 19.000 Ft-tól • Ülőgarnitúrák 39.000 Ft-tól • Ágy 19.000 Ft-tól • Étkezőgarnitúra 19.000 Ft-tól • Tálalószekrény 19.000 Ft-tól • ... további részletek >>

Kiegészítő kisbútorok 3.000 Ft-tól


Feladva: 2016-08-30    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 8226tól000szekrénysorbútorokminketTálalószekrényfolyamatosanválasztékkísérnieÉtkezőgarnitúraAkciósmegújulófigyelemmelÁgyHetenteérdemesÜlőgarnitúrák

Forrás: pepitahirdeto.multiapro.com

Szakszerű nyílászáró beépítés és csere Budapesten és országosan a Milano Nyílászáró profi, több éves szakmai tapasztalattal rendelkező csapatával. Cégünk nyílászáró forgalmazással is foglalkozik, így a felmérés után a megrendelő igényeihez igazodva tudjuk összeállítani egyedi ajánlatunkat, melyet meg is valósítunk Önnek! Legyen szó ablakokról, bejárati és beltéri ajtókról, garázskapuról, redőnyről, vagy szúnyoghálóról nálunk jó helyen jár! Kérjen ajánlatot kötelezettségek nélkül még ma!


Feladva: 2016-08-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: nyílászáróhelyenMilanomégegyedinélkülajtókrólBudapestenösszeállítanikötelezettségekCégünkbeltéricseretudjukajánlatotcsapatávalbejáratibeépítésjár

Forrás: pepitahirdeto.multiapro.com

1 órán belül ott vagyunk, nincs kiszállási díj! Hétvégén és ünnepnapon is hívhat bizalommal, nonstop! Kerti kút, szökőkút vagy akár medence bekötését is vállalunk. Megoldunk mindent: legyen az átfúrt vízcső, ázás, -csap, - mosdó vagy akár -kádcsere, vagy vizes blokk teljes generálja, hívjon bátran. Mindenre van megoldás!


Feladva: 2016-08-12    [Lakossági szolgáltatás]

Címkék, kulcsszavak: vagyakármosdószökőkútvagyunkMindenrecsapkútottbátranázásKertibelülhívjonvízcsőnonstopórángeneráljaátfúrtbizalommalBudapestteljeslegyen

Forrás: pepitahirdeto.multiapro.com

Személyre szabott gyógynövény teák tanácsadással. Minőségi szálas teák, gyógynövényes teakeverékek, tearendelés a termelőtől! Rigó teák Vegyszermentes kistermelés, gyűjtés, gondos válogatás. Íz-illat-harmónia.


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teákgyógynövényszálasMinőségiVegyszermentesszabottSzemélyreRigóteakeverékektanulóillatgyógynövényesIstvánválogatásgondosgyűjtéstanácsadássalEger

Forrás: pepitahirdeto.multiapro.com

A legjobb otthoni segéd. E világszabadalmazott szerkezet szinte bárhol, bármilyen körülmények között felállítható, használható magunk, barátaink nagy megelégedésére. Minden grillezhető rajta. Teljes egészében rozsdamentes anyagból kézzel készült. A hihetetlen teljesítményű, fém hajtóműves kis méretű motor egy akkumulátor töltéssel több mint 20 órán át képes üzemelni. Bárhová vihető, vagy szállítható akár egy kis táskában is. Mérete igény szerint.


Feladva: 2016-08-08    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: kisegyGrillDobvagykörülményekméretű174rajtavihetőbármilyenhajtóműveskényelmesengrillezhetőBárhovábárholfémGrillezésszerintMindenüzemelniigény

Forrás: pepitahirdeto.multiapro.com

Új, garantáltan eredeti, számlás Kingston Pendrive-ok 1 év garanciával, gyors kiszállítással: Kingston 8GB USB 2.0 Pendrive: 1420 Ft Kingston 16GB USB 3.0 Pendrive: 1700 Ft Kingston 32GB USB 3.0 Pendrive: 3000 Ft Kingston 64GB USB 3.0 Pendrive: 5800 Ft Középkategóriás (gyorsabb, strapabíróbb), csak a héten: Kingston USB 3.0 pendrive 16GB *DTR 3.0 G2* (120/25MBps) - 2990Ft Rendelni a weboldalról lehet: www.itmedia.sk/shop Megrendelését még aznap továbbítjuk szállító partnereink ... további részletek >>

felé, amit a Sprinter futárszolgálat már másnap, a Pick Pack Pont 2 munkanap alatt kézbesít. A pesti csomagpontra a délután 2 óráig beérkezett megrendeléseket már másnap délben beszállítjuk, így gyakorlatilag 24 órán belül átveheti a megrendelését, legyen az bármilyen kis értékű!


Feladva: 2016-07-30    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: pendriveKingstonUSBmegrendelésétmásnapmár16GBmegrendeléseketPick32GBitmediaMediabeérkezettfutárszolgálat1700átvehetiwwwóráigSprinter1420belül

Forrás: pepitahirdeto.multiapro.com

Mérleges adagoló gép eladó, az Ön igényei szerint! Poros, szemcsés vagy kisebb darabos áru (morzsa, száraztészta, magvak, stb.) adagolására, csomagolására alkalmas adagoló gép eladó. www.gepetgyartok.hu/adagolo1.htm Írja meg igényeit, és kérjen árajánlatot e-mailben! Elérhetőség: Kálmán László 6791 Szeged, Negyvennyolcas u. 49. Tel.: 30/604-5453 www.gepetgyartok.hu


Feladva: 2016-07-11    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: gépadagolóSzegedLászlóeladóKálmángepetgyartokwwwhtmmorzsa6791adagolo1árudaraboskisebbElérhetőségvagymailbenalkalmasszemcsésárajánlatot5453

Forrás: pepitahirdeto.multiapro.com

A Bujdigép Kft. 2004-től biztosít nagyteljesítményű munkagépeket kis- és nagyberuházásokhoz Szegeden, Csongrád megyében és országosan. Béreljen földmunkagépeket, autódarukat, emelőgépeket a Bujdigép Kft.-től. Makó, Kiskunhalas, Baja, Mórahalom, Kistelek, Hódmezővásárhely térségében biztosítunk munkagépeket kis- és nagyberuházásokhoz.


Feladva: 2016-06-13    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: nagyberuházásokhoztőlkisKftmunkagépeketBujdigépMakóSzegedennagyteljesítményűbiztosít2004biztosítunkemelőgépeketSzegedtérségébenautódarukatAnderass

Forrás: pepitahirdeto.multiapro.com

Kútfúrást vállalok! Szigetszentmiklós, Szigethalom, Tököl,Halásztelek, Dunaharaszti, egész Csepel Szigeten és környékén,Délegyháza,Dunavarsány, Alsónémedi, Bugyi,Ócsa, Áporka, Kiskunlacháza, Apaj,Majosháza Budapesten és környékén,Érd, Göd,Sződ, Dunakeszi. ZÁRT ALJJAL. Minőségi szűrőkkel. A jó vízhozamú és homokmentes kút érdekében. KÉZZEL acélcsőben és helyszínen összeszerelt GÉPPEL.40mm-tõl-125mm-ig. Szivattyú telepítéssel is. SZAKMUNKA. Megfizethető árak, garanciával! Hívjon bizalommal


Feladva: 2016-05-31    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GÉPPELgaranciávalkútfúrásKÉZZELkörnyékénMinőségibizalommalKiskunlacházaHalásztelekALJJALáronHívjonÁporkaösszeszereltTökölZÁRTreálisÓcsahelyszínen

Forrás: pepitahirdeto.multiapro.com

Próbálja ki a mobil számítógép szerviz előnyeit. A javítást intézze kényelmesen, otthonából! Házhoz megyünk és megoldjuk számítógépes problémáit, legyen szó asztali számítógépről, vagy laptopról. 1 órán belüli munkavégzés esetén, csak kiszállási díjat kell fizetni! Készséggel segítünk mindenben, kérje tanácsunkat! Tel: 0620-4-117-117 www.pcjavitas.net


Feladva: 2016-04-18    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: szerviznetpcjavitas117számítógépszámítógépestanácsunkatmobilmunkavégzésmegoldjukkérjePróbáljabelülimegyünkmindenbenBudapestenóránHázhozsegítünk

Forrás: pepitahirdeto.multiapro.com

Imagine színkatalógus alapján 260 féle színárnyalatban választható. Hosszú élettartamú, vízzáró, de páraáteresztő, időjárás állósága kiváló, öntisztuló díszvakolat. 10 év gyártói írásos szín- és termékszavatossággal. Anyagszükséglet: ~ 2,5 Kg/m2 Kiszerelés: 15 Kg/vödör kiadósság ~ 6 m2


Feladva: 2016-04-06    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: díszvakolatfélekapartöntisztuló260SILICONkiválóalapjánkiadósságállóságaszínkatalógusvödöridőjárásImagineKiszereléspáraáteresztőKftAnyagszükséglet

Forrás: pepitahirdeto.multiapro.com

Vendégházunk a Dunakanyarban, Börzsöny egyik legszebb részén található, ahol patakcsobogásra és madárdalra ébredhet. Az emeleten három szoba várja a Kedves Vendégeket. Téli börzsönyi túra után meleg szaunával, nyáron fűtött medencével tesszük komfortossá a nálunk töltött napokat. A gyermekek örömére, előttünk jár a királyréti kisvasút. Szeretettel várjuk mindazokat, akik nyugalomban, jó levegőn, családias környezetben szeretnék szabadságukat eltölteni.


Feladva: 2016-04-01    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: börzsönyimedencévelpihenésszabadságukatvárjakirályrétiegyikfűtöttszeretnékszobajárBörzsönynyáronkörnyezetbenháromelőttünkDunakanyarbanszaunával

Forrás: pepitahirdeto.multiapro.com

JUNKERS gázkészülék szakszerviz Budapest. Junkers, Bosch szerviz. Junkers cirkók és vízmelegítők éves karbantartása javítása, cseréje. Garanciális kazánok ellenőrzése Budapesten és környékén. Gyors, megbízható, precíz munka, korrekt ár! Budapest területén nincs kiszállási díj! Ha önnek fontos családjának biztonsága, évente ellenőriztesse gázkészülékét! Hívjon bizalommal! Junkers szerelés, gázkészülék szerviz, gáz szerviz, Junkers márkaszervíz, Bosch márkaszervíz. Kazán szerviz.


Feladva: 2016-03-28    [Lakossági szolgáltatás]

Címkék, kulcsszavak: JunkersszervizBudapestmárkaszervízBoschkarbantartásabiztonságaprecízévescsaládjánakmegbízhatóvízmelegítőkfontosGyorsgázcirkókönnekkörnyékéndíj

Forrás: pepitahirdeto.multiapro.com

Masszázskrémek, olajok profi masszőröknek, wellness, szépség stúdióknak, vagy otthonra. Masszőrök, kozmetikusok, természetgyógyászok az országban bárhol, kedvező áron vásárolhatnak masszázskrémeket, olajokat, higiéniai papír és textil árukat, masszázskellékeket. www.harmoniamasszazskellek.hu Rendelési összeghatár nincs, kedvező kiszállítási díjak!


Feladva: 2016-03-16    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: kedvezőolajokMasszázskellékdíjaktextilMasszőrökHarmóniakiszállításipapírotthonragyógykrémekhigiéniaivagyMasszázsnincsolajokatstúdióknakösszeghatár

Forrás: pepitahirdeto.multiapro.com

Dormán László mosógépszerelõ vállalja Whirpool, Ignis, Polar, Energomat, Minimat, Midimat, Energolux, LG, Zanussi, NDK-s WA tipusú, stb. automata mosógépek javítását. MOSÓGÉPSZERVIZ KISPESTEN a kerületben lakóknak, mosógépszerelés munkanapokon, akár 4 órán belül is lehetséges. Mosógépszerelés: Erzsébet, Kõbánya, Pestlõrinc, Pestimre, Csepel, Soroksár, Ferencváros, Józsefváros, Kispest és a XVII. ker.-ben. www.mosogepszereles-javitas.hu


Feladva: 2016-03-14    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 245MosógépszerelésDormánkerLászlówwwZanussirinclakóknakhttpEnergoluxXIXkerületbenbenMidimatPestlBudapestKISPESTENMinimatbányaMOSÓGÉPJAVÍTÁS

Forrás: pepitahirdeto.multiapro.com

Több mint 10 éve foglalkozunk PIANÍNÓ és ZONGORA szállítással. Szállítóink profi, gyakorlott szakemberek! Vállaljuk magánszemélyek, és cégek PIANÍNÓ és ZONGORA szállítását, alkalmanként, vagy rendszeres időközönként is! Továbbá vállaljuk Cégek és Magánszemélyek Költöztetését Budapesten és Vidéken egyaránt! Pianínó Szállítás, Költöztetés Budapest, Szállítás, Lomtalanítás, Költöztetés kalkulátor, Költöztetés olcsón a PianinoSzallitas.eu weboldalon AKCIÓS ÁRAKON!


Feladva: 2016-03-11    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KöltöztetésPianinóMagánszemélyekCégekvállaljukSzállításBudapestZONGORAPianínószállításolcsóngyakorlottprofikalkulátorSzállítóinkLomtalanításTovábbá

Forrás: pepitahirdeto.multiapro.com

Helló! 30 éves szakmai gyakorlattal és tapasztalattal vállalunk szobafestést, mázolást, tapétázást. Díszléc, stukkó, rozetta, bordűr felrakását, díszítő festést. Kisebb-nagyobb munkák akár azonnali kezdéssel is! Vállalunk még: gipszkarton szerelést, parkettázást, lambériázást. Hideg-meleg burkolást, tető szigetelést. Ajtók-ablakok kibontását, beépítését. Ha szeretne tiszta, szép, korrekt munkavégzést megbízható szakiktól, kérem keressen! A szomszédos megyékben is dolgozunk szívesen!


Feladva: 2016-02-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SzépgyakorlattalVállalunkMihálymeleglakásfelújításmunkátkorrektmázolástHidegtapétázásterületénnagyobbtisztaszobafestéstlambériázástmázolásmegyék

Forrás: pepitahirdeto.multiapro.com

Betonacél, acélháló, betonvas hajlítás kedvezményes nagykereskedelmi áron! Nagyobb megrendelés esetén még nagyobb árkedvezményt adunk. Cégünknél az árut leszállításkor is kifizetheti. Önnek csak annyi a dolga, hogy az e-mail címünkre elküldi a Statikai tervet! Mi kiszámoljuk és legyártjuk a szükséges mennyiséget. Üzenhet itt is, vagy a honlapunkon található elérhetőségen!


Feladva: 2015-12-22    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: hajlításBetonvasAcélhálóBetonacéllegyártjukBudapestcsaknagyobbkiszámoljukKftÖnnekmelybőltervetCentrumkifizethetibetonvascentrumáronStatikaiÉpít

Forrás: pepitahirdeto.multiapro.com

Mistyque FehérneműSzalon Online Márkás termékek: Triumph, Sloggi, Felina, Skiny, Misty, Bahama. Rider papucsok, minőségi fehérneműk, fürdőruhák, harisnyák, zoknik - KIFUTÓ MODELLEK KEDVEZŐ ÁRON! Kínálatunkból: FIORE 40 den-es, mintás harisnyanadrágok, több színben: 1.550 Ft. SKINY Essentials Tolerance női trikó (kék vagy narancs): 4.250 Ft. Átadás személyesen: Budapesten (XVII. ker.), Bálványoson (Somogy), vagy országos kiszállítással. Webáruházunk: www.mistyque.hu


Feladva: 2015-11-27    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: mistyqueMárkásországosfehérneműkOnlinevagyFehérneműSzalonpapucsokRiderSKINYfürdőruháknarancsmintáskékdenminőségitrikóFIORESomogynőiTolerance

Forrás: pepitahirdeto.multiapro.com

Fűtsön hagyományosan fával, szénnel vagy vegyesen. Elégetheti a papír hulladékot, reklámújságokat és a kartondobozokat is. Magyarországon az egyik legolcsóbb áron. Hagyományos fűtéshez és gázhoz kályhacső, füstcső és kiegészítők. Webáruházunkból országosan kiszállítunk!


Feladva: 2015-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: fustcsokályhacsőkiegészítőkpapírKergázhozElégethetifűtéshezvegyesengazhozHagyományosvagyaluminiumboláronszénnellegolcsóbbfávalkinalategyikfjs

Forrás: pepitahirdeto.multiapro.com

MTZ-re és más gyártmányú traktorra! Hazai gyártású kiváló minőségű homlokrakodók kedvező áron, 25 - 200 LE–ig, szinte minden traktor típusra, szállítással, üzembe helyezéssel, rövid határidővel, készletről. BB. Junior 1.4 homlokrakodó: Emelőmagasság max.: 3,9 m. Terhelhetőség: 2500 kg. Emelőerő: 1800 kg. Felszereltség: - Traktor típus szerinti adaptációs alváz - Joystick vezérlés - Kihelyezett 3. hidraulikakör - Lengés csillapítás - Szállítás, üzembe helyezés ... további részletek >>


Feladva: 2015-11-09    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: homlokrakodóüzembeTraktorhelyezés200szerintiJuniorárontípuskészletrőlSzállításkedvezőhatáridővelcsillapításhomlokrakodókFelszereltségrövidLengés

Forrás: pepitahirdeto.multiapro.com

Építőipari kivitelezéseket vállalunk: - kőműves - ács - festő - vasbeton szerelő - kézi földmunka - kisgépes földmunka (minikotró, mini homlokrakodó) - nagygépes földmunka (JCB univerzális árokásó, homlokrakodó) munkákban. Munkákat főképpen Veszprém, Vas, Gy-M-S, Zala, Somogy, és Fejér megyékben vállalunk. Nagyobb volumen esetén a földrajzi távolság nem akadály!


Feladva: 2015-10-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: földmunkahomlokrakodóVeszprémkisgépesTeljesfőképpenkéziBorszörcsökMunkáinkatszerelőKftvasbetonMŰVEKárokásófestővállaljukBARANTAuniverzálisács

Forrás: pepitahirdeto.multiapro.com

Vákuumformázó kisipari műanyag feldolgozó üzem kompletten eladó. 600x600 mm-es vákuumgép, 2 db vízhűtéses vákuumszivattyú, kompresszor, szabászgép szerszámokkal együtt 3 000 000 Ft. Ajándékba adok hozzá egy 500 W-os nagyfrekvenciás PVC hegesztőgépet az árnyékoló ketrecével, tartalék üzembiztos OT-400-as csövekkel együtt. Alapanyag beszerzésében is tanáccsal segítek. Az ár a vevő telephelyén a beüzemelés segítését, a próbaüzemet, és a kezelő beatanitását is tartalmazza!


Feladva: 2015-09-08    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: üzem000eladókisipariVákuumformázósegítekKálmánegykezelőkompresszortanáccsalKóczyhozzápróbaüzemetvákuumszivattyúbeszerzésébenadoksegitéséttartalék

Forrás: pepitahirdeto.multiapro.com

Vállaljuk LG, Samsung, Sony, Thomson, Philips, Orion, Panasonic, Daewoo, Vestel, Beko, Digitek, Hisense, Hitachi, JVC, Videoton, Grundig, Fujitsu Simens, Toshiba, Pioneer, Beqo, Matsui, NEC, SIM2, Technika , plazma, LCD televízió, projektor készülékek javítását. Javításra és a beépített alkatrészekre garanciát vállalunk. Budapesten és környékén INGYENES KISZÁLLÁS!


Feladva: 2015-09-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: RichárdKadarkutiprojektorLCDplazmavállalunkThomsonTechnikawwwJVCgaranciátSonySIM25544176HitachialkatrészekreSamsungNECTelHisensebeépített

Forrás: pepitahirdeto.multiapro.com

SZAKMŰHELYBEN SZÜKSÉG SZERINT HELYSZÍNEN IS. GARANCIÁVAL! Kiszállással a következő kerületekben: Budapest, VIII., IX., X., XVII., XVIII., XIX., XX., XXI., XXIII. kerületeiben. Kispest, Kőbánya, Erzsébet, Csepel, Soroksár, Pestimre, Pestszentlőrinc. Pest megyében: Vecsés, Gyál.


Feladva: 2015-09-03    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BudapestSZERINTPestXIXSZÜKSÉGPestszentlőrincXVIIISZAKMŰHELYBENPestimreXVIILÁSZLÓSoroksárVIIIKISSCsepelVÁLLALOMErzsébetkerületekbenJAVÍTÁSÁTGyál

Forrás: pepitahirdeto.multiapro.com

Nyugtató-lazító hatás: a test átmelegszik, könnyeddé válik az idegek kisimulnak az izmok ellazulnak az idegrendszer megnyugszik a vér- és nyirokkeringés megélénkül javul a sejtek oxigén- és tápanyagellátása salak- és méreganyagok kiválasztása hormonális hatás (érintésre a szervezet endorfin és oxitocin hormont állít elő, amelyek a test saját stressz- és fájdalomcsillapító szerei).


Feladva: 2015-08-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatástestméreganyagokpozitívellazulnakelőNagysalakhogyizmokállítmasszástápanyagellátásacéljakisimulnakhormontrelaxációsoxigénvégzőidegekválik

Forrás: pepitahirdeto.multiapro.com

0-24 darázsirtó gyorsszolgálat vállalja Budapesten és országos kiszállással darazsak, lódarazsak azonnali eltávolítását porozásos, permetezéses eljárással. Oldalunkon hasznos darázsirtási tanácsokat olvashat a házilagos darázsirtással kapcsolatban.


Feladva: 2015-07-30    [Lakossági szolgáltatás]

Címkék, kulcsszavak: porozásosBudapestpermetezésesdarázsirtókapcsolatbaneltávolításátZoltándarázsirtássalazonnaliGoldnerházilagoslódarazsakdarázsirtásolvashatdarazsak

Forrás: pepitahirdeto.multiapro.com

Kútfúrást, víznyelő fúrást vállalok kézzel és géppel. Vállalási területek: Szigetszentmiklós, Szigethalom, Tököl, Halásztelek, Dunaharaszti, egész Csepel-sziget, Délegyháza, Dunavarsány, Zugló, Kispest, Alsónémedi, Pesterzsébet, Újpest, Budakalász, Angyalföld, Kiskunlacháza, Kunszentmiklós, Majosháza, Budapest és környéke. Kedvező áron, minőségi szűrővel. Az ár tartalmazza a hozzávaló anyagokat is. Munkáinkra garanciát vállalunk!


Feladva: 2015-07-21    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SzigetszentmiklóskörnyékénBudapestenanyagokatfúrástKiskunlacházánCsepelhozzávalóvíznyelőAngyalföldönegésztartalmazzaKútfúrástBudakalászonDunaharaszti

Forrás: pepitahirdeto.multiapro.com

Energetikai tanúsítvány készítése Kecskeméten és Bács-Kiskun megyében ingatlanok adásvételéhez, illetve bérbeadásához, pályázatokhoz! Rövid határidővel, olcsón!


Feladva: 2015-06-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: tanúsítványEnergetikaikecskemetKiskunBácsKecskemétenolcsónhatáridővelrövidkészítésepályázatokhozbérbeadásáhozilletvevételéheztanusitvanyadáswww

Forrás: pepitahirdeto.multiapro.com

AcPumPa azonnali országos kiszállítással, Budapesten 1-2 órán belül, vidéken 24 órán belül átvehető. AC pumpa tankon belül, AC pumpa tankon kívül, elektromos üzemanyag szivattyú 5200 autóhoz, és munkagéphez, raktárról non-stop működő webshopunkból. Telefonos érdeklődés napközben 8-18 óra között. „Velünk biztosan újra indul”


Feladva: 2015-05-04    [Autó - Motor - Jármű]

Címkék, kulcsszavak: acpumpabelülAzonnaltankonóránüzemanyagszívattyúbiztosanOrszágosacpumpawebshopelektromosVelünkwwwkívül8222kerwebshopunkbólközöttXVIIImüködő18h

Forrás: pepitahirdeto.multiapro.com

Exkluzív névre szóló étkészletek, evőeszközök kiegészítőkkel! Ha egyedi ajándékkal szeretnéd meglepni az ifjú párt, vagy ha a saját esküvőd szeretnéd egyedibbé és meghittebbé tenni, nézz körül nálunk! Webáruházunk rendeléseit országosan kiszállítjuk.


Feladva: 2015-04-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szeretnédétkészletekesküvődszólósajátnévrevagyExkluzívpártÁcsnálunkifjúBoglárkakörülmeglepniPappnénézzajándékkalajándékoktenniegyediEsküvői

Forrás: pepitahirdeto.multiapro.com

Struccok eladók, előjegyezhetők 2-4 hetes kortól tenyészérett korig! Strucc keltetők, keltetés, strucc adás-vétel, hús, szalámi, étkezési tojás, kifújt tojások stb...! Tenyésszen, hizlaljon struccot vágóhidaknak! EU konform technológiával! A jövő haszonállatát, a legjobb áron felvásárolom!


Feladva: 2015-01-19    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: struccjövőétkezésihetestechnológiávalszalámielőjegyezhetőkkonformhúseladókvágóhidaknakvételStruccokstruccotadásKiskunhalashizlaljonSándorkeltetés

Forrás: pepitahirdeto.multiapro.com

Lepje meg gyermekét, szeretteit, barátait, ismerőseit egy igazán különleges ajándékkal, egy HAPPY BIRTHDAY dallamot játszó serleg-focilabda vagy egy rózsaszín virág alakú tortatűzijátékkal, tortagyertyával! Kiszállítás postai, vagy futár csomagban!


Feladva: 2014-11-22    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: egyserlegvirágrózsaszínfocilabdagyermekétlatvanypont@gmailjátszómegmaildallamotLepjetortagyertyávalBIRTHDAY0775SzegedtortatűzijátékkalHAPPY863

Forrás: pepitahirdeto.multiapro.com

PSORATINEX Tisztító Gél 200 ml -es kiszerelésben Mikor ajánlott a készítmény alkalmazása? A psoriasis enyhe és középsúlyos, krónikus (stabil) formájában a tünetek (erythema, beszűrődés, parakeratosis, viszketés) csökkentésére, a száraz, hámló, pikkelyes bőr ápolására. Gyógyszernek nem minősülő gyógyhatású készítmény. A készítmény összetevőinek hatását szakirodalmi adatok igazolják. A készítmény két hatóanyaga: szalicilsav és kátrány emulzió.


Feladva: 2014-02-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: készítményGélTisztítóPSORATINEXerythemahatóanyagakiszerelésbenGyógyszernektünetekkét200ápolásáraformájábanbőrstabiligazoljákpikkelyeskrónikusnem

Forrás: pepitahirdeto.multiapro.com

Kameradepó az IP kamerák, IP kamerarendszerek, éjjel látó színes IP infrakamerák webáruháza! Ön kényelmesen megrendeli az íróasztala mellől, mi rövid határidővel kiszállítjuk! Prémium kategóriájú Full HD IP kamerarendszerek a legjobb áron! Magánszemélyeket, cégeket és kivitelezőket is kiszolgálunk! Nézze meg a weboldalunkat: www.kameradepo.hu/ip-kamerarendsze r.html Kérje kollégánk segítségét: 06-20-5698848 Kameradepó webáruház a gyors, biztonságos megoldás!


Feladva: 2014-02-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: KameradepókamerarendszerekhttpolcsónFullinfrakamerákgyorsweboldalunkatKamerarendszertkategóriájúszíneswebáruházmegPrémiumlátóNézzekiszállítjukéjjel

Forrás: pepitahirdeto.multiapro.com


Kategóriák: •   Állás - Munka - Foglalkoztatás   •   Autó - Motor - Jármű   •   Hobbi - Gyűjtemény - Modell   •   Állat - Növény - Tápszer   •   Vegyes hirdetések   •   Háztartás - Kert - Vegyiáru   •   Gép - Szerszám - Műszer   •   Egészség - Gyógyászat - Gondozás   •   Iparcikk - Elektronika - Kisgép   •   Irodaszer - Dísztárgy - Ajándék   •   Baba - Gyerek - Játék   •   Bútor - Lakástextil - Irodabútor   •   Ház - Lakás - Ingatlan   •   Lakossági szolgáltatás   •   Biztonság - Őrzés - Védelem   •   Internet - Weboldal - Érdekes   •   Könyv - Fotó - Film - Videó   •   Oktatás - Tanfolyam   •   Óra - Ékszer - Nemesfém   •   Régiség - Művészet   •   Ruha - Cipő - Divat   •   Sport - Kemping - Túra   •   Számítástechnika - Mobiltelefon   •   Szórakozás - Vendéglátás   •   Társkereső - Ismerkedés   •   Utazás - Üdülés - Szállás   •   Üzlet - Befektetés - Pénzügyek   •   Zene - Hangszer   •   Építés - Építőanyag - Szerelvény   •   TV - Hifi - Házimozi   •   Élelmiszer - Hús - Étolaj   •   Szépség - Kozmetika - Parfüm   •   Közlemények - Felhívás - Adomány   •   Szállítás - Szállítmányozás   •   Fordítás - Tolmácsolás   •   Fényképezőgép - Kamera - Optika   •   Pénzkeresés - MLM   •   Kegyelet - Ezotéria  


tegnap, 2 napja, 3 napja, 4 napja, 5 napja, 6 napja