1.37 hirdetések - ingyen apróhirdetés egyszerűen

Nincs találat .... Nézze meg kiemelt hirdétéseinket.

FB like, G+, Retweet, Pin-ek, követők szerzést biztosítja ez a nemzetközi weboldal. Ingyenesen is, ha mások posztjait, oldalait megnézed, lájkolod, esetleg megosztod. A választás a Tiéd, amit nem akarsz, azt nem kell! Viszont ami Neked tetszett, vagy megosztottad, azért pontokat kapsz, amit a saját közösségi oldalad, posztod népszerűsítésére használhatsz. Azt is kiválaszthatod, hogy mely országokból érkezzenek a lájkolók, +1-et adók, követőid kizárólagosan! Sok magyar is van már ...


Feladva: 2016-03-14    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: AztlikeamitnemmagyarválasztásbiztosítjamegosztottadFacebookSokmegosztodhasználhatszszerzéstvagykizárólagosanesetlegnépszerűsítésérekövetőkposztod

Forrás: pepitahirdeto.multiapro.com

A makett építés egy igen kedvelt és érdekes hobbi. Katonák, harckocsik, repülők, egyéb kiegészítők nagy választéka áll rendelkezésetekre, hogy elkészítsetek egy makettet, vagy akár egy igényesen kidolgozott diorámát. Akik még csak most ismerkednek ezzel, vagy szeretnék elkezdeni, azoknak ajánlom a kisebb, egyszerűbb maketteket, ezeknek az összeállítása nagyon egyszerű. Méretarányuk: 1 : 100 Általában 6-8-10 elemből összeépíthető makettek, amik nem igényelnek nagy szaktudást, de már az első ... további részletek >>

makett összeállítása is nagy élmény lehet a gyermek számára. Bővebben: www.kpjatek.hu/KEZDo-MAKETTEZoKNEK-c63_0_1.htm


Feladva: 2017-08-23    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: nagyegymakettMAKETTEZŐKNEKvagyKEZDŐösszeállításadiorámátnagyonszaktudástazoknakhtmkidolgozottegyszerűkiegészítőkmárelkezdeniJátékigényesenegyéb

Forrás: pepitahirdeto.multiapro.com

99,8%-os tisztaságú vízmentes izopropanol általános tisztításra. Kitűnően alkalmas lejátszófejek tisztítására, fluxok, alacsony zsírtartalmú olajok, poláris szennyeződések, és ásványi eredetű szennyeződések eltávolítására. A legtöbb flux higítására is használható. • nem ózonkárosító • műanyag felületen is használható • gyorsan párolog • nincs maradványanyag • nem korrozív


Feladva: 2017-01-22    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 8226szennyeződésekhasználhatónemeltávolításáraalkalmasnincsIzopropilKitűnőenpárologeredetűtisztításragyorsanásványiáltalánospolárisizopropanolflux

Forrás: pepitahirdeto.multiapro.com

Havi egy főzéssel a hónap minden napján meleg ételt varázsolni az asztalra, anélkül, hogy hosszú órákat töltenél minden nap a konyhában? Igen, lehetséges! Válaszokat, segítséget az oldalon találsz!


Feladva: 2017-01-20    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: HaviegyfőzésmindenoldalonhogysegítségetanélkülVálaszokatasztalralehetségesvarázsolniIgenételtkonyhábanmelegnapnapjánhónaptöltenélfőzéssel

Forrás: pepitahirdeto.multiapro.com

Alsóörsi kiadó szálláshelyek fényképes gyűjtőoldala. Panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Több mint 100 fényképpel a szálláshelyekről és a településről! - SZÉP kártyát elfogadó szálláshelyek Alsóörsön - Egész évben nyitvatartó (kidó) szálláshelyek - Weboldal: www.zimmerinfo.hu/alsoors/hu.htm


Feladva: 2017-11-08    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfonélkülvillákAlsóörsöndíjhtmvendégházakelfogadóközvetítésialsoorsPanziókkártyátszálláshelynélgyűjtőoldalaSZÉPlehetőséghttp

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés Budapest minden kerületébe és Pest megye több településére is lehetséges nálunk! 10 éves tapasztalattal várjuk hívását, ha sitt szállítást, zöldhulaldék vagy háztartási szemét elszállítását szeretné hatékonyan megoldani! A konténer rendelés szemét és sitt számára nálunk 1 perc alatt lebonyolítható! Telefonon, emailen és a weboldalunkon található űrlapon keresztül is leadhatja rendelését! 1 munkanapon belül leszállítjuk a hulladékgyűjtőt az Ön által megjelölt címre! Kisebb ... további részletek >>

felújításokhoz, kerti munkákhoz és építkezésekhez, bontásokhoz is van megfelelő méretű konténerünk! Konténer rendelés Budapest!


Feladva: 2017-08-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: rendelésKonténernálunkBudapestsittszemétstoptalálhatókonténerünkmegoldaniévesmegjelöltnonweboldalunkonméretűhatékonyanlehetségesáltalemailenvan

Forrás: pepitahirdeto.multiapro.com

Újra indul a családi házakra kiírt Napelem + infra fűtés 50%-s vissza nem térítendő állami támogatással program! Napelem szerelés kulcsra készen. Felmérés ingyenes, tervezés, árajánlat, engedélyeztetés, kivitelezés. Villanyszámla 0 Ft-os csekk és ha ezt kombináljuk infra fűtéssel, akkor a fűtése is ingyen lesz! A kora tavasztól késő őszig megtermelt többletáramot a szolgáltató télen visszaadja és a beruházás 5 év múlva megtérül. Utána ingyen áram évtizedekig.


Feladva: 2017-10-26    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: Napelemtérítendőnemvisszainfraingyentámogatássalengedélyeztetésállamimúlvainfrafutesleszárajánlatberuházásfűtéserendszertervezésvisszaadjaakkor

Forrás: pepitahirdeto.multiapro.com

ÜZLET AHOL SENKI NEM VESZÍTHET! SunMoney az első világot behálózó KÖZÖSSÉGI NAPERŐMŰ PROGRAM - Az üzletet építheted online is - Itt nincs havi kötelező befizetés - Itt nem terméket kell venni, hanem egy termelő eszközt vásárolunk


Feladva: 2016-09-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemIttsunmoneywebofficeSENKIegyonlinehttpsAHOLhanemépíthetedRegisztrációÜZLETvenniüzletetcomTiborkellPROGRAMsunmoneyonlineNaperőművedbotibi

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Alumínium profilok porfestése. Például: Ablakok és ajtók, kapuk, zsaluk, medencefedő szerkezetek, kerítések elektrosztatikus felületi kezelése porszórással. Kérje árajánlatunkat! Szeretettel várjuk!


Feladva: 2016-07-21    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: AlumíniumvállalunkSzeretettelkapukporfestéstárajánlatunkatajtókKérjeAblakokporszórássalPéldáulkezeléseporfestésefelületiprofilokelektrosztatikusKft

Forrás: pepitahirdeto.multiapro.com

HA ÖNNEK VAN ELADÓ MÁRKÁS KARÓRÁJA, AKKOR ÉRDEKLŐDJÖN A 06 30 350 319-ES TELEFONSZÁMON, VAGY AZ ALÁBBI E-MAIL CÍMEN: E-mail: aranybazarkft@gmail.com Óra, karóra felvásárlás Ha szeretné eladni márkás karóráját, mi magas áron megvásároljuk boltjaink egyikében, azonnali készpénzfizetéssel. Amennyiben van lehetősége fotókat küldeni a megadott E-mail címre, kérjük tüntesse fel mennyit szeretne érte kapni. Rövid időn belül válaszolunk. Amiket vásárolunk: Patek Philippe, Jager-LeCoultre, ... további részletek >>

Vacheron Constantin, Breguet, Audemars Piguet, Breitling, Panarei, IWC Schaffhausen, Omega, Rolex, ARANY ÓRÁKAT. Amiket nem vásárolunk; Aranyozott órákat, Japán-Kinai kvarcórákat, replika órákat, divat órákat nem vásárolunk. Debrecen, Csapó utca 52 sz. alatti ékszerbolt


Feladva: 2017-02-19    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: órákatmailvásárolunkAmiketDebrecenmárkásszeretnevannemfelvásárláskaróraÓracímreELADÓkvarcórákatboltjainkBreitlingaranybazarkft@gmailékszerbolt

Forrás: pepitahirdeto.multiapro.com

Válassz kutyádnak nyakörvet széles választékunkból, legyen szó akár kistestű, akár nagy testű kutyáról.


Feladva: 2016-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: akárszóKutyalegyenválasztékunkbólszélesnyakörvetkutyádnakkutyárólVálassztestűgubanagyebengyártásakistestűnyakörvek

Forrás: pepitahirdeto.multiapro.com

2000-es évjáratú Twingo eladó. Műszaki érvényessége: 2019. 06.19. Elektromos ablak, tükör beállítás, légzsák, szervókormány HIBÁI: sajnos a jobboldali ablak elektromossága hibás, nehéz felhúzni, a fényszórók rossz bekötés miatt nem megfelelően működnek. Mivel már nem fiatal, természetesen van rajta mit csinálni, igény szerint... Ára: 170.000,- Ft Alkuképes!


Feladva: 2017-10-05    [Autó - Motor - Jármű]

Címkék, kulcsszavak: ablakeladóTwingonemMivelszerintMűszakiműködnekjobboldaliigénymegfelelőensajnoscsinálnimiattHIBÁImitévjáratúbekötésszervókormányrajta2000van

Forrás: pepitahirdeto.multiapro.com

Weboldalak tervezését és teljes körű kivitelezését vállaljuk. Forduljon hozzánk bizalommal, és vegye igénybe szolgáltatásainkat: - Statikus és dinamikus weboldalak programozása, igény szerinti funkciók programozása (Bemutatkozó honlapok, webáruházak, egyedi ötlet alapú weboldal igény szerinti funkciókkal) - Egyedi webdesign, webgrafika, céges arculat, reklámgrafika Erősségeink: marketingközpontú gondolkodásmód, kreativitás, agilitás. Programozás - Könczöl Dávid ... további részletek >>

konczol.david@webstark.hu Grafika - Biró Virág biro.virag@webstark.hu Tekintse meg referenciáinkat weboldalunkon: www.webstark.hu/#references


Feladva: 2017-03-09    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: programozásaEgyediweboldalakszerintiigénywebstarkkonczolkreativitáskörűvirag@webstarkdinamikusgondolkodásmódteljesbiroStatikusmarketingközpontúVirág

Forrás: pepitahirdeto.multiapro.com

Ennyiért még szórólapot sem kap! Kezdő weboldalaknak, weboldalakon, webáruházakban megjelenő akcióknak és internetes figyelemfelhívásoknak kifejezetten ideális! Egyszerűen használható kezelőfelületen beállítható, módosítható, ha kell...


Feladva: 2017-06-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: 000szórólapotfigyelemfelhívásoknakméginternetesEnnyiértakcióknakajánlókellmegjelenőHirdetőmódosíthatówebáruházakbanPepitabeállíthatóweboldalakonért

Forrás: pepitahirdeto.multiapro.com

Kongép Bt .Saválló, rozsdamentes polcok, pultok, tálcák, büfékocsik gyártása. Saválló ipari padlószifonok gyártása. Különböző saválló nagykonyhai termékek gyártása. Saválló, rozsdamentes anyagok megmunkálása, fémmegmunkálás, lemezmegmunkálás, lemezhajlítás, élhajlítás.


Feladva: 2013-08-04    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: SavállórozsdamentesgyártásaKongépgépektálcákanyagokpultokpolcokkongepbttartályokwwwtermékekfelhordószalagokhttpnagykonyhaiszállítószalagokKülönböző

Forrás: pepitahirdeto.multiapro.com

Cégünk tapasztalt emberei vállalják a nehéz tárgyak, berendezések, eszközök (gépek hűtők, klímák, jakuzik, zongorák, pianínók, egyéb nehéz hangszerek, stb.) szakszerű mozgatását, szállítását. Raktárainkban lehetőséget biztosítunk ügyfeleinknek, akár azonnal bútorok, eszközök, egyéb ingóságok rövidebb-hosszabb idejű elhelyezésére.


Feladva: 2017-10-03    [Lakossági szolgáltatás]

Címkék, kulcsszavak: eszközöknehézegyébtárgyaktapasztaltakárpianínókCégünkügyfeleinknekzongorákelhelyezéséreBudapestbiztosítunkjakuzikidejűCsacsitranszlehetőségetklímák

Forrás: pepitahirdeto.multiapro.com

Megint egy újabb gardróbszekrényt hoztunk kínálatunkba. Mint ahogy megszoktuk két méretben (239 cm és 160 cm szélesben). A toló ajtókat a csíkos betétei teszik játékosabbá. 3 színben kapható: ferrara tölgy és finom barna, san remo és canterbury, canterbury és rusztikus fehér. Mint minden egyes gardróbunkra így rá is jellemző a 18 mm bútorlap vastagság, hogy minél tartósabb legyen a bútor. Magasító hozzá is kérhető így 263 cm magas. 160 széles szekrény: 10.1250,- 160 széles magasító: 41.850,- ... további részletek >>

239 cm széles szekrény: 124.200,- 239 cm széles magasító: 59.400,- Mevásárolható üzleteinkben és webshopunkban egyaránt. www.alphabutor.hu/haloszobai-valasztek/capri-gardrobszekreny Facebook oldalunk: www.facebook.com/Alpha.butordiszkont


Feladva: 2017-04-11    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: széles160magasító239szekrénycanterburyfacebookwwwígycapriMint124színbenlegyenahogyfehéralphabutorjátékosabbátartósabbkínálatunkbarusztikus

Forrás: pepitahirdeto.multiapro.com

Nemzetközi szinten is kiváló minőségű, sporttáplálkozási-, étrend-kiegészítő- és diétás termékek. Body&Fit termékek. Kategóriák: www.bodyfit-hungary.hu/bodyandfit_ kategoriak


Feladva: 2017-08-01    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: termékekBodydiétássporttáplálkozásiFitkiegészítőétrendminőségűhungarykiválóbodyfitszintenwwwNemzetköziBudapest

Forrás: pepitahirdeto.multiapro.com

Kézzel készített férfi és gyermek csokornyakkendők nagy választékban. Fényes, matt, virágos, kockás, pöttyös, vintázs kivitelben.


Feladva: 2017-08-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: kivitelbenférfivintázskészítettpöttyösKézzelkockásajánlóvirágosHirdetőmattPepitaFényesCsokornyakkendőboltválasztékbannagycsokornyakkendőkgyermek

Forrás: pepitahirdeto.multiapro.com

Szeretettel várunk minden pihenni, szórakozni és kirándulni vágyó vendéget a Velencei-tó mellett lévő pákozdi vendégházunkban! A ház közvetlenül az erdő mellett, csendes festői környezetben található, ami családias hangulatot, kényelmet, nyugalmat biztosít vendégeink számára. Ideális szórakozni, pihenni vágyó családoknak, osztályoknak, baráti társaságoknak (max. 45 főig, egyeztetés után).


Feladva: 2016-12-03    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: pákozdivágyópihenniszórakoznimellettvendégházingókőamilévőtalálhatóVelenceikörnyezetbenutánVendégetIdeálisfestőiegyeztetéskirándulniszámárafőig

Forrás: pepitahirdeto.multiapro.com

A torokgyulladás a torok égő, kaparó érzésével, nyelési nehézséggel jelentkezik. Ezt gyakran kíséri köhögési inger, hőemelkedés, de kisgyermekeknél akár láz is kialakulhat mellette. A torokgyulladás többnyire vírusos eredetű, a kórokozó kimutatása gyorsteszttel és tenyésztéssel is történhet. A mandulagyulladás és a torokgyulladás kezelése heveny esetekben megkívánja az antibiotikumok szedését. Ez a terápia teljes gyógyulást hoz, de mellette érdemes olyan étrendet is folytatni, ami kíméli a torok ... további részletek >>

nyálkahártyáját. Torokgyulladás és mandulagyulladás kezelése weboldalunkon!


Feladva: 2017-02-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: TorokgyulladásmandulagyulladásmellettetorokkezelésekaparótenyésztésselhőemelkedéshozégőgyorsteszttelingergyógyulástKittikimutatásanyálkahártyájátami

Forrás: pepitahirdeto.multiapro.com

Partira, esküvőre, bálra, céges bulira, városnapra rendezvényszervezőt keresel vagy fellépőre van szükséged? Hívj minket! > Kizárólagos produkció: Barna Barnabás a Mulatós Herceg > Egyedi programokkal, műsorokkal, technikai és marketing háttérrel állunk rendelkezésre > Gyerekműsorok (bohócok, óriásbábok, vásári komédiások) > Játszóház, kézműves foglalkozás > Ismert és helyi fellépők > Zenekari produkciók > Humoristák és stand-up comedy-sek > Játékpark ... további részletek >>

(ugrálóvár, körhinta, kis vonat, lézerharc, buborékfoci, rodeóbika, stb...) > Tűzijáték > Kordon és biztonsági szolgálat > Mobil WC > Élő online rádióközvetítés Egyedi, akár extrém igényekkel is keress bennünket, nálunk mindenre megoldást találsz!


Feladva: 2017-05-08    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: EgyedibuborékfociBarnabászenekarirendezvényszervezőtrádióközvetítésgyerekműsorokrendezvényszervezéslézerharcBarnatalálszfellépőkvárosnapraonlinekörűélő

Forrás: pepitahirdeto.multiapro.com

Mégsem vagy még partnerünk? a SkyWay capital programjában való részvétel - egy kiváló lehetőség egy hatalmas innovációs projekt részévé válni, amihez hasonló még nem létezik a világban! a SkyWay projekt értéke ugyan 400 milliárd dollárra van felbecsülve, de mára már minimum 20szor ennyit ér. Ma ebbe befektetni - ez a lehető legelőnyösebb befektetés, amit csak megtehetünk. Tudjuk, hogy a legnagyobb léptékű Transnet projektet hozzuk létre és minden kockázatot számba vettünk.


Feladva: 2017-10-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: projektSkyWayegymármégcapitalbefektetni400válniléptékűpartnerünkebbeugyanrészévélegnagyobbvagyennyitértékeinnovációshogyMégsem20szorÁgi

Forrás: pepitahirdeto.multiapro.com

Minden típusú automata váltó javítása, felújítása korrekt árakon, garanciával, kifogástalan minőségben! Vállaljuk automata sebességváltók tuningját, verseny célú átépítését, megerősítését is. Csak minőségi, megbízható anyagok felhasználásával dolgozunk! Több éve jelen vagyunk a versenysportban, jelentős tapasztalatokat gyűjtöttünk. Várjuk céges megrendelők megkeresését is! Rendszeres megrendelés esetén jelentős kedvezményeket biztosítunk a munkadíjból. További információ: Facebook: Mopar Garage


Feladva: 2016-10-21    [Autó - Motor - Jármű]

Címkék, kulcsszavak: automatajelentősváltóTovábbiVállaljukVárjukEgermegbízhatómunkadíjbólminőségbengyűjtöttünkCsabaminőségibiztosítunkkifogástalantapasztalatokatHorváth

Forrás: pepitahirdeto.multiapro.com

ORVOSI FORDÍTÁS, SZAKFORDÍTÁS! Orvosi, egészségügyi, gyógyszerészeti fordítások magyarra, angolra és németre. Akár teljesen online ügyintézés! EU Fordítóközpont – Fordítóiroda (EU Translations) Orvosi fordítás, szakfordítás valamint hiteles fordítás.


Feladva: 2015-05-08    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: OrvosifordításszakfordításeuforditasFordítóirodawwwFordítóközpontphpegészségügyiTelszakforditasÚjlipótvárosügyintézéskerhitelesonlineXIIIvalamint

Forrás: pepitahirdeto.multiapro.com

HELKAMA ITALHŰTŐ 12 HÓ GARANCIÁVAL 5 db polc Űrtartalom: 361 liter 230 V/50 Hz 295 W; 4.65_kWh/nap 0,33 l doboz: 406 db vagy 0,5 l üveg: 217 db vagy 2,0 l üveg: 56 db Magasság: 2055 mm Szélesség: 595 mm Mélység: 710 mm www.hgc.hu/Helkama-italhuto-vilagi to-reklamfelulettel


Feladva: 2017-10-04    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: italhutoHelkamaüvegvagydobozHirdető710napPepitaMélységkWh595295Szélesség2302055literreklamfelulettelMagasság361vilagitoŰrtartalompolc

Forrás: pepitahirdeto.multiapro.com

Megbízható vízszerelő dugulás megszüntetés csőtörés csepegések megszüntetése csapok szerelése új vízvezeték rendszerek telepítése, gyors szolgálati munkák a legolcsóbban a fővárosban és Pest megyében! Tel.:303286969


Feladva: 2017-02-12    [Lakossági szolgáltatás]

Címkék, kulcsszavak: csőtörésvízvezetékmegszüntetésefővárosbancsepegéseklegolcsóbbanmunkákmegszüntetésszolgálatidugulásgyorsvízszerelőtelepítéseMegbízhatórendszerekSándor

Forrás: pepitahirdeto.multiapro.com

Bio Ganoderma kávé! Lúgosít, megszünteti a gyomorégést. Szabályozza a magas és alacsony vérnyomást egyaránt. www.kavekiraly.hu/termekek Törzsvásárlói regisztráció: www.kavekiraly.hu/member_registrat ion_private Ha akarsz, pénzt is kereshetsz vele, de nem kötelező az üzleti lehetőség! www.kavekiraly.hu/uzleti_lehetoseg


Feladva: 2016-02-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kavekiralyhttplehetoseguzletikávéGanodermavelevérnyomástTakácskereshetszalacsonyTermészetespénztmagas100akarszSzabályozzaprivategyomorégéstBio

Forrás: pepitahirdeto.multiapro.com

Tekintse meg jelenleg bérelhető flipper automatáinkat! Bérelhető flippereink abból az időszakból származnak, amikor a játéktermek fénykorukat élték, a valaha gyártott legjobb flipperek készültek, mint a Terminator 2, az Indiana Jones: The Pinball Adventure, vagy akár az Addams Family. A legnagyobb flippergyártó 2000-ben befejezte működését, azonban a gépek a retro hullámnak is köszönhetően visszatértek a köztudatba. Mára ezek a gépek igen keresettek, azonban szerviz igényességük miatt kevesen ... további részletek >>

foglalkoznak a bérbeadásukkal. Flippereink egytől-egyig tökéletes műszaki állapotban vannak (ez nem zárja ki a meghibásodást, de ennek esélyét töredékére csökkenti), esztétikailag is igényesen felújítva kerülnek kihelyezésre. www.automataberles.hu/hu/flipper-berles További szolgéltatásaink: - Játékterem telepítés - Retró játékok bérbeadása - Klasszikus és retró játékok családi napokra, céges rendezvényekre - Csocsó, darts kölcsönzés - Box gép bérlés - Prémium katergóriás játékautomaták kölcsönzése - Videójáték bérlés


Feladva: 2016-10-10    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: bérlésflippergépekFlippereinkautomataberlesjátékokretróBérelhetőazonbanegyigTheCsocsószolgéltatásainkigenfénykorukattöredékérebenBudakalászegytől

Forrás: pepitahirdeto.multiapro.com

HULLÁMOSÍTOTT ACÉLHÁLÓ (Heidekker háló) gyártása. Egyedi méretekre és különböző kivitelben gyártott hullámosított acélhálók (Heidekker háló) 18x18 mm-től - 115x115 mm-ig, többféle kockaméretekben: sima normál / álló, diagonál / átlós, valamint duplaszálas átlós kivitelben, 2330,-Ft/m²-től Megrendelhető: Nyíregyháza, Szarvas u 85 www.drotspecial.hu Tel: 06-70/453-8288


Feladva: 2016-10-04    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: HeidekkerhullámosítotthálóNyíregyházatőlACÉLHÁLÓkivitelbenátlósdrotspecialDrótszálvalamintacélhálókwwwdiagonálSzarvasállógyártottnormálkülönböző

Forrás: pepitahirdeto.multiapro.com

Masszázskrémek, olajok profi masszőröknek, wellness, szépség stúdióknak, vagy otthonra. Masszőrök, kozmetikusok, természetgyógyászok az országban bárhol, kedvező áron vásárolhatnak masszázskrémeket, olajokat, higiéniai papír és textil árukat, masszázskellékeket. www.harmoniamasszazskellek.hu Rendelési összeghatár nincs, kedvező kiszállítási díjak!


Feladva: 2016-03-16    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: kedvezőolajokMasszázskellékdíjaktextilMasszőrökHarmóniakiszállításipapírotthonragyógykrémekhigiéniaivagyMasszázsnincsolajokatstúdióknakösszeghatár

Forrás: pepitahirdeto.multiapro.com

A szálláshely szobái légkondicionáltak (csak a tetőtéri szobák) , TV-vel, hűtővel felszereltek. Minden szobához zuhanyfülkés fürdőszoba tartozik. Lehetőség van számítógépes csatlakozásra, internet használatra. Vendégeink még teljesebb kikapcsolódását medencével és hozzá kapcsolódó szaunával szolgáljuk.


Feladva: 2017-03-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: medencéveltartoziklégkondicionáltakkikapcsolódásátfürdőszobaszobáiteljesebbzuhanyfülkésszálláshelymégszobáhozSzékesfehérvárVendégeinkMindenIgnácPap

Forrás: pepitahirdeto.multiapro.com

Szálláshelyek és szállásfoglalás Erdélyben. Foglalja le már most erdélyi szálláshelyét, nyaralásához. Erdelybe.hu és szallas-erdely.hu oldalainkon válogatott erdélyi szálláshelyeket találhat. Szálláshelyeinknen már többezer elégedett vendégünk megfordult. Az erdélyi szálláshelyek közül csak a legjobbakat válogattuk ki Önnek, hogy egyszerű legyen a választás.


Feladva: 2017-02-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekerdélyimárErdélybentöbbezerszálláshelyétÖnnekmostválogattukSzálláshelyeinknenFoglaljalegjobbakattalálhatcsakszálláshelyeketszállásfoglalás

Forrás: pepitahirdeto.multiapro.com

www.nemetmunka.hu/allasaink.html .... és ezen kívül összesen 8 db ÁPOLÓ-i állásunk van idősotthonokban (Allgäu, Chiemgau, Niederbayern és München) német ANERKENNUNGgal vagy OKJ 54 + erős A2 némettel. A kondíciók (fizetés, szállás, stb.) helytől függően változnak, de a végeredmény kb. ua. mindenütt mint a 2 müncheninél. (Van ahol kevesebb a bruttó, de ott olcsóbb a szállás, stb.) 24h háziápoló munkánk NINCS. 1.) München északnyugati részén (S-Bahnnal 20 perc) 3.000,-€ bruttó 2.) ... további részletek >>

Garmisch-Partenkirchen közelében a hegyek lábainál (szerintem a legjobb helyünk) 3.) Straubing körzetében több mint 15 saját idősotthonnal rendelkező cégcsoportnál 4.) München déli részén egy tó melletti településen (S-Bahnnal 30 perc) 2.650,-€ bruttó 5.) Füssen közelében (a mesekastély vidéke) -2 magyar ápolónk van itt kb 1,5éve 6.) Rosenheim közelében az Alpok lábainál- 1 Anerkenungos magyar ápolónőnk van itt- RÉSZLETEKet az állásokról jelentkezés után e-mailben tudunk küldeni. A jelentkezőnek a munkáért fizetnie vagy bármit aláírnia NEM kell. Jelentkezni lehet: -E-mailben, német nyelvű fényképes önéletrajzzal és telefonszámmal. info@nemetmunka.hu -Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs)


Feladva: 2017-09-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németvanközelébenvagyMünchenbruttóhttpmailben8364lábainálpercBahnnalminthtmlNINCSTeamittMunkarészénnemetmunkastbwwwmagyarszállásÁPOLÓ

Forrás: pepitahirdeto.multiapro.com

XIV. kerületben, Zugló Törökőr részén, a Mandala kert tőszomszédságában kínálok számlaképes módon kiadásra lift nélküli társasházban egy teljeskörűen és frissen felújított, 29 m2-es, világos, csendes, 3. emeleti, franciaerkélyes téglalakást elsősorban diáklányoknak, egyedülálló nőknek és gyermektelen fiatal pároknak - háziállat nélkül. Dohányzás kizáró ok. Elrendezése: előszoba (gardrób szekrénnyel), felszerelt teakonyha, háromszárnyú franciaerkélyes ajtón át hangulatosan és kiválóan ... további részletek >>

megvilágított délkeleti tájolású szoba berendezés nélkül (de igény esetén berendezve). Fűtését egyedi Héra gázkazán biztosítja hangulatos cserépkályhába építve, ami jó meleget ad és tart is. A tágas, ablakos fürdőszobában a meleg vizet villanybojler szolgáltatja (zuhanyzó, WC). Fenntartási költségei kedvezőek, a közös költség 7075 Ft/hó, víz-, gáz-, áramfogyasztást egyedi fogyasztásmérők mérik. A ház a főútvonalról közelíthető meg, körbekerített, saját kerttel is rendelkezik, parkos, csendes, zöld környezetben helyezkedik el, mégis frekventált környéken, amely jó infrastruktúrájú és közlekedésű. A közelben több élelmiszerbolt, benzinkút, konditerem található. 7 perces séta vagy 2 megálló a Hungária körút, ahol az 1-es villamos jár, nincs messze a Zugló Vasútállomás, a 77-es trolibusszal pedig csak 5 megálló a piros metró Stadionok megállója. Parkolni az utcában ingyenesen lehet! Költözhető azonnal egy éves hűségidővel, 2 hónap kaucióval és első havi bérleti díjjal. Bérleti díj bútorozatlanul: 90.000 Ft Igény esetén bútorozva: 100.000 Ft Érdeklődni a 30/294-1525 számon lehet 10:00-20:00 között. Ingatlanosok ne keressenek!


Feladva: 2017-09-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 000100nélkülcsendeseseténmegállóIgényegyediegylehetBérletiZuglófelújítottfranciaerkélyesfrissennincsfőútvonalrólberendezveMandalakaucióvaljár

Forrás: pepitahirdeto.multiapro.com

Karácsonyi dekorációs cikkek közül válogasson a Zöldvilág Webáruházban! www.selyemviragok.hu/index.php?id= 2054


Feladva: 2017-10-29    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ZöldvilágcikkekdekorációsKarácsonyiGyőrWebáruházNagykereskedésSelyemvirágWebáruházbanKarácsonyválogassonközül

Forrás: pepitahirdeto.multiapro.com

Továbbá gyártunk különböző méretű, huzalvastagságú horganyzott és műanyagos drótfonat, vadvédelmi háló, vadháló, tüskéshuzal, tüskésdrót, szögesdrót, vezérdrót, kerítés háló, kerítésháló, feszítőhuzal, feszítő huzal, kerítésdrót, tüskés szöges vezér drót, vadkerítés, kerítés építés, kerítésépítés, kerítésfonat ,kiskapu, nagykapu, huzalfeszítő csavar, vibropréselt zsalukő, lábazati elem, fémoszlop, faoszlop, natodrót nato drót, fém fa beton kerítés oszlop, kerítéspanel, kerítéselem, kutyakennel, ... további részletek >>

drótháló, drótkerítés, kis nagy vas kapu, kutya kennel, szőlőoszlop, kerítésoszlop, betonoszlop, kutya kenel, szőlőkaró, kutyakenel, szőlő oszlop karó. Vállalunk az ország egész területén vadhálóval, vagy dróthálóval komplett kerítésépítést 1000 Ft/m áron. (Csak drótkerítéseket és vadvédelmi kerítéseket építünk, fakerítést nem!!!)Rengeteg terméket gyártunk és forgalmazunk a kerítésdróton és betonoszlopokon kívül, amit egy hirdetésben nehéz lenne felsorolni, ezért kérem, látogasson el honlapunkra www.kerites.hupont.hu oldalra, vagy telephelyünkre, a KÓTAJI DRÓTFONAT, VADHÁLÓ és BETONOSZLOP CENTRUMBA ahol személyesen akár további kedvezményekre is van lehetőség.


Feladva: 2017-05-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keriteswwwvadvédelmibetonBETONOSZLOPdrótVADHÁLÓDRÓTFONAToszlopgyártunkhálóvagyhupontkutyakerítéseketkerítéspaneltüskéshuzalaholegészkívülfém

Forrás: pepitahirdeto.multiapro.com

PC játékok óriási választéka a Konzolvilágban, pénztárcabarát árak és speciális kiadások. Kiemelkedő kiszolgálás, gyors és megbízható futárszolgálat.


Feladva: 2017-09-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: játékokpénztárcabarátKonzolvilágbanválasztékafutárszolgálatóriásimegbízhatógyorsajánlókiszolgálásHirdetőKiemelkedőPepitakiadásokKonzolvilágspeciális

Forrás: pepitahirdeto.multiapro.com

AKAI PHA-2880 mobiltelefon DUAL - sim - 7.990 Ft. ÚJ, garanciális készülék! www.techdiszkont.superwebaruhaz.hu /akai-pha-2880-mobiltelefon-dual-si m-t464754


Feladva: 2017-04-07    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: techdiszkontakciówwwTelefonkészülékgaranciális990simDUALmobiltelefon2880PHAsuperwebaruhazAKAI

Forrás: pepitahirdeto.multiapro.com

0-24 darázsirtó gyorsszolgálat vállalja Budapesten és országos kiszállással darazsak, lódarazsak azonnali eltávolítását porozásos, permetezéses eljárással. Oldalunkon hasznos darázsirtási tanácsokat olvashat a házilagos darázsirtással kapcsolatban.


Feladva: 2015-07-30    [Lakossági szolgáltatás]

Címkék, kulcsszavak: porozásosBudapestpermetezésesdarázsirtókapcsolatbaneltávolításátZoltándarázsirtássalazonnaliGoldnerházilagoslódarazsakdarázsirtásolvashatdarazsak

Forrás: pepitahirdeto.multiapro.com

Egyedi tervezésű, fából, kézzel készült, pirográffal (fába égetési módszerrel) gravírozott, tollak, tolltartók, ékszerek, táblák, fali órák, és egyéb kis fa csodák... A termékeket a saját elképzelésed szerinti szöveggel, grafikával és névre szólóan is elkészítjük számodra. Sokféle alkalomra ötletes, és igazán személyhez szóló ajándék.


Feladva: 2017-09-21    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ajándékelkészítjükKedvesegyébpirográffalszólóanórákkészültnévrefalikézzelgrafikávaltáblákszólófábólszöveggelékszerekszemélyheztervezésűszerinti

Forrás: pepitahirdeto.multiapro.com

Rendelj online, mi pedig szélsebesen szállítjuk neked! Ragyogj Te is Rossettiben! · Ingyenes átvétel Bp-en · Online fizetés · Házhoz szállítás · Pick Pack Pont átvétel Fülbevalók - Gyűrűk - Akciós termékek - Nyakláncok - Szettek


Feladva: 2017-10-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: 183OnlineátvételPontnekedSzépPackszállítjuktermékekPickszélsebesenNyakláncokpedigSzettekszállításRendeljHázhozajánlásfizetésHirdetőAkciós

Forrás: pepitahirdeto.multiapro.com

Olcsó új gyerekruhák és játékok! Gyerekruhák bébi, gyerek és kamasz méretekben, bébi kiegészítők nagy választékban. Több mint 10.000 gyerekjáték a bébitől egészen 12 éves korig. Személyes átvétel Budapesten, házhoz szállítás az ország egész területén.


Feladva: 2016-03-27    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: GyerekruhákbébijátékokOlcsóJátékBudapestenválasztékbanátvételnagySzemélyeskiegészítőkkorigkpjatekévesméretekbenwwwegészenkamaszterületénbébitől

Forrás: pepitahirdeto.multiapro.com

Táplálékunk az egészségünk! Túlszennyezett világunkban rengeteg káros anyag halmozódik fel bennünk, ezért fontos a szervezetünk megtisztítása, és az ételeink megtisztítása is! Ehhez nyújt segítséget e készülék, mely ózonnal (O3) kitisztítja a zöldségekbe, gyümölcsökbe felhalmozódott vegyszer, rovarölő-szer maradványokat. A húsokból és halakból a hormon és egyéb maradványokat. De fertőtleníthetjük lakásunkat, autónkat a különböző gombáktól, baktériumoktól is. Igazi természetes fertőtlenítő!


Feladva: 2014-10-23    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: megtisztításamaradványokatfertőtlenítőkészülékvegyszerautónkatvilágunkbanfelhalmozódottételeinklakásunkatTúlszennyezettgyümölcsökbeszervezetünkegészségünk

Forrás: pepitahirdeto.multiapro.com

LÁTOGASSON EL MUNKARUHA BOLTUNKBA! Munkaruha, munkavédelmi cipő, munkabakancs. Forgalmazott munkaruha és védőfelszerelés márkáink: Coverguard, Uvex, Lux Optical, Cado, Dunlop


Feladva: 2015-11-25    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: MunkaruhawwwMunkabakancscipőMunkavédelmiszívébenBudapestboltnyílóÚjonnanmrmunkaruha

Forrás: pepitahirdeto.multiapro.com

Zeneszolgáltatás! Mulatós < Vendéglátós < Örökzöld zenék. Balatonlelle és távolabbi környékén, megfizethetően árazva. Hívjanak bizalommal! id.Bertalan József + egy fő hölgy hegedűs!


Feladva: 2017-11-18    [Zene - Hangszer]

Címkék, kulcsszavak: ZeneszolgáltatásBalatonlelleJózsefBertalanbizalommalhivjanakárazvamegfizethetöenkörnyékéntávolabbihegedüshölgyzenékegyÖrökzöldVendéglátosMulatós

Forrás: pepitahirdeto.multiapro.com

Szakkísérői vizsga túlméretes szállítmányokhoz! 138.000 Ft/fő teljes áron, részletfizetési lehetőséggel! Jelentkezési feltételek: ”C” kategóriára érvényes vezetői engedély valamint legalább 5 év gépjármű vezetési gyakorlat, bármely nemzetközi kategóriában. Várjuk jelentkezését! Tel: 0620-248-4700; 0620-248-68-18; www.fuvinfoiroda.hu/tanfolyamok/eg yeb-kepzesek/szakkiseroi-tulmeretes -szallitmanyokhoz


Feladva: 2017-04-03    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: május8221túlméretesvizsgaJelentkezésiSzakkísérői2480000620jelentkezésétextranemzetköziVárjukmostbármelyfeltételekhétfőszállítmányokhozgyakorlat

Forrás: pepitahirdeto.multiapro.com

Ásvány ékszerek hihetetlen árakon nagyszerű kedvezményekkel akár 60% kedvezménnyel a Lili Bizsu webáruházban www.lilibizsu.hu Házhoz szállítás már 650 Ft-tól akár ingyenesen is


Feladva: 2017-10-29    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÁsványBizsuLiliakárnagyszerűmárárakonszállításhihetetlenHázhozékszereklilibizsuwwwWEBÁRUHÁZwebáruházbanolcsóniyeningyenesenékszertkedvezménnyel

Forrás: pepitahirdeto.multiapro.com

Értékesítőket és Hálózatépítőket keresek az ország minden területéről! Olyanok jelentkezését várom akik szeretnének elérni valamit az életükben és vannak céljaik! Lehetsz: - munkanélküli - gyesen, gyeden lévő anyuka - 18 életévét betöltött diák - nyugdíjas - vállalkozó - vagy aki jövedelmét szeretné kiegészíteni Aki komolyan foglalkozik vele rövid időn belül lehet akár Főállás is! Feltétele a munka kezdéshez: - Internet elérhetőség - Jó kommunikációs készség - Akarat - Kitartás - ... további részletek >>

Célok Akinek felkeltettem az érdeklődését és szeretne a munkatársam lenni, írjon!


Feladva: 2017-01-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekHálózatépítőketÉrtékesítőketszeretneAkivállalkozóAkaratcéljaikmindenbelülnyugdíjaskészségvannakországidőnírjondiákkommunikációséletükben

Forrás: pepitahirdeto.multiapro.com

A lakásfelújítás stressz mentes lebonyolításáért hívjon minket, bontástól a kulcsátadásig, nálunk minden egy kézben.


Feladva: 2017-03-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: lakásfelújításkulcsátadásigBudapestenbontástólminkethívjonlebonyolításáértmentesstresszkézbenegyBudapestmindenÁdámnálunkHomenszki

Forrás: pepitahirdeto.multiapro.com

KOBRA AF.1 - a leggyorsabb automata iratmegsemmisítő - 24 óra folyamatos használat - fém hajtáslánc, acél fogaskerekek, edzett acél vágókések - nem szükséges olajozni a vágókéseket - 135 literes hulladéktartály www.kobra-shredder.eu/hu/af1


Feladva: 2016-08-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: kobrairatmegsemmisítőautomatashredderacélwwwhasználatvágókéseketfolyamatosolajoznióraszükségesnemvágókésekleggyorsabbedzettfogaskerekekhajtáslánc

Forrás: pepitahirdeto.multiapro.com

Golosi Kitten speciális táp a kiscicák számára, 1 hónapos kortól 1 éves korig. Ebben az életszakaszban könnyű, mégis gazdag beltartalmú táplálékra van szükség, mely elősegíti a fiatal kismacska kiegyensúlyozott, egészséges fejlődését. A könnyen emészthető csirkehús olyan fehérjeforrás, mely nagy mennyiségben tartalmazza a növekedéshez elengedhetetlenül fontos aminosavakat. A frukto-oligoszacharid (FOS) tartalmú prebiotikumok elősegítik a tápanyagok megfelelő felszívódását, mivel egészséges ... további részletek >>

táptalajt biztosítanak a bélflórának. Ugyanakkor a krokett forma a kiscica igényeinek megfelelően lett kialakítva, elősegítve ezzel a rágást. Teljes értékű állateledel csirkével és rizzsel kiscicáknak 1 hónapos kortól 12 hónapos korig. www.golosipetfood.hu/katalogus/macska/golosi-kitten


Feladva: 2017-07-01    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: golosikittenhónaposkortólmelykorigegészségesajánlóaminosavakatemészthetőlettgazdagmivelHirdetőkiscicáknakfontoskönnyenmegfelelőenmégisPepita

Forrás: pepitahirdeto.multiapro.com

Egyedileg válogatott, magas minőségű gyerekruhák piciknek és nagyoknak. Örök méretgaranciával, akár ingyenes szállítással. A Facebookon is megtalálsz, keresd: Ruhacuka


Feladva: 2017-09-29    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: RuhacukaHasználtHirdetőakárajánlásingyenesEgyedilegszállítássalválogatottFacebookonmagasmegtalálszminőségűkeresdwebáruházgyerekruhákpiciknekÖrök

Forrás: pepitahirdeto.multiapro.com

Pályázatírás másképpen Biztosan sok helyen olvashatja, hogy ingyenes pályázatírás, ingyenes tanácsadás stb. …. de elege van, hogy a végén MINDIG MINDENT ÖNNEK KELL KITALÁLNIA???? Ráadásul a számla kiállítása után a lehető leghamarabb el is feledkeznek Önről? Ha szeretné, hogy…. - 15 perc „ingyenes tanácsadás” helyett tényleg EGYÜTT GONDOLKOZZANAK ÖNNEL - egyetlen gépbeszerzés helyett KOMPLETTEN, egyben vizsgálnák cégének valódi szükségeit - valóban ... további részletek >>

TEHERMENTESÍTSÉK az összes pályázatírással kapcsolatos papírmunkától - VÉGIGKÍSÉRJÉK az egész pályázati folyamatot az előlegtől a záró-ellenőrzésig - KAPCSOLATI TŐKÉT is kapjon pályázatához, ne csak egy számlát a pályázat megnyerésekor Akkor kérjen időpontot a +36 30 928 3621 telefonszámon (vagy montaltechkft@gmail.com e-mail-en) Zakor Beátától és várjuk Önt budaörsi irodánkban.


Feladva: 2016-09-29    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ingyeneshogytanácsadáshelyettpályázatírás8230zárószeretnéZakorvalóbanÖNNEKmegnyerésekorGONDOLKOZZANAKBiztosanelőlegtőlÖnrőlmailszükségeitMINDENT

Forrás: pepitahirdeto.multiapro.com

Kárpitozás. Teljes vagy részleges kárpitozás autó utasterében. Bőr, műbőrbevonatokkal történő javítási munkák, ill. teljes belsőtér kárpitozás. Kormánybőrözés, műszerfalbőrözés, ajtókárpitbőrözés, tetőkárpitozás,ülés javítás, utastér kárpitbőrözés és műbőrkárpitozás. Lakóbusz kárpitozás. Lakóautó - lakókocsi kárpitozás, műbőrkárpitozás, bőrkárpitozás, kárpitjavítás. Helyszíni ki és visszaszereléssel is. Kéz és lábáploló szalonok pedikűrszékeinek újra kárpitozása. Kozmetikai, tetoválószék ... további részletek >>

kárpitozás. Fogászati székek újra kárpitozása. Konditermek kondigépeinek újrakárpitozása, továbbá pubok, éttermek boxainak újra kárpitozása, szivacsolása. Masszázságy, ill. sportklubok gyúrópadjainak újrakárpitozása. E mail: carleathering@gmail.com Tel.: +36209313164


Feladva: 2017-02-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: kárpitozáskárpitozásaújraújrakárpitozásaillbőrkárpitozásműbőrkárpitozásteljespedikűrszékeinekKárpitoscarleathering@gmailLakóbuszéttermekmunkákszalonok

Forrás: pepitahirdeto.multiapro.com

Budapesten belül vállalok kedvező árakon burkolást és felújítást, nagy tapasztalattal! Rövid határidővel dolgozom, hétvégén is hívható vagyok. Árak: burkolás 3000.-/nm Mozaik, díszkő, diagonál 3200.-/nm Metro csempe 3500.-/nm Laminált parketta 1000.-/nm További részletek telefonon.


Feladva: 2017-10-11    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BudapestenburkolásárakonLamináltvagyokkedvező3500hívhatóvállalokcsempehétvégénbelülMetrodolgozom3200határidővelBudapestdiagonálRövidtelefonon

Forrás: pepitahirdeto.multiapro.com

Küldje el digitális fotóját kedvencéről, családtagjáról, barátjáról s mi visszaküldjük 3 dimenziós formában, üvegkockába gravírozva! • A kép legalább 3 megapixeles és a file 800 KB vagy több legyen • Ha régi fényképet szeretne beszkennelni, akkor minimum 300 dpi-ben és .jpg file-ként mentse el! www.gravirexpressz.hu/2d-fotobol-3d-uveghasab-75×9×13-cm Üzleteink: Gravír Expressz Westend 1062 Budapest, Váci út 1-3. Középső szint, főbejárat - a Niagara vízesésnél jobbra a ... további részletek >>

Starbucks kávézóval szemben! Mobil: 06-20/922-2384 Tel./Fax: 06-1/238-7125 Gravír Expressz Mammut 1024 Budapest, Lövőház u. 2-6. Mammut I. 2. emeleti mozgólépcső Mobil: 06-20/922-2356 Tel./Fax: 06-1/345-8165 Gravír Expressz Pólus 1152 Budapest, Szentmihályi út 131. Mobil: +36-20/454-9634 Tel./Fax: +36-1/410-5080 Gravír Expressz Árkád Pécs 7622 Pécs, Bajcsy-Zsilinszky u. 11. A földszinten, az Intersparral szemben Mobil: 06-20/264-1170


Feladva: 2016-09-28    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ExpresszGravírMobilBudapestFaxTelfile8226szemben922PécsMammutSzentmihályimentseajánlóLövőházfényképetÁrkádszintüvegkockábakéntHirdető1170

Forrás: pepitahirdeto.multiapro.com

Ingyenes házhoz szállítás keltetőgépekre Magyarországon belül bárhova, ajándék hőmérővel! Új Keltetőgépek 1 év garanciával, kézi vagy automata forgatóval, légkeveréses, digitális kijelzővel. Továbbá kaphatóak a keltetéshez használatos kiegészítők: páramérő (3, 5e), hőmérő(2, 5e), tojáslámpázó(3, 5e). Keltethető tojások: szárnyasok, hüllők, méhek. Hu100sk: 32, 9e, Hu140sk: 36, 9e, Hu100fsk: 59, 9e, Midi55fsk: 69, 9e, Midi60fsk: 69, 9e, Midi100fsk: 79, 9e. Szállítási idő: 1 nap.


Feladva: 2013-12-11    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: garanciávalKeltetőgépekpáramérővagyHu100fskházhozkiegészítőkkéziHu140skIngyeneshasználatosHu100skGellértkeltetéshezméhekKajoskaphatóakDecembernap

Forrás: pepitahirdeto.multiapro.com

Nem árulok zsákbamacskát, sem ”legyél milliomos fél nap alatt” című e-könyveket sem. Egyszerű, bárki által könnyen érthető, INGYENES és fizető oldalakra szeretném a hangsúlyt fektetni. Egészítse ki a fizetését, keressen pénzt az interneten! Maximalizálja a profitot és költse arra amire szeretné! Látogasson el a blogoldalamra!


Feladva: 2017-05-31    [Pénzkeresés - MLM]

Címkék, kulcsszavak: sem8221félpénztkönnyenmilliomoskeressenáltalblogoldalamralegyélfizetésétbárkiLátogassonzsákbamacskátEgészítseEgyszerűszeretnéárulokfektetniNem

Forrás: pepitahirdeto.multiapro.com

A Wilson Burn széria a 2017. évi tavaszi szezonra teljesen megújult mind anyagában, mind külső megjelenésében. A széria három tagja (95 CV, 100 CV, 100S CV) új megerősítést kapott a Countervail technológia révén, amelyet félévvel korábban a Blade szériánál mutatott be először a Wilson. Az ütők megjelenése is harmonizál a Blade és Pro Staff ütők színvilágával, ami minimál dizájnt jelent, fekete alapszínnel, tiszta vonalakkal és matt festéssel. Az ütőket a szériákra jellemző szín teszi ... további részletek >>

megkülönböztethetővé a többitől, így a Burn ütők messziről felismerhetők a feketébe ágyazott narancsszínükkel. A Burn széria teniszütői az alapvonal játékosok számára készülnek, akik nagy erővel hátulról játszva ütik a labdát, s ezzel tartják ellenfelüket folyamatosan nyomás alatt a mérkőzés utolsó pillanatáig. www.lhsport-shop.hu/tenisz/teniszuto/wilson-burn-95-cv-teniszuto


Feladva: 2017-04-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: burnwilsonütőkszériateniszutomindBlade2017PepitaakikStaffmesszirőlrévénfolyamatosanmattkészülnekProtechnológiaanyagábanellenfelüketvonalakkal

Forrás: pepitahirdeto.multiapro.com

Eladó XVI. Kerületben, egy 6-lakásos társasház alatt, főútvonalon, az Örs vezér tér közelében (Nagyiccén) 20 m2-es, komfortos garázs WC-vel, mosdóval, saját vízórával és villanyórával. Két ablak nyílik a főútvo-nalra. A billenő garázsbejáraton még egy külön nyitha-tó személybejárat is van. Ára: 3.900.000.- Ft. Tel: 06302226247


Feladva: 2017-09-24    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egyvelTellakásosbillenőgarázs000Kerületbennalrakomfortos900XVIfőútvoNagyiccénÁraEladónyílikközelébenvanBudapestablaktérszemélybejárat

Forrás: pepitahirdeto.multiapro.com

VENDÉGLÁTÓS állásaink Németországban: szakács, felszolgáló, szobalány, főzőasszony. SZAKÁCS végzettséggel és valamennyi némettudással, szállással és ellátással. 1800-2400€ Bruttó. FELSZOLGÁLÓ (végzettség nélkül is) Wirshausba (kocsma) 900€ nettó + borravaló (kb 1600-1800€ nettó lesz a vége), szállással és ellátással. (valamennyi némettudással-A1-től) 35 éves korig. SZOBALÁNY és konyhai kisegítő (50-50%) egy kis Panzióba ( 8 szoba van) 1000-1200 € nettó, ... további részletek >>

szállással és ellátással. (B1 némettudástól) BeiKoch – segédszakács, KUKTA- (főzőasszonyt- főzni tudó személyt keresünk) vendéglőbe valamennyi némettudással, szállással és ellátással. 1000-1200€ nettó. További infók a www.nemetmunka.hu/gastro.html weboldalunkon, ahol regisztrációs lehetőség is van. Érdeklődni munkaidőben a +36 1 920 3433 vagy a +49 8641 6949 000 vezetékes számokon lehet. Várjuk jelentkezését! Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban)


Feladva: 2017-03-26    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 8364ellátássalszállássalnettónémetnémettudássalvalamennyi1000állásainkSZOBALÁNYVENDÉGLÁTÓSFELSZOLGÁLÓTeamMunka1800SZAKÁCSvan1200számokonkonyhai

Forrás: pepitahirdeto.multiapro.com

Energetikai tanúsítvány készítése Kecskeméten és Bács-Kiskun megyében ingatlanok adásvételéhez, illetve bérbeadásához, pályázatokhoz! Rövid határidővel, olcsón!


Feladva: 2015-06-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: tanúsítványEnergetikaikecskemetKiskunBácsKecskemétenolcsónhatáridővelrövidkészítésepályázatokhozbérbeadásáhozilletvevételéheztanusitvanyadáswww

Forrás: pepitahirdeto.multiapro.com

Az Ozeki IoT szoftvereket és eszközöket gyárt, amely terület robbanásszerűen fejlődik napjainkban. Mit várunk az ideális jelölttõl: - Felsőfokú programozói vagy mérnök informatikus végzettség (Utolsó éves hallgatói státusz, amely nem igényel hallgatói jelenlétet.) - Java nyelvismeret Amiben többet nyújtunk, mint más cég: - Szakmai képzés IoT területen. - Legújabb technológiák és kutatási eredmények használata - Átlagon felüli fizetés az elért eredmények arányában. Jelentkezés ... további részletek >>

módja: A job@ozeki.hu email címünkre küldött önéletrajzzal és jelentkezési adatlappal. Folyamatosan várjuk a jelentkezőket!


Feladva: 2016-07-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: JavaIoTeredményekhallgatói245amelyOzekitechnológiákMitAmibenálláslehetőségmódjavégzettségLegújabbnapjainkbanjelentkezőketnyelvismeretfejlesztvagy

Forrás: pepitahirdeto.multiapro.com

Irodalmi és képzőművészeti pályázatokat keres ? A www.omlit.hu oldalon megtalálja! Az egyik legfrissebb pályázatunk: I. nemzetközi Mécs László Irodalmi Díj pályázat. Fődíj: 102016 Ft!


Feladva: 2016-11-20    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: IrodalmipályázatokatMécsképzőművészetinemzetköziGYJApályázatunkpályázatoklegfrissebbegyik102016megtaláljaFődíjoldalonpályázatomlitDíjwwwkeres

Forrás: pepitahirdeto.multiapro.com

Jelentkezz haladó webprogramozó képzésünkre, melynek elvégzése után cégünknél akár azonnal munkába tudsz állni webfejlesztőként! Emelt szintű, gyakorlatias képzés PHP, MySQL, Javascript, HTML5 nyelveken, OOP keretrendszerek használatával. Részletek: www.szhweb.hu/kepzes/halado-webpro gramozo/ A haladó képzés jelentkezési feltétele valamilyen webes szakirányú előképzettség. A tanfolyam díja akár 100%-ban visszakapható!


Feladva: 2017-01-12    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: képzéswebprogramozóhaladóakárszhwebRészletekEmeltwebeshasználatávalwebfejlesztőkéntJelentkezzvalamilyenkeretrendszerekállniKomlófeltételeOOPtudsz

Forrás: pepitahirdeto.multiapro.com

Pihenjen, gyógyuljon és töltődjön fel Hajdúszoboszlón, a Pávai Apartmanházban, 2 személyes, kényelmes apartmanjainkban, melyek a gyógyfürdő bejáratától csak egy rövid sétára találhatóak. Az ajánlat tartalmazza a szállásdíjat 6 éjszakára, a parkolás, internet használatát is. A külön bejáratú, 2 személyes apartmanok mindegyikéhez saját, jól felszerelt konyha, fürdőszoba tartozik. Ágynemű huzat, törölköző, kábel és műholdas tv, Wi-Fi internet, a teraszon, erkélyen kerti bútorok.


Feladva: 2016-11-11    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: PávaiApartmanházinternetszemélyesbejáratátólbútorokfürdőszobaPihenjenparkolásgyógyfürdőkertikonyhaHajdúszoboszlóéjszakáramelyekerkélyenfelszerelt

Forrás: pepitahirdeto.multiapro.com

A NAGISZ Zrt. Intenzív sertés koncentrátumainak és szemes terményeknek meghatározott arányú keverésével a kis- és közepes gazdaságokban tartott sertések egészséges és gazdaságos felnevelésére alkalmas teljes értékű takarmányok készíthetők. Az Intenzív sertés koncentrátumok kiváló alapanyagai, magas fehérje- és energia tartalma miatt alacsony fajlagos takarmány felhasználás melletti gyors növekedést biztosítanak. ... további részletek >>


Feladva: 2016-10-10    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: IntenzivSertessuldokomarimanterményeknekbiztosítanakfehérjegazdaságoskoncentratumszemesnövekedéstmagasegészségeshizogyorskoncentrátumainakalapanyagai

Forrás: pepitahirdeto.multiapro.com

A Fordított Ozmózis víztisztító berendezés a mosogató alá szerelhető, kis helyigényű. Közvetlen a hideg víz csapjához csatlakoztatjuk a többlépcsős szűrőberendezést. A beszerelése különös szakmai tudást nem igényel, a használati utasításokon leírtak alapján egyszerűen elvégezhető. A víztisztító berendezés csak a szabvány ivóvíz, a vízművek által kibocsájtott víz tisztítására alkalmas. A nem a vízhálózaton keresztül folyó szennyezett származású víz tisztítása nem végezhető el!


Feladva: 2015-06-25    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: víztisztítónemvízszakmaifolyókisberendezésszűrőrendszerkülönöskeresztülszerelhetőbeszerelésevízhálózatonaláelvégezhetőkszűrőberendezéstalkalmasBéla

Forrás: pepitahirdeto.multiapro.com

Most adunk egy tippet, mivel váltsa ki meglévő halogén izzóját, a kevesebb energiafogyasztás végett! LED spotlámpával csökkentheti a világításra fordított energiát! A 3 wattos LED lámpa bruttó 890 Ft-ba kerül, ennyiért legfeljebb 3 halogén izzót vásárolhatunk, ugyanakkor a fogyasztást negyedére csökkenthetjük, így hamar megtérülés a LEDre fordított csere. Energiatakarékos LED spotlámpa 3 watt fogyasztással a 20W halogén helyére az ANRO Épületdíszítés Webáruházban!


Feladva: 2015-04-09    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: LEDhalogén890fordítottANROkevesebbhamarizzók20WizzójátígyWebáruházbruttófogyasztássalmeglévőcsökkenthetjükdarablámpawattváltsanegyedére230V

Forrás: pepitahirdeto.multiapro.com

Az ország legelismertebb és legjobban foglalkoztatott Elvis imitátora, külföldi turnéja után újra Magyarországon vállal fellépéseket. Ő az egyetlen Magyarországon, aki Las Vegasban sajátította el a szakmát. Ha színvonalas műsort szeretne, hívjon bizalommal telefonon!


Feladva: 2016-04-24    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: ElvisMagyarországonLasakifoglalkoztatotttelefononlegjobbanbizalommalegyetlenlegelismertebbhívjonfellépéseketországszeretnevállalélőbenműsortújra

Forrás: pepitahirdeto.multiapro.com

Minőségi kínai telefonok és kiegészítők elérhető áron! Ingyenes szállítás 1 év garanciával, megbízható országos szervizekkel. Vásárlás csak előreutalással lehetséges. Vállalkozások részére külön kedvezmények. 0-24 elérhetőség online, telefonos ügyfélszolgálat 16.30-20.00-ig, hétvégén is.


Feladva: 2017-07-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: garanciávalkínaiMinőségionlineországosajánlóelérhetőségmegbízhatóHirdetőkedvezményekPepitakülönszállításnyelvenrészéreIngyenesmagyarVállalkozások

Forrás: pepitahirdeto.multiapro.com

Nyugtató-lazító hatás: a test átmelegszik, könnyeddé válik az idegek kisimulnak az izmok ellazulnak az idegrendszer megnyugszik a vér- és nyirokkeringés megélénkül javul a sejtek oxigén- és tápanyagellátása salak- és méreganyagok kiválasztása hormonális hatás (érintésre a szervezet endorfin és oxitocin hormont állít elő, amelyek a test saját stressz- és fájdalomcsillapító szerei).


Feladva: 2015-08-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatástestméreganyagokpozitívellazulnakelőNagysalakhogyizmokállítmasszástápanyagellátásacéljakisimulnakhormontrelaxációsoxigénvégzőidegekválik

Forrás: pepitahirdeto.multiapro.com

Rusztikus kerti bútor, kerti garnitúra csomoros nyárfából eladó, tetszés szerinti méretekben és színekben a gyártótól megrendelhetõ! Garantált minõség, kedvezõ árak! Termékeink: asztalok, padok, székek, fatálak, sarokpadok, egyedi faragott bútorok, komplett kerti és étkezõ garnitúrák. Éttermek, vendéglátóegységek, borozók, sörözõk berendezését is vállaljuk. Tel: +36209325853 ; Web: www.artholz.hu ; info@ artholz.hu


Feladva: 2016-11-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 245kertibútorokRusztikusárakTeleladókomplettkedvezvállaljuknyárfábólségberendezésétcsomorosfaragottmingarnitúraegyediGarantáltsörözbútorwww

Forrás: pepitahirdeto.multiapro.com

🍀Figyelem! Figyelem!🍀 Nyitási akcióként szeretnénk megajándékozni minden kedves REGISZTRÁLT ÜGYFELÜNKET ”1” Ft-os áron választható termékekkel. Ajándék választásának feltétele: 30 000 Ft és 60 000 Ft feletti termékek megrendelése! Az ajándékok a kosárban a meghatározott összeghatár után tekinthetőek meg!🤔🤔🤔


Feladva: 2016-11-09    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 129300000PROFI127808Figyelem8221VargatermékekREGISZTRÁLTIstvánfelettikedvesSZERSZÁMPLACCmindenmegMINTfeltételemegajándékoznitekinthetőekMÁS

Forrás: pepitahirdeto.multiapro.com

MI AZ AGYKONTROLL? A Stanford-i egyetem kutatói szerint elménk adta képességeinknek csupán mintegy 2%-át használjuk ki. A Silva-féle agykontroll egy tudományosan megalapozott, egyszerű, praktikus, könnyen elsajátítható önfejlesztő módszer, ami lehetővé teszi, hogy ennél lényegesen nagyobb mértékben használjuk ki istenadta lehetőségeinket, s így sikeresebben oldjunk meg mindenfajta problémát. Egyik fontos eszköze a relaxáció avagy lazítás, ami egyúttal a bizonyítottan megbetegítő hatású ... további részletek >>

stresszt is levezeti. Az agykontroll nem vallás. Ateista ember ugyanúgy megtanulhatja elméje hatékonyabb használatát, mint az istenhívő, ahogy világnézetétől függetlenül mindenki megtanulhat például úszni is. Az agykontroll nem mágia, hanem elménk sokak által ma még kevéssé ismert, s emiatt kevéssé kiaknázott képességeinek okos – tehát nem kishitű és nem is fanatikus – használata, ami kiegészíti a cél elérése érdekében tett cselekedeteinket! Jelszavunk: egyensúly. MIRE JÓ AZ AGYKONTROLL? – A stressz levezetésére, – alvászavar megszüntetésére, – ébresztőóra nélküli, időzített ébredésre, – élénkítőszer nélküli felfrissülésre (például autóvezetéskor), – a fejfások 90%-ának és a migrénnek gyógyszer nélküli elmulasztására, – a minket foglalkoztató kérdések – bölcsebb tudatalattink és az „összemberi tudás”* bevonásával történő – megválaszolására, – a memória fejlesztésére, – gyorsabb és hatékonyabb tanulásra, – a jó döntéshozatal megkönnyítésére, – céljaink elérésére (magunk és szeretteink gyógyulását is beleértve), – a fájdalom és a vérzés gyors uralására, – szokásaink (pl. dohányzás, alkoholizálás, túlzott evés, lustaság, rendetlenség) akaraterő és kínlódás nélküli megváltoztatására, – gyerekeink és felnőtt szeretteink szavak nélküli megsegítésére, – a misztikusnak hitt, ám valójában természetes és hasznos intuíció avagy megérzőképesség rendkívüli fokozására. Tudományosan is bizonyított tény, hogy az emberi elmék között láthatatlan szálakkal kapcsolat van. Az egyes emberek tudása így bizonyos értelemben „összemberi tudássá” válik. Többnyire ez magyarázza, hogy felfedezők, feltalálók sokszor egyszerre álltak és állnak elő azonos ötletekkel. Nem véletlenül mondja hát a módszerről a világhírű amerikai orvos, dr. Clancy D. McKenzie: „Ha valaki megtapasztalja az eredményeket, amiket ezen a tudatszinten el lehet érni, akkor a későbbiekben már meg se kísérel ennek használata nélkül fontos döntéseket hozni vagy problémákat megoldani.”


Feladva: 2016-10-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 8211AGYKONTROLLnemnélküli8222amiméghogy8221kevésséhasználjukhatékonyabbfontoshasználatapéldáulMIREtudományosanszeretteinkelménkígyavagyának

Forrás: pepitahirdeto.multiapro.com

Fashion Plus divatos női ruha webáruház, naponta bővülő divatos női ruha kínálattal, és akciókkal ajándékozza meg látogatóit. Napi Fashion Plus divat tippek a divatos női ruha webáruház kínálatát felsorakoztatva kiegészítőkkel és szép divatfotókkal, a legjobb divat tippeket nyújtja a divat és női ruhák szerelmeseinek. Női ruhák és alap darabok, pulóverek, pólók, divatos nadrágok, divatos szoknyák, kabátok és kiegészítők bő választéka!


Feladva: 2016-10-29    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: NőidivatosruhadivatPlusFashionruhákwebáruházdarabokkiegészítőkkelajándékozzaalapfelsorakoztatvaakciókkalkínálatátválasztékakínálattalkiegészítők

Forrás: pepitahirdeto.multiapro.com

Adatrögzítést, gépelést vállalok. Jegyzőkönyv készítését értekezletről, közgyűlésről, konferenciáról, gyorsírással, hanganyag készítésével. Gépelést, szövegszerkesztést, hanganyagok leírását, adatfeldolgozást, adatbázis feltöltést. Szakdolgozatok, fordítások, könyvek, használati útmutatók, diplomamunkák, kéziratok, életrajzok, önéletrajzok leírását. Interjúk, cikkek, háttéranyagok leírását diktálással is. www.kattyca.mindenkilapja.hu/html/ 22219339/render/bemutatkozas


Feladva: 2015-07-17    [Vegyes hirdetések]

Címkék, kulcsszavak: leírásátkattycakészítésétJegyzőkönyvGépeléstmindenkilapjaértekezletrőlInterjúkadatbázisönéletrajzokadatfeldolgozástwwwéletrajzokhanganyagokcomvállalok

Forrás: pepitahirdeto.multiapro.com

A látás egyik legnagyobb értékünk. 6 féle olyan gyakorlatot tanulhat meg, aminek otthoni ismétlésével javítani, tudja saját és családja látását. A gyakorlatok könnyen megtanulhatók és együtt ismételheti az egész család. Időpont egyeztetésért, bővebb információért hívjon a 06-30/907-47-86 telefonon. Életmód Stúdió - www.eletmod-debrecen.hupont.hu/36/ a-latas-helyreallitasa-termeszetes- uton


Feladva: 2017-09-17    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: debrecengyakorlatokhelyreallitasagyakorlatotinformációértlátásátlatasolyanbővebbcsaládjahupontféleegyeztetésértsajátértékünkIdőponttudjaeletmod

Forrás: pepitahirdeto.multiapro.com

A Négy Évszak Magánóvoda szeretetteljes környezetet biztosít a bölcsőde és az általános iskola kapuja közötti úton. Szeretettel várjuk gyermekét a belváros szívében, a bankok és minisztériumok negyedében. Csoportjainkba az év közben is folyamatos a 2,5 és 7 év közötti korú gyermekek felvétele, amíg a szabad férőhelyek megengedik. Óvodánk három csoporttal működik, államilag regisztrált, OM azonosítóval rendelkezik: OM 202810. Jöjjön el, ismerjen meg minket...


Feladva: 2016-09-11    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: MagánóvodaközöttiközbenmegkapujaÓvodánkBudapestCsoportjainkbaismerjeniskolamegengedikPicurkanegyedébenJöjjönáltalánosférőhelyekBelvárosban202810

Forrás: pepitahirdeto.multiapro.com

Vegye igénybe cégünk weboldal készítési szolgáltatásait.


Feladva: 2016-12-28    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: honlapokegyedikészítéseszolgáltatásaitweboldalakwebkészítésiMinőségicégünkigénybeVegyeBudapestWebnaviwebáruházak

Forrás: pepitahirdeto.multiapro.com

Takarítás és kapcsolódó feladatok... A környéken élő, gyakorlott, sok szabadidővel rendelkező, megbízható, leinformálható, takarító hölgyet keresünk! Lakások takarításához hosszú távra, folyamatos munkalehetőséggel, változó időpontokban való (hétvégén, reggel, vagy este is) munkavégzésre és lakáskiadáshoz kapcsolódó feladatok elvégzésére. Angol/német nyelvtudás előny. Tel.: 0630 452 9013


Feladva: 2017-09-20    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: Takarításkapcsolódófolyamatos9013szabadidővellakáskiadáshoztávra452sokmunkavégzésrehosszú0630gyakorlottestetakarításáhozTelélővagylakásokelőny

Forrás: pepitahirdeto.multiapro.com

Nadrágok, ruhák, szoknyák és kabátok rövidítését, szűkítését, vagy karcsúsítását vállaljuk rövid határidőre, korrekt áron. Cipzárcsere, cipzárjavítás szakszerűen! Cím: Budapest IX. Tompa utca 22. Ruhaszerviz Nyitva: h,sz,p,: 9,15-17,00-ig k,cs,: 10,00-18,00-ig A szombati nyitva tartásról érdemes előzetesen érdeklődni! Tel.: 06-1-215-7047 Várom szeretettel! www.divatruha.hu/index.php?page=ru haszerviz


Feladva: 2016-07-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: RuhaszervízFERENCVÁROSBANNEKEDBudapest251kítésétérdeklődjöncipzárjavításrövidítésétnyitvatartásrólCipzárcserekabátokszombatiáronszoknyákNyitvakorrekt

Forrás: pepitahirdeto.multiapro.com

Kedvező áron vállalom I. osztályú kerítés lécek készítését kemény fából, légszáraz anyagból. A kerítéslécek 22 mm vastagságban, bármely marásmintával, gyalulva és csiszolva készülnek, igényes minőségben. Dísz- és élberakott kerítésléceket, lapkerítéseket, kutyaházakat készítek, a vásárló igényének megfelelően. Akár saját tervezés alapján is. Szállítás megegyezés szerint az egész országban. Hívjon bátran, vagy írjon!


Feladva: 2017-08-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: lécekkerítésosztályúmegegyezéslapkerítéseketvastagságbanlenadebora@gmailvállalomSzállításkerítésléceket22mmírjonáronalapjánÉlberakottkerítéslécekvagy

Forrás: pepitahirdeto.multiapro.com

DOKA PERI monolit födém zsaluzatok készítése, bérbeadása, értékesítése. Vasszerelések összeállítása, födém betonok készítése


Feladva: 2015-07-08    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: készitésefödémbérbeadásaBélamonolitZacharovitsPERIDOKAzsalufarmösszeállításawwwszerelésekcomvaszsalufarm@gmailértékesítése9006426zsaluzatok

Forrás: pepitahirdeto.multiapro.com

Tudvalevő, hogy a téli levegő igen száraz, amely az emberi szervezetre nézve nem a legegészségesebb. Tény, hogy az alacsony páratartalmú környezetben a vírusok sokkal könnyebben szaporodnak, ám amikor a páratartalom 43% vagy ennél magasabb (az ideális páratartalom 40 – 60% között van) ez a kockázat csökken. Érdekelnek a párásítók? www.marketworld.hu/A-parasito-10-e lonye-b47.html


Feladva: 2017-10-19    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: elonyepáratartalomhogyennélTénypárásítókTudvalevővagylegegészségesebbÉrdekelnekajánlásamikornemcsökkenHirdetőszaporodnaknézvekockázatPepitavan

Forrás: pepitahirdeto.multiapro.com

Háztartási műanyag áruház! Minden, ami egy háztartásban kell, konyha, fürdőszoba, takarítás, kert, gyerekbútorok, játékok... Érdemes nézelődni!


Feladva: 2017-07-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: műanyagháztartásikerttakarításfürdőszobamuanyagabckonyhawwwkellhttpháztartásbanBudaörsamiIldikónézelődnimindenPriskinérdemesmegjátékokáruház

Forrás: pepitahirdeto.multiapro.com

AcPumPa azonnali országos kiszállítással, Budapesten 1-2 órán belül, vidéken 24 órán belül átvehető. AC pumpa tankon belül, AC pumpa tankon kívül, elektromos üzemanyag szivattyú 5200 autóhoz, és munkagéphez, raktárról non-stop működő webshopunkból. Telefonos érdeklődés napközben 8-18 óra között. „Velünk biztosan újra indul”


Feladva: 2015-05-04    [Autó - Motor - Jármű]

Címkék, kulcsszavak: acpumpabelülAzonnaltankonóránüzemanyagszívattyúbiztosanOrszágosacpumpawebshopelektromosVelünkwwwkívül8222kerwebshopunkbólközöttXVIIImüködő18h

Forrás: pepitahirdeto.multiapro.com

Eladom bélyeggyűjteményemet egyben vagy darabonként. Érdeklődni lehet: Bodor Csaba: 06-20/556 9841 bodormotor@gmail.com


Feladva: 2017-05-27    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: CsabaBodorÉrdeklődnidarabonkéntvagyegybencombélyeggyűjteményemetbodormotor@gmailEladom9841Tahitótfalu556eladóBélyeglehet

Forrás: pepitahirdeto.multiapro.com

Nyíregyházán két utcával határolt 4615 m2 telephely, építési telkeknek is, az Ukrán, Román, Szlovák határokhoz vezető 41-es főút 6-os km-nél eladó. A városközpont 4 km, az M3-as autópálya 1 km, a határok 50-100 km távolságra vannak. Sok célra alkalmasan, lekövezve, bekerítve, közművesítve, tetszés szerint oszthatóan. 63 méter széles. Itt megvalósíthat bármit sikeresen. Jól megközelíthető, forgalmas, látványos hely, jó kiindulópont.


Feladva: 2017-09-18    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladókiindulópontSzlovákNyíregyházamétertávolságrahelyRománJánososzthatóan100látványosUkránNemesszerinthatároktelkeknekforgalmasterülettetszés

Forrás: pepitahirdeto.multiapro.com

A fitt emberek webáruháza. Eredeti Body&Fit termékek Magyarországon. Étrend kiegészítő, sporttáplálkozási, diétás termékek. Fehérjék, aminosavak, protein szeletek, diétás édességek. Nézze meg weboldalunkat és adja le megrendelését.


Feladva: 2017-07-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: termékekFitBodydiétáshungaryproteinwebáruházabodyfitaminosavakemberekwwwFehérjékfittmegrendelésétBudapestadjasporttáplálkozásiweboldalunkatmeg

Forrás: pepitahirdeto.multiapro.com

Országosan olyan üzletkötőket keresünk csapatunkba, akik nem kezdők már az értékesítésben, de kimagasló teljesítményükért elvárják a megbecsülést is cserébe. Talán pont Téged keresünk? Magas kereseti lehetőség, NEM MLM! Ha ilyen üzletkötőnek tartod magad, küldj önéletrajzot az alábbi email címre andras.bogar@athletastic.co m! Vagy ismersz valakit, aki ilyen üzletkötői munkát keres, kérlek, vedd fel vele a kapcsolatot.


Feladva: 2017-10-02    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünküzletkötőketNEMilyenvalakitcsapatunkbamagadkapcsolatotTalánismersztartodvelecserébeVagyolyanüzletkötőnekfelmegbecsüléstcomOrszágosan

Forrás: pepitahirdeto.multiapro.com

Az MS-METAL KFT. tevékenysége közé tartozik különböző acéltermékek, fémtömegcikkek gyártása, valamint ezen termékek értékesítése. Megrendelőink igényei alapján gyártunk különböző stancolt, hajlított vagy görgőzött, hegesztett lemezalkatrészeket, különböző polcokat, polcszerkezeteket, állványszerkezeteket, fali síneket, fali tartókarokat, valamint raktártechnikai elemeket és egyedi acéltermékeket. A gyártott termékek vasfoszfátos alapozással, elektrosztatikus vagy tribosztatikus porlakk ... további részletek >>

bevonattal készülnek. Termékeink segítségével minden tárolási probléma gyorsan és egyénileg megoldható. Tevékenységünk közé tartozik az álmennyezeti elemek gyártása és értékesítése, mely mind beltéren, mind kültéren használható. A méretválasztékból a kombinációs lehetőségeket kihasználva minden igényt kielégítő polcrendszer állítható össze, legyen az irodában, lakószobában, gyerekszobában, kamrában, garázsban. Ha vásárolni szeretne, válasszon webshopjaink közül!


Feladva: 2016-12-31    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: mindenkülönbözőközévalamintvagymindfaliértékesítésetermékekgyártásatartozikelemeketpolcszerkezetméretválasztékbólhegesztettporlakktevékenységePolc

Forrás: pepitahirdeto.multiapro.com

3/4-es méretű klasszikus gitár, mely elsősorban gyermekek részére készült, belépő szintű tanulógitár. Agathis testtel, juharfa nyakkal, rózsafa fogólapokkal, 18 bunddal. Méret: 3/4-es Típus: Klasszikus Gitárok Fogás: Jobbkezes Szín: Rózsaszín Test: Agathis Nyak: Juharfa Fogólap: Rózsafa Fedlap: Agathis Híd: Juharfa Nyakhossz: 580 mm www.dj-sound-light.hu/dimavery-ac- 303-34-es-klasszikus-gitar-rozsaszi n-6753


Feladva: 2017-07-03    [Zene - Hangszer]

Címkék, kulcsszavak: klasszikusJuharfaAgathis303RózsafadimaverygitárNyakhosszPepitaJobbkezes6753belépőFogásrozsaszinkészültHídGitárokgitarrészéreTípusgyermekek

Forrás: pepitahirdeto.multiapro.com

A Lada Vesta stílusos, merész és ragyogó – pont, mint amilyennek egy új generációs Ladának lennie kell. A szedán sziluettje korszerű és harmonikus, az X forma egységként kíséri végig a karosszériát. Az új, bátor stílus könnyen felismerhető a részleteiben: a fekete színnel kiemelt radiátor borításban, a lenyomatokban az oldalakon, a hátsó fényszórók fényvisszaverőin. A megemelt öv vonalának, meghosszabbított motorháztetőnek illetve lejtős tetőnek köszönhetően a Vesta külsőre is sportos és ... további részletek >>

dinamikus. Egy ilyen autóval nehéz észrevétlennek maradni az utakon. Vesta. A LADA új arca. www.ladaszolnok.hu/vesta_sedan_ismerteto


Feladva: 2017-04-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: vestaLADAEgymeghosszabbítottmintsedanszínnelilyenformavonalánakpontfeketeharmonikusmegemelt8211ladaszolnokrészleteibendinamikuskorszerűragyogó

Forrás: pepitahirdeto.multiapro.com

Angol nyelvtanítás, korrepetálás, felkészítés nyelvvizsgára, állásinterjúra, közép és emelt szintű érettségire Szolnok belvárosában diplomás nyelvtanárral.


Feladva: 2017-09-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nyelvtanításAngolSzolnokbelvárosábanbarnaérettségireszintűemeltközépállásinterjúranyelvvizsgárafelkészítésnyelvtanárralkorrepetálásdiplomás

Forrás: pepitahirdeto.multiapro.com

Eladó tulajdonostól Bpest. Rákoshegy - Nagyhangácson az Orgoványi utcában 620,2 nm-es, külterületen lévő bekerített kertgazdasági, szántó, gazdasági épület, kivett lakóház, udvar megjelölésű ingatlan és a hozzá tartózó 44,8 nm szolgalmi út. A telken villany és a vezetékes víz bekötve a házba, gáz az utcában, gyűrűs kút, bontandó vagy erősen felújításra szoruló 36 nm-es faház (2 helység, külön WC, tusolós mosdó, veranda és 26 nm-es fedett tároló) van. Csatorna, szennyvíztároló nincs. ... további részletek >>

Személygépkocsi tárolás kerítésen belül megoldható. Utca fronti személykapu, oldalsó gk. bejárat. A terület átminősítése gazdasági területté a Fővárosnál folyamatban van. Befektetésnek is ajánljuk. BKV busszal 10 perc a KöKi . Tájékoztatás csak telefonon! Az ár alkuképes irányár.


Feladva: 2017-10-16    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vanEladógazdaságiutcábanirányárfedettkivettRákoshegyerősenUtcavillanyépületalkuképes26nmBpestfolyamatbanvagymegoldhatótelkenszántótelefonon

Forrás: pepitahirdeto.multiapro.com

Kútfúrást, víznyelő fúrást vállalok kézzel és géppel. Vállalási területek: Szigetszentmiklós, Szigethalom, Tököl, Halásztelek, Dunaharaszti, egész Csepel-sziget, Délegyháza, Dunavarsány, Zugló, Kispest, Alsónémedi, Pesterzsébet, Újpest, Budakalász, Angyalföld, Kiskunlacháza, Kunszentmiklós, Majosháza, Budapest és környéke. Kedvező áron, minőségi szűrővel. Az ár tartalmazza a hozzávaló anyagokat is. Munkáinkra garanciát vállalunk!


Feladva: 2015-07-21    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SzigetszentmiklóskörnyékénBudapestenanyagokatfúrástKiskunlacházánCsepelhozzávalóvíznyelőAngyalföldönegésztartalmazzaKútfúrástBudakalászonDunaharaszti

Forrás: pepitahirdeto.multiapro.com

Hajcica Agency oldalán minden egy helyen! Nézzen be hozzánk, fantasztikus kínálat hostess, táncos hölgyekből, chippendale fiúkból, show műsorokból. Megszervezzük esküvőjét, szülinapi meglepetés buliját, vagy bármilyen céges rendezvényét teljes szervizeléssel! Rendeljen tőlünk! Kedvezményeink egyediek, az Ön igényeinek megfelelően. Rugalmasak vagyunk, hiszen a legfontosabb dolog: A MEGRENDELŐ-nek megfelelni, hogy visszajöjjön!


Feladva: 2014-12-24    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hajcicaagencymegfelelnihostesskedvezményeinkProdukciósmeglepetésnekkínálatfolyamatosanszervezéseszülinapiMEGRENDELŐfantasztikustőlünkrendezvényekcom

Forrás: pepitahirdeto.multiapro.com

Törökországban, Alanyaban élő magyar házaspár vagyunk. Itt egész évben szezon van, egész évben segítséget nyújtunk a Török Riviérára utazó turistáknak. Fő profilunk: fakultatív programok, egyéni utazások szervezése, lakások eladása-vétele, letelepedési ügyek intézése, cégalapítás. Élérhetőségeinket megtalálja a hirdetés alján! Telefonszámunk nem emelt díjas! Ha utazást, üzleti tevékenységet tervez, állunk rendelkezésére!


Feladva: 2015-11-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: syedrawww5mptorok534nyujtunkRobertszervezesetelsegitsegettoursrivieranutazasokcomvallaljukhomesfelegyenihomes@hotmailevbenElerhetosegeink

Forrás: pepitahirdeto.multiapro.com

A Makulátlan Tiszta Terület Kft., Panoráma ablak, a PVC, a Parketta, a Felújítás utáni, A szőnyeg mély tisztítása, az Irodai eszközök tisztítását, a Zsíros kézmosó, a Boltíves üvegtető, a Lépcsőházi takarítás, a Kazánház takarítása, a Sportlétesítmény, a Kirakattisztítás, a Nagy felületű ablak tisztítása, a Mohás terasz takarítása, az Éttermi asztal tisztítása, a Maszatos, csíkos padló tisztítását a Gumicsík eltávolítását, a seprést, a Domború burkolatok, az Irodaház ablakainak tisztítását, az ... további részletek >>

Olajozott parketta tisztítását, a Garázs tisztítását, mind kihívásnak tekinti, és örömmel végezzük el.


Feladva: 2016-11-16    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tisztításáttisztításaMakulátlanparkettatakarításaKftTerületablakTisztafelületűeszközökpadlóNagyGarázsIrodaicsíkoskerületKirakattisztításmélyPVC

Forrás: pepitahirdeto.multiapro.com

LAPRA SZERELT IKEA - KIKA - RETZ BÚTOROK ÖSSZEÁLLÍTÁSA 06209884170. Háztartási gépek bekötése, lakásfelszerelési tárgyak felfúrása beton és tégla falra. Egyedi karnis, előszobafogas, gardrób gyártás, meglévő bútorok otthoni javítása.


Feladva: 2016-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: IKEASZERELTbútorokLAPRAEgyediÖSSZEÁLLÍTÁSAfalraRETZtéglaKIKAjavításabetonotthonifelfúrásatárgyakmeglévőlakásfelszerelésiBudapestgyártásbekötése

Forrás: pepitahirdeto.multiapro.com

Eladó bazalt, andezit kockakő új és bontott állapotban. 10x10, 20x20-as méretekben. 4500 Ft/m2 ártól. Érdeklődni telefonon lehet: 06705887417


Feladva: 2017-05-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kockakőBazaltEladólászlóméretekben20x2010x10állapotbanbontott06705887417lehetAndezittelefononÉrdeklődniártólBudapest4500ft

Forrás: pepitahirdeto.multiapro.com

A DXN-nél semmi... Átáll a cég egy másik, mobil barát kinézetre. Hát abba már nem fér bele az a fajta blogolás, amit néhányan annak tartottak. Feltételezhető azonban, hogy van rengeteg normális DXN üzletépítő, akik azért még folytatnák... Nekik fenntartunk egy lehetőséget, amivel a saját DXN oldalukra tudnak látogatókat szerezni. Titok nincs, kereshetőnek kell lenni! (Persze csak annak, aki kereshető akar lenni...) ... további részletek >>


Feladva: 2017-08-16    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: DXNlenniannakblogolásegyhogyajánlófenntartunkwwwazonbanabbaTitokHirdetőNekikFeltételezhetőHátszerezniPepitahtmlfolytatnákakartartottakmég

Forrás: pepitahirdeto.multiapro.com

FŰTÉSKORSZERŰSÍTÉS kondenzációs gázkazán telepítésével, kéménymunkákkal, engedélyeztetéssel, garanciával. Családi ház, lakás, iroda víz, gáz, fűtés tervezési és szerelési és felújítási munkái! CIRKÓ CSERE, kondenzációs, vagy turbós gázkazánra kéményszereléssel, garanciális beüzemeléssel gyorsan! Fűtésszerelés, gázszerelés és tervezés, központi fűtés szerelés, minikazán, radiátor, vízvezeték szerelés, piros plomba ügyintézés, kondenzációs kémény építés!


Feladva: 2017-01-24    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kondenzációsfűtésgázszerelésszerelésFŰTÉSKORSZERŰSÍTÉSvízturbóslakásRózsavagyépítésházközpontiCSEREkéményCsaláditervezésCIRKÓgaranciávalmunkái

Forrás: pepitahirdeto.multiapro.com

Amerikában (Pennsylvania és New York államokban) szállodai és bentlakásos házvezetőnői állások, pároknak és hölgyeknek egyaránt” Leinformálható, megbízható, segítőkész!


Feladva: 2016-09-16    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: LeinformálhatóAmerikábanYorkNew8221PennsylvaniaegyaránthölgyeknekBudapestpároknakKleinállásokMirjamházvezetőnőimunkákbentlakásosszállodaisegítőkész

Forrás: pepitahirdeto.multiapro.com

Nemtudom szilva fa csemete, és magonc milotai10-es diófa csemete eladó. Alanynak és oltásra kiváló.


Feladva: 2017-02-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: csemeteeladóbajcsydiófamilotai10magoncszilvaNemtudomKérsemjénkiválóTótholtásraBarnabasalanynakut10

Forrás: pepitahirdeto.multiapro.com

Jóslás, sorselemzés, párkapcsolat, karrier, pénz, egészség, stb. lelki tanácsadás. Jóslás, döntéshelyzet, elakadás, krízis esetén... Minden nehézségből van kiút, a kártya megmutatja más nézőpontból a dolgokat, megmutatja a helyes irányt. A mágia segíti a pozitív energiák áramlását. Személyes tanácsadás Szegeden, Budapesten és online. Hívjon bizalommal: 308199987 www.joslasszeged.com


Feladva: 2017-06-07    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: JóslássorselemzésmegmutatjatanácsadáskarrierbizalommalmágiaMindenpárkapcsolatHívjonirányteseténonlinehelyeskrízisSzegedBudapestenelakadásBudapest

Forrás: pepitahirdeto.multiapro.com

Quartz Wrist Watch női karóra, fém szíjjal, 2999 ,- Ft Ezüst színű, téglalap, fém óraházzal, 4 db kristállyal, fekete számlappal, elegáns divatos kivitelben. Rozsdamentes acél, fém szíjjal. Quartz szerkezettel, elemmel. Rose gold színű pontjelzéssel és mutatókkal. Méretek : Téglalap számlap 40 x 28 mm, teljes hossz 22.5 cm Érd: 001 6ado@gmail.com Tel.: 70/209-4260


Feladva: 2017-11-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: fémszíjjalQuartzTéglalap2999comkaróra0016ado@gmailnőiÉrdWatchszínűWristEzüstMéretekacélmutatókkalRozsdamentespontjelzésselkivitelben4260209

Forrás: pepitahirdeto.multiapro.com

Budapesti fuvarozó cég megbízható nemzetközi gépkocsivezetőket keres. Választható munkarend, napidíjas rendszer. Feltétel: C+E kategória, GKI sofőrkártya, PÁV. Kezdőket betanítunk. Érdeklődni a megadott telefonszámon, vagy itt üzenetben: www.crosseuropa.hu/hu/jelentkezes- sofornek


Feladva: 2015-11-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: gépkocsivezetőketmunkarendCrosseuropaÉrdeklődniVálaszthatókeresünkbetanítunkkeresKezdőketPÁVnemzetközisofőrkártyamegbízhatóGKIcégkategóriafuvarozó

Forrás: pepitahirdeto.multiapro.com

Ingyen elvihető, vagy esetleg olcsón eladó kályhát keresek, ami még használható! Ingyen elvihető rossz, megunt, kiöregedett műszaki cikket, háztartási gépet is keresek! Szállítást megoldom! Esetleg érdekel még kandalló kályha is, ha olcsón eladó! Budapesten és környékén. Tel: 0670 650 31 68


Feladva: 2017-11-08    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keresekEsetlegelvihetőIngyenkályháteladóolcsónmégmeguntérdekelrossz6500670megoldomTelSzállításthasználhatókörnyékénamiBudapestengépetvagy

Forrás: pepitahirdeto.multiapro.com

Már több éve tagja vagyok egy MLM vállalatnak, de csak lassan tudtam haladni az online munkával. Nem igazán ment. Nem a vállalattal volt a hiba, hiszen láttam, hogy sokan milyen szépen gyarapodnak, haladnak. A DXN tökéletes választás volt. Már közel álltam, hogy kimondjam: ez nem nekem való, nekem nem megy. Kb. másfél hónapja szponzorom megmutatott egy új eszközt, ami segíthet nekem is. Gondoltam, mit veszíthetek, kipróbáltam. Eleinte szkeptikus voltam, de jöttek az eredmények. Egy hónap alatt, ... további részletek >>

többen csatlakoztak hozzánk, mint előtte lévő évben összesen. Felcsillant a remény, hogy ezzel én is tudok eredményesen dolgozni! Nagyon megszerettem ezt az automata eszközt! Így már én is meg tudom csinálni. Csatlakozz a csapatunkhoz, hogy kipróbálhasd Te is ingyenesen magadat és az eszközt! Ha dolgozol, garantált a siker, és ez nagyon jó érzés.


Feladva: 2017-09-29    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmárnekemEgyeszköztvoltNagyonÍgyösszesenközelgarantáltingyeneseneredményekhiszenautomataamivállalatnakévbensikerkipróbálhasdjöttek

Forrás: pepitahirdeto.multiapro.com

Trump megnyittatja a Kennedy-gyilkosság titkos aktáit A rejtély, hogy Oswald volt-e a gyilkos, és ha igen, magányos elkövető volt-e, vagy egy szélesebb összeesküvés része, a mai napig nem oldódott meg. Itt olvashatsz róla: www.goo.gl/FCQvko Itt, pedig tovább kereshetsz (Google keresőnk): www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60546


Feladva: 2017-10-27    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: KennedygyilkosságvoltIttwwwFCQvkopageOswaldmaipedig60546napigtovábbPepitagyilkosnemkereshetszHirdetőigenoldódottGoogleajánlásmagányos

Forrás: pepitahirdeto.multiapro.com

Hogyan kaphat ajándékba egy olyan pénztermelő gépezetet, ami nulláról indulva, alig 29 nap alatt, képes volt 3.748 eurós jövedelmet generálni, miközben emberek tucatjainak tettük egészségesebbé az életét…


Feladva: 2017-08-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8230egészségesenvoltegyéletétvégreképesajándékbaegészségesebbéSzeretnealattkaphatsztettüknapHogyantucatjainakalig8220emberekindulvaJózsef

Forrás: pepitahirdeto.multiapro.com

A kívánság lampion története: Ezeket a papírballonokat repülő lámpásnak, azaz Tiang Deng-nek nevezik, eredete a keleti világban több száz évre nyúlik vissza. Ázsiában a mai napig hagyományosan több ezer ilyen repülőlampiont, azaz kívánság lampiont engednek fel az emberek újév napján, vagy az ismert ”Fullmoon” ünnepeken. Annyi év elteltével még mindig él a szokás, hogy feleresztésekor a belesuttogott, ráírt kívánságok valóra vállnak. Megrendelhető - lásd Honlap alább!


Feladva: 2015-02-18    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: kívánságlampiontöbb8221azazhogykeletinapjánalábbszokáseredeteújévSzegedHonlaphagyományosanmindignevezikemberekLátványPontlásdnapigmégnek

Forrás: pepitahirdeto.multiapro.com

Nem online! Személyes segítség! Azonnali társtalálás megbízhatóan általam. Diplomások, Vállalkozók, jó társaság! Azonnali Társközvetítés · 23-96 év közöttieknek Férjet? Feleséget keres? · Hívjon már ma!


Feladva: 2017-07-15    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: Azonnali183FérjetSzemélyesközöttieknekonlineTársközvetítésNemajánlótársaságHirdetőVállalkozókPepitamárDiplomásokIrodájaHívjonáltalamTárskereső

Forrás: pepitahirdeto.multiapro.com

Kutyakozmetika, kutyakozmetikus. Szeretettel várjuk Önt és kedves kutyáját kozmetikánkban. Kedvence részese lehet az Ön igénye szerint egy fürdetésben és egy nyírásban. Telefonos időpont egyeztetéssel.


Feladva: 2015-08-25    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: XIIIegyKutyakozmetikakerületegyeztetésselrészesekutyájátidőpontKedvencekedvesTelefonoskozmetikánkbanönttartástalálhatóvárjukNyitvaalattnyírásban

Forrás: pepitahirdeto.multiapro.com

Cégünk széleskörű költöztetési illetve áruszállítási szolgáltatásokat kínál Szegeden és vidéken is. Ha nem talál igényeinek megfelelő szolgáltatást, kérjük lépjen kapcsolatba velünk, hiszen minden ügyfél fontos számunkra és igyekszünk minden elvárásnak megfelelni. Áru, bútorszállítás Nehéz tárgyak szállítása Házhozszállítás Költöztetés Szegeden és az ország bármely területén (magánszemélyek illetve cégek részére) www.ruzsatrans.hu +3630/799-0512


Feladva: 2016-11-06    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: illetvemindenSzegedenszegedKöltöztetésRúzsacégekkínálNehézTransvelünkszolgáltatásokatbútorszállításkapcsolatbamagánszemélyekáruszállításiÁrulépjen

Forrás: pepitahirdeto.multiapro.com

Tűzifa? Szén? Szilárd tüzelő? Ha tűzifára (ömlesztett köbméterben, vagy mázsára), vagy szénre (lengyel feketeszén, cseh barnaszén, német brikett) van szüksége, hívjon bennünket! A tüzelő kiszállításán kívül vállaljuk a behordást, illetve megbeszélés alapján a tűzifa felrakását (sliht) is.


Feladva: 2016-11-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tűzifaSzéntüzelővagynémetSzilárdbehordástbarnaszénvállaljukcsehBudapestkívülfeketeszénGáborkiszállításánlengyelFeketeszénreSZÁLLÍTÁSslihtvan

Forrás: pepitahirdeto.multiapro.com

Németországba keresünk fizikai betanított munkára férfi, női dolgozókat. Német nyelvtudás szükséges, jó kereseti lehetőség. Fényképes önéletrajzát várjuk i jckft.hr@gmail.com címre.


Feladva: 2016-02-24    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: betanítottfizikaivárjukmunkáramunkaönéletrajzátNémetországiFényképeslehetőségkeresünkkeresetiNémetországbaszükségesZalaegerszegnyelvtudásKftcímre

Forrás: pepitahirdeto.multiapro.com

Kimerít a mindennapos rohanás? Vagy fásulttá tesznek a szürke hétköznapok? Már régen érezted szeretve magadat? Ha olyan masszázsra vágysz, ahol érzed, hogy szeretettel vagy érintve, akkor jó helyen jársz :) Ebben az órahosszában a figyelmem csak a tiéd, aminek hatására teljesen kipihentnek, ellazultnak fogod érezni magadat. A relaxált állapot már önmagában is beindítja a szervezet regeneráló folyamatait, aminek hatására gyógyulások mennek végbe a legkülönbözőbb területeken. Ezt ... további részletek >>

még fokozhatjuk azzal, hogy a kezelés elején immunerősítő energiákat indítok el, ami a masszírozás ideje alatt végig dolgozik a test izmaiban, sejtjeiben. Aki erre vágyik, szívesen jön vissza újra és újra és újra ... Ha kipróbálnád Te is, szeretettel várlak Kecskeméten a Széchenyivárosban csendes környezetben. www.egeszseg-wellness.hu/masszazsok


Feladva: 2017-07-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: újravagymárszeretettelmagadathatásárahogyaminekvégigfogodKutiazzalakkorvisszafolyamataithétköznapokalattellazultnakmasszázsfokozhatjukérintve

Forrás: pepitahirdeto.multiapro.com

Márványcsiszolás, mészkőcsiszolás, gránitcsiszolás, terrazzocsiszolás, grescsiszolás, betoncsiszolás, műkőcsiszolás, cement anyagok csiszolása Magyarországon, Romániában, Szlovákiában, Horvátországban, Németországban, és Ausztriában. www.everfloor.hu +3630/298-4353


Feladva: 2017-04-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: mészkőcsiszolásRomániábanMárványcsiszolás4353MagyarországonKatalin298csiszolásaNagy3630anyagokPadlócsiszoláseverfloorcementwwwműkőcsiszoláshttp

Forrás: pepitahirdeto.multiapro.com

Legújabb digitális festékrétegmérő készülékünk az elmatronic F/NF HANDY. Nagyméretű LCD kijelzője könnyedén leolvasható, sőt a FLIP DISPLAY szolgáltatásnak köszönhetően az LCD kijelzőn megjelenő információk egy gombnyomással 180 fokban megfordíthatóak. Így a mérési eredmények minden esetben kényelmesen olvashatóak. Beépített mérőszonda, automatikus alapanyag felismeréssel. Gyors mérési sebesség, rendkívül egyszerű kalibrálás! 1 évgarancia! Magyar nyelvű használati útmutató! Áfás számla! ... további részletek >>

Szállítás raktárról azonnal! Ár: 49.000.-Ft Bruttó! Honlap: www.elmatronic.webnode.hu/products/elmatronic-f-nf-handy-digitalis-retegmero-keszulek


Feladva: 2017-02-26    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elmatronichandyLCDmérésifestékrétegmérődigitáliskeszulekdigitalisesetbenSzállításkijelzőnsebességkészülékünkmindenszámlaeredményekÁfásköszönhetően

Forrás: pepitahirdeto.multiapro.com

Használtruha Nagykereskedésünk, az originál bálás használt ruha, valamint a minőségi válogatott használt ruha kollekciójával várja kedves vásárlóit. Nyári bálás ruha kínálatunk: vegyes ruha bála, felnőttruha bála, gyerek ruhabála, szabadidős jogging bála, Holland lakástextil és ágynemű bála, valamint Német munkásruha bála. Válogatott Angol ruházat 1.osztály, Extra és Krém minőségben a legjobb áron! Termékeink tartalma: szezonális, divatos és márkás ruha, garantált minőségben! Visszavásárlási ... további részletek >>

garancia! Hívjon minket bizalommal! Látogasson el weboldalunkra! Ingyenes házhoz szállítás a hét minden napján! Viber/Tel: 06306995904 Web: www.europanagyker.hupont.hu


Feladva: 2017-05-17    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: bálaruhahasználtruhaVálogatottbálásvalamintNagykerminőségbenAngoldivatoshttpgyerekLátogassonszezonálisminőségiWebfelnőttruhabizalommaltartalma

Forrás: pepitahirdeto.multiapro.com

A bevásárlóközpontok, plázák, mallok világszerte méltán népszerűek... Olyan igényt elégítenek ki, amivel mindenki nyer! Magyarországon is jelentősen növekedik az e-kereskedelem. Számtalan webáruházat találhatunk, jót is és kevésbé jót is... Azoknak a kereskedőknek figyelmére mindenképpen számítunk, akik már megtapasztalták a saját webhelyeiken nem csak az éppen hatályos jogszabályoknak kell megfelelni, hanem folyamatosan karban kell tartani a webhelyet, annak az elérhetőségét, különben a ... további részletek >>

látogatottság, vele együtt az üzleti eredmény is elmarad. Azok figyelmére is számítunk, akik (esetleg földrajzi adottságaik miatt?) fejlődésre csak az interneten keresztül számíthatnak. Internetes kereskedelemről van szó, pláza szerű webes környezetben! Nem feltétlenül mindenki alkalmas azonnal árusítani termékét, interneten forgalmazható szolgáltatását. Ismerjük meg egymást! Ön tudni szeretné, hogy miképp lehet kereskedő webplázánkban, mi pedig azt, hogy Ön milyen gyakorlattal (ismeretekkel) rendelkezik már az internetes kereskedelemben, milyen árucikkeket, termékcsoportokat forgalmazna. Ezen a helyen biztonságosan üzenetet küldhet, egy rövid bemutatkozást, cégismertetőt kérünk! Ha van webhelye, kérjük írja meg webcímét is! Minden olvasónak köszönet az érdeklődésért, az üzenetekre a legrövidebb időn belül válaszolunk!


Feladva: 2017-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: márNemhogyjótvaninternetenakikesetlegmilyenplázaszámítunkfigyelméreinternetesmegkellMagyarországonmindenkicsakkérjükegymástüzletinyeridőn

Forrás: pepitahirdeto.multiapro.com

Tudtad, hogy 2016-tól a Gördeszka Olimpiai sportág? Végre :) Most meg tudod mutatni, ki vagy. Tanulj a Legmagasabb szintű módszerrel. Kerüld az ”utcán haveroktól v. önállóan megtanulom” elvet. Hacsak nem akarod, hogy 30 éves korodra széthulljanak az ízületeid, ínszalagjaid, csontjaid. A sikered 100%-ig attól függ: - ki az oktatód - milyen a technikai-módszer Őrizd meg az egészséged. Legyél Pro deszkás. Tanulj a Legjobb módszerrel. Juss ki akár a 2020-as Olimpiára. ... további részletek >>

Teljesen kezdő vagy? Rémület fog el, ha az esésekre gondolsz? 1) 90 perc alatt 2) Teljesen a Nulláról 3) Alap szinten 4) Stabilan 5) Baleset nélkül, esés-mentesen megtanítunk gördeszkázni.


Feladva: 2017-07-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: 8221meg2020TeljesenakárJussGördeszkamódszerrelhogyTanuljvagyLegyéltudodsikeredPepitaszintenkezdőelvetegészségedMostcsontjaidOlimpiaAlap

Forrás: pepitahirdeto.multiapro.com

Folyamatos bélyeg vásár - Garantáltan a leírt állapotban! Folyamatosan színvonalas tételsorra licitálhat, mindezt otthonról, kényelmesen. Évtizedes tapasztalat - Online árverés kéthetente Aloldalaink: Eladóknak | Webshop | Aukciók


Feladva: 2017-07-12    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: vásárbélyegFolyamatosEladóknaktételsorraPepitaAloldalainkszínvonalaskéthetenteFolyamatosanárverésállapotbanOnlineleírttapasztalatGarantáltanÉvtizedes

Forrás: pepitahirdeto.multiapro.com

A vizsgálatok eredményei szerint a propolisz csepp sok különböző vírus- és baktérium ellen fejt ki áldásos hatást. A herpesz, az influenza, a Candida és a körömgomba is ezek közé tartozik, de kimutatták hatékonyságát Staphylococcus és E.coli fertőzés esetén is. A propolisz cseppek a házi patikában mindig jó szolgálatot tesznek, hiszen sérüléseket, sebeket kezelhetünk velük, felhasználhatjuk bőrápoláshoz és a megfázás tüneteitől is hamar megszabadulhatunk, ha elkezdjük fogyasztani. Nem beszélve ... további részletek >>

arról, hogy természetes immunerősítő hatásával a megelőzésben is segítségünkre lesz. Minősített propolisz csepp vásárlás webáruházunkban!


Feladva: 2016-10-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: propoliszcseppCandidaarrólszerintvelükeseténinfluenzabeszélveeredményeikezelhetünkfertőzésherpeszNemvizsgálatoksebeketMinősítettcolihatástlesz

Forrás: pepitahirdeto.multiapro.com

Szeretettel várunk minden négylábú barátunkat! Egyszerre 3 kistestű és 1 nagytestű kutya gondozását, foglalkoztatását és elszállásolását tudjuk vállalni.


Feladva: 2017-09-23    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: vállalninégylábúCSIMAbarátunkatTANYAEgyszerreKutyapanziókistestűPepitanagytestűHirdetőkutyaajánlógondozásátVérteskethelyfoglalkoztatásátSzeretettel

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés a Konténer Gurutól telefonon és emailben is lehetséges! Hívás előtt az egyik legfontosabb kérdés, hogy hova szeretné elhelyezni a konténert! Vizsgálja meg, hogy befér-e a kapuján vagy csak az utcán marad-e hely a lerakásához. Ez utóbbi esetben ugyansi lehet, hogy területfoglalási engedélyre lesz szükség, ami módosíthatja a leszállítás időpontját. A konténer rendelés a főváros valamennyi kerületébe és Pest megye több településére is lehetséges még hétvégén is. Ha lomtalanítást ... további részletek >>

tervez, hívjon még ma, hogy a feleslegessé vált holmik ne az út szélén végezzék! Kérdések és válaszok konténer rendelés előtt weboldalunkon!


Feladva: 2017-08-16    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: konténerhogyrendelésméglehetségeselőtttervezkonténertidőpontjátKittiválaszokutóbbilomtalanítástelhelyeznileszállításKellérKérdéseklerakásáhozami

Forrás: pepitahirdeto.multiapro.com

IFETCH - az igazi szórakozás Önnek és kutyájának! Újdonság a kutyajátékok piacán!! www.petsafe.hu/hu/ifetch-labdakilo vo/444-ifetch-labdakilovo-kutyaknak .html


Feladva: 2016-01-05    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: ifetchkutyajátékokÚjdonságkutyájánakhtmlÖnnekkutyaknakszórakozáslabdakilovigaziPápa418KftpetsafeTradinghttpWilsonpiacánkutyajáték

Forrás: pepitahirdeto.multiapro.com

Örömmel adom tudtodra, kedves verskedvelő olvasóm, hogy az 1 kép 1 vers oldalamon található verseim első négy kötete megjelent. (2.350 Ft/kötet + 1.000 Ft szállítási költség) Országosan megrendelhető. Várom megrendelését! Facebook-on is: facebook.com/versakephez


Feladva: 2015-09-30    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: verseskönyvekköteteverskedvelőhttpnégykedvesWebáruházelsőtudtodramegrendelésétverseimadomVáromtalálhatóÖrömmelköltségoldalamonDunakeszivers

Forrás: pepitahirdeto.multiapro.com

Hogy miért? Regisztrációkor leadott első 100 PV pontot meghaladó rendelésnél a következő AJÁNDÉKOKBA részesül: - 1 doboz ganodermás müzli - 1 doboz ganodermás fogkrém - Ingyenes regisztrációs díj - Ingyenes kiszállítás Ezen ajándékok értéke: 11.660,- Ft Legyen törzsvásárlónk


Feladva: 2017-05-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ganodermásdobozIngyenesfogkrémelsőtörzsvásárlóitörzsvásárlónkleadottExcelLegyenRegisztrációkorGano660müzlimiértregisztrálniértékerészesülHogy

Forrás: pepitahirdeto.multiapro.com

Non-stop bútorszállítás, költöztetés, lomtalanítás! Ügyfeleink időbeosztásához rugalmasan igazodunk, hétvégén és éjszaka is dolgozunk, telefonon a nap minden órájában elérhetőek vagyunk! Több éves tapasztalattal, jó referenciákkal, gyors és pontos munkavégzéssel hétvégén is hétköznapi árakon állunk rendelkezésükre! Igény szerint csomagolunk csomagolóanyagot kiszállítunk, szerelést is vállalunk! Tel: +36 70 2353403


Feladva: 2017-02-20    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: költöztetéshétvégénmindenbútorszállításcsomagolunkBudapestreferenciákkaléjszakaszerintCsacsitransztapasztalattaligazodunkIgénynapjánévesrugalmasanhét

Forrás: pepitahirdeto.multiapro.com

CNC állásuk van Németországban! Szerződött német partnerünk (NEM Zeitfirma) részére Mannheim közelében keresünk CNC-st aki CNC Abkanter (élhajlítógép) gépen szakrajzról tud nagyon precízen dolgozni. A feladat a CNC élhajlítógép (Trumpf) beállítása és kezelése. A munkához legalább A2-B1 némettudás szükséges. Hosszú távú munkalehetőség! (A család pár hónap utáni kiköltözését a munkáltató segíti és támogatja.) Próbamunka ideje alatt a szállás ingyen van. Sikeres próbamunka után szerződés a ... további részletek >>

céggel, szállás megoldott, kb. 300€/hó. Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1.) E-mailben: info@nemetmunka.hu 2.) Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3.) Telefonon munkaidőben a magyar 06 1 920 3433, ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9.00-17.00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-10-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: CNCnémetvagyszállásTeamMunkamailbenpróbamunkanemetmunkavanwwwélhajlítógépTelefononmegoldottdolgozni000támogatjarészéreújbólikövetkezőPersonal

Forrás: pepitahirdeto.multiapro.com

Vattacukor készítő gépek - Új/Gyáriak (USA Design) - átlátszó plexi szélvédő burával, (Professional candy floss machine) + kétkerekű kocsival szerelten (kordé), vagy asztali változatban ELADÓK - MEGRENDELHETŐK! A Vattacukor gépek ELEKTROMOS (Electric) és GÁZOS (PB Gas) fűtéssel választhatóak! Kiemelkedően profi gasztronómiai használat, és gyári design! E-mail címre tájékoztatót, és képeket küldök! Az értékesítés Pro-Forma számlával történik! ... további részletek >>


Feladva: 2017-04-30    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: ELADÓKdesigngépekVattacukorMEGRENDELHETŐKProcandyprofiWAYértékesítésProfessionalKiemelkedőenGOLDENváltozatbanküldökburávalválaszthatóakasztaliGas

Forrás: pepitahirdeto.multiapro.com

Budapestiek figyelem! Ha szeretne egy csendes kisvárosban élni, vagy nyaralót venni, itt a lehetőség! Gyomaendrődön, a vizek városában, 20 m-re a holtághoz közel - ami intenzíven telepített (harcsák, amurok, pontyok és más ragadozó halak vannak) 80 nm-es ház eladó. Az ingatlan a 60-as években épült, vegyes a falazata tégla, illetve vályog 50 cm-es falvastagsággal. Nyáron hűvös, télen meleg... Nem repedezett, penészes, 2006-ban nyílászáró csere, burkolás, festés és háromfázisú áram ... további részletek >>

lett bevezetve. Az udvari rész 1400 nm, melyben sok gyümölcsfa, alsó épület, garázs található. Családoknak is ajánlom, CSOK igénybe vehető. Az ingatlan per és teher mentes. Nos kíváncsiak, hogy mennyi az ára? Bútorral is eladó 10 millió forint, bútor nélkül 9 millió forint. Komoly érdeklődés esetén az árból engedek!


Feladva: 2017-09-11    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóvárosábanvizekingatlanházmennyi2006holtághozárbólajánlomilletvekisvárosbanudvarihalakbútorralhogypenészes20mengedekcsaládoknaktéglaegy

Forrás: pepitahirdeto.multiapro.com

INGYENES Elme Tréner szoftver! Toppon Leszel! Egy nagyszerű eszköz az önfejlesztéshez, ami segít a tudatalattid hatékony átprogramozásában. Változtatni sohasem késő, kezd el most, ezzel az ingyenes szoftverrel! Bővebb információ a weboldalon, ahol például láthatsz egy nagyon jó videót, ami bemutatja azt a folyamatot, hogy mi játszódik le az agyadban, amikor szabotálod a sikereidet!: www.topponleszel.com/tudatalatti-u zenetek-mukodese


Feladva: 2017-04-03    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: ingyenesszoftverTrénerElmeszoftverrelsegítönfejlesztőamiezzelönfejlesztéshezmosteszközkezdnagyszerűcomkésőEgytopponleszelsohasemLeszelhttp

Forrás: pepitahirdeto.multiapro.com

Munkatársakat keresek vásárlói közösségbe, azonnali kezdéssel interneten vagy katalógusból ajánlással történő munkára! Nincs kötelező havi vásárlási kényszer. Fő és mellékállásban is végezhető, rugalmas időbeosztásban! Csak egy számítógép vagy okostelefon kell hozzá! A bevételed a befektetett munkával arányosan növekszik! Sokan el sem tudják képzelni, hogy átlag fizetésnél többet vigyenek haza, pedig ez lehetséges csak jó helyen kell dolgozni. Ha valós internetes munkát keresel és ... további részletek >>

tényleg szeretnél dolgozni, keress bátran! Írj a üzenetet, vagy regisztrálj a megadott oldalon.


Feladva: 2017-09-14    [Pénzkeresés - MLM]

Címkék, kulcsszavak: vagykellcsakdolgozniregisztráljmunkávalkényszerkereselazonnalitöbbetbefektetettvásárlásimunkátközösségbefizetésnélcímrebevételedhaviinternetes

Forrás: pepitahirdeto.multiapro.com

Akuna Alveo gyógynövények kombinációja, mely több évtizedes kutatómunka eredményeként született meg. Összetett hatásaival bárki egészségi állapotán képes javítani, hiszen kizárólag értékes hatóanyagok találhatók benne. A méregtelenítő Alveo ital fokozza a kiválasztószervek működését, így segíti a szervezet megtisztulását. Hatására a bevitt tápanyagok jobban felszívódnak és intenzívebben érvényesíthetik előnyeiket. Mivel a benne lévő növényi összetevők fokozatosan és kíméletesen hatnak, ... további részletek >>

fogyasztása nem okoz kellemetlen mellékhatásokat a méregtelenítés során. Méregtelenítés Akuna Alveo itallal - rendelés webshopunkban! www.gyogynovenyek.megoldascsomagok.com/akuna-alveo-szolos-950ml


Feladva: 2017-02-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: AlveoAkunaitalméregtelenítőMéregtelenítésbennewebshopunkbanműködésétképesfogyasztásatöbbintenzívebbenrendeléskiválasztószervekállapotánhatnakmely

Forrás: pepitahirdeto.multiapro.com

Sok problémát jelent gyereknek és szülőnek egyaránt, ha egy gyerek valamely sajátosságát későn fedezik fel. Ilyenkor sok munka lehet helyre tenni azt, ami egy korai felfedezés után esetleg néhány hónap aktív mozgásfejlesztésével korrigálható lett volna. Az ilyen sajátosság korai szenzomotoros szűréssel időben felfedezhető. A Jutalom Vagyok projekt keretében gyermekek csoportos vizsgálatát kínáljuk intézményeknek, óvodáknak, bölcsődéknek és családi napköziknek olyan módon, hogy a jelenlétünket ... további részletek >>

szinte észre se vegyék...


Feladva: 2016-08-02    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: koraisokszenzomotorosegyintézményeknekjelentészreesetlegvizsgálatátIlyenkorproblémáthogyutáncsoportosfelBudaörssajátosságjelenlétünketfelfedezés

Forrás: pepitahirdeto.multiapro.com

New Yorkban játszódik a történet, amelynek főszereplője Kyra, egy doktornő, aki meddősége miatt nem alakít ki tartós kapcsolatot senkivel. Van rá oka: már érte emiatt csalódás. Ám ez az állapot sem tarthat a végtelenségig és egyszer csak találkozik azzal a férfival, aki minden nő álma. Ő azonban továbbra is titkolja meddőségét, ám egy idő után ez a helyzet fenntarthatatlanná válik... www.adamobooks.com/termek-A-sors-i roniaja-86.html


Feladva: 2016-09-29    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: adamobooksakiegysorscomtarthattartósazonbanYorkbansemhttpalakítálmaNewállapotváliknemmindenBudapestcsalódásfenntarthatatlannámiattemiatt

Forrás: pepitahirdeto.multiapro.com

Szeretettel várok minden új és régi vendégemet újonnan nyílt szalonban :) Bejelentkezni ezen a telefonszámon tudtok : +36 70 626 1434


Feladva: 2017-09-28    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: régi1434minden626vároktudtokSzeretetteltelefonszámonBudapestezenÉvaBejelentkezniGázerszalonbanVicuskutyakozmetikanyíltújonnanvendégemet

Forrás: pepitahirdeto.multiapro.com

Férfi és női takarítókat keresek. Budaörsre napi iroda takarításra 18 órai kezdettel minden hétköznap. Férfi munkaerőt keresek Budapestre és Budaörsre külön-külön, külső takarítási munkálatokra.


Feladva: 2017-09-04    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresekFérfikülönBudaörsretakarítókatcsomádKrisztinahétköznapSzigetimindenmunkálatokrakezdetteltakarításióraikülsőtakarításrairodanapiBudapestre

Forrás: pepitahirdeto.multiapro.com

Fogyni szeretnél? Hogyan tudnál a leghatékonyabban lefogyni úgy, hogy a kilók ne kússzanak vissza? A weboldalon megismerheted azokat a technikákat, amelyek segítenek a fogyást akadályozó lelki okok megszüntetésre. Bízom abban, hogy Te is könnyen megtalálhatod azt, ami segíthet végre beindítani a fogyást. A lelki okok megszüntetésére és a stressz oldására nagyon egyszerű módszereket találsz. www.blog.topponleszel.com/fogyokur a-2


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: okoklelkifogyásthogyakadályozóamitechnikákatnagyonHogyanaztazokatoldásáraszeretnélmegtalálhatodmegismerhetedstresszFogynikönnyenfogyokuraTréner

Forrás: pepitahirdeto.multiapro.com

Kérjük, hogy támogassák alapítványunkat, és így együtt segíthetünk azoknak, akiknek a lakhatása veszélybe került, vagy máris hajléktalanok. Ezzel hozzájárulhatunk emberi életfeltételeik minimumának megteremtéséhez. Köszönjük az utalást, megosztást és mindenféle segítő felajánlást! Erre az OTP számlaszámra várjuk a felajánlásokat: 11707000-20490166 (IBAN): HU73 1170 7000 2049 0166 0000 0000 SWIFT kód OTPVHUHB Adószám: 18739196-1-42


Feladva: 2016-10-29    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: 0000SzívNyugodtKöszönjükkódveszélybefelajánlásokatMagyarországmegteremtéséhezSWIFTlakhatásavárjukajánlóminimumánakakiknekszámlaszámraHirdető0166

Forrás: pepitahirdeto.multiapro.com

Elege van a magas közös költségből? Szeretné csökkenteni kiadásait? Válassza az AXA Trend Kft. szolgáltatását! Professzionális társasházkezelés; közös képviselet; társasházak és lakásszövetkezetek jogi képviselete; könyvelés; könyvvizsgálat! Amennyiben az Ön társasháza – közgyűlési határozat alapján – szerződést köt az AXA Trend Kft. társasházkezelővel, a társasház közös képviseletére, akár 10%-al csökkenthetjük a közös költséget.


Feladva: 2015-10-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: közösKftTrendAXA8211társasházkezelésProfesszionálistársasháztársasházaszolgáltatásáttársasházkezelővelAmennyibenVálasszakönyvvizsgálatkiadásaitSzeretné

Forrás: pepitahirdeto.multiapro.com

GKI képzés és vizsga RÉSZLETFIZETÉSI LEHETŐSÉGGEL! Ingyenes tananyagot biztosítunk! Korábbi GKI igazolvánnyal rendelkezők esetén 59.900 Ft/fő. Ne maradjon le róla! Tel.: 0620-248-6818; www.fuvinfoiroda.hu/tanfolyamok/ke pzesek-gepjarmuvezetok-reszere/gki- soforoknek


Feladva: 2017-04-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: GKImájusvizsgatananyagot248képzésünkreIngyenes0620LEHETŐSÉGGELTelindulóRÉSZLETFIZETÉSIrólaJelentkezzenmaradjon900képzéshétfőeseténBudapestwww

Forrás: pepitahirdeto.multiapro.com

Kampány, hirdetés, figyelem felhívás egy helyen, saját beállítási panellel! Legyen jelen több, mint 3550 különböző weboldalon egyszerre! Érjen el több tízezer értékelhető megjelenést alkalmanként! Már 2.000 Ft-tal is létrehozhatja első kampányát...


Feladva: 2016-03-17    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: eszközökkelpanellel000PepitaLegyentalHirdetőjelenlétrehozhatjaKampány3400kampányáthirdetéskülönbözőfigyelemweboldalonfelhívástöbbegytízezer

Forrás: pepitahirdeto.multiapro.com

Az álmok jelentése a legtöbb embert érdekli. A tudomány sem cáfolja azt a nézőpontot, miszerint álmunkban legbensőbb világunk jelenik meg, félelmeink, vágyaink, reményeink vetülnek ki különböző fantáziákba szőve. Az álom működése azonban még ma sincs teljesen megfejtve. Hogy mit üzennek, gyakran csak találgatni tudjuk, máskor pedig egészen egyértelmű, hogy a napközben átélt helyzeteket dolgozzuk fel általuk. Az álmok megfejtése napjainkra egyfajta “tudományággá” vált, sokszor ... további részletek >>

segítségül hívhatjuk a különböző lelki problémák, konfliktus- és stresszhelyzetek feldolgozásához.


Feladva: 2016-11-08    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: jelentéseálomhogykülönbözőmégálmoktudjuksegítségülműködésefelálmunkbantalálgatniKittisokszordolgozzukmiszerintcsakKellérváltszővehelyzeteket

Forrás: pepitahirdeto.multiapro.com

Egy világméretű üzletet már ellehet kezdeni 15.000 forinttal! Te szeretnél pénzt keresni, vagy még dolgozni akarsz apró pénzért? Ez egy vásárlói közösség. Ha tovább ajánlod a kártyát, milliós jövedelmed származik abból is. A lehetőség korlátlan, te döntöd el mit választasz a pénz kereset szempontjából, 12 féle lehetőség közül választhatsz!!!! Skype: kollar.klara a további információ itt: www.forevergreen.cafeblog.hu/2017/ 09/27/van-egy-jo-munka-en-ezt-megle ptem


Feladva: 2017-09-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: egylehetőségmárüzletetvilágméretűforinttal000kezdeniellehetszármazikakarszjövedelmeddolgoznifélemilliósmégszempontjábólkártyátittvagykereset

Forrás: pepitahirdeto.multiapro.com

Építés, felújítás, kőműves munka terén biztosan számíthat ránk. Az Épelem Bau Kft vállalja minden építés, felújítás és kőműves munkával kapcsolatos feladatot, akár kulcsrakészen, akár rész munkafázisként. A cég több mint 12 éve panaszmentesen működik, a minőség pontosság és megbízhatóság jegyében. Kérjük látogasson a www.epelembau.hu honlapunkra. Köszönjük megtisztelő bizalmát!


Feladva: 2016-10-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kőművesfelújításépítésÉpelemmunkaKftakárBaukulcsrakészenmegtisztelőminőségfeladatotKöszönjükránkműködikkapcsolatoshonlapunkraszámíthatmunkával

Forrás: pepitahirdeto.multiapro.com

A Bujdigép Kft. 2004-től biztosít nagyteljesítményű munkagépeket kis- és nagyberuházásokhoz Szegeden, Csongrád megyében és országosan. Béreljen földmunkagépeket, autódarukat, emelőgépeket a Bujdigép Kft.-től. Makó, Kiskunhalas, Baja, Mórahalom, Kistelek, Hódmezővásárhely térségében biztosítunk munkagépeket kis- és nagyberuházásokhoz.


Feladva: 2016-06-13    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: nagyberuházásokhoztőlkisKftmunkagépeketBujdigépMakóSzegedennagyteljesítményűbiztosít2004biztosítunkemelőgépeketSzegedtérségébenautódarukatAnderass

Forrás: pepitahirdeto.multiapro.com

Olcsó árak! Huawei Mate, Honor, Asus Zenfone, Asus Pegasus, Lenovo A, Lenovo Vibe, LeTv Le Eco, Mezu M, UleFone, UMI, Vernee Thor, Vernee Apollo, VKworld T1, VKworld G1, VKworld T3, Xiaomi Note, Xiaomi Redmi, Xiaomi MI. Minden egy helyen, minden a legjobb helyen.


Feladva: 2017-11-07    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: XiaomiVKworldLenovoAsusVerneemindenhelyenárakegyEcoOlcsóLeTvajánlásRedmiVibeHirdetőNotePepitaPegasusmobilApolloKínaiZenfoneThorHonor

Forrás: pepitahirdeto.multiapro.com

Neked már fizetett valaki azért, hogy kávét iszol? És szeretnéd, hogy fizessenek? Ha igen, jelentkezz a weboldalon: www.fekete.egeszsegeskave.hu/uzlet i_lehetoseg


Feladva: 2013-07-07    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyszeretnédpénztlehetosegiszolKeressuzletikávétKávézolegeszsegeskaveazértfeketevalakihttpfizetettweboldalonmárjelentkezzNekedigenErzsébet

Forrás: pepitahirdeto.multiapro.com

Mosógépjavítás, Mosógépszerelő, Érd, Diósd, Tárnok, Törökbálint, Budaörs, Budafok, Budatétény, Nagytétény, XXII, Gazdagrét, Őrmező, XI. 06/20-5477129 Mosogatógép javítás, mosógépjavítás: AEG, ARDO, ARISTON, BOSCH, BEKO, SIEMENS, ELECTROLUX, ZANUSSI, WHIRLPOOL, LG, INDESIT, SAMSUNG


Feladva: 2017-08-30    [Lakossági szolgáltatás]

Címkék, kulcsszavak: DiósdMosógépszerelőBudafokBudaörsmosógépjavításTörökbálintZANUSSI5477129ÉrdELECTROLUXŐrmezőSIEMENSGazdagrétMarkBEKOXXIIBOSCHNagytétényARISTON

Forrás: pepitahirdeto.multiapro.com

1991 óta működő faipari cég garanciával vállalja, egyedi igények szerinti konyha, szoba, gyerekszoba, fürdőszobabútorok, polcrendszerek, beépített szekrények, valamint irodabútorok, egyedi bútorok készítését, és különféle asztalos munkákat. Bemutatótermünkben rendelkezésre állnak anyagminták, melyekből kiválaszthatja az ön által elképzelt egyedi kialakítású bútorát, valamint a webáruházunkban forgalmazott bútorainkból néhány darabot.


Feladva: 2015-11-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: egyediKoránvalamintbútorát1991munkákatszobakialakításúkftasztaloskonyhaKereskedelmikülönféleszerintielképzeltBútorkészítőkészítésétigényekáltal

Forrás: pepitahirdeto.multiapro.com

Dunaharaszti, Gyál, Ócsa, Szigethalom, Érd, Budaörs, Törökbálint, Taksony, Szigetszentmiklós, Halásztelek térségébe szolgálatvezetőt keresünk aktív szolgálat vezetésére, szolgálati feladatok ellátásra, csak nappalra és munkanapokra, bejelentve, főállásban, nettó 750 Ft/óra bérezéssel. Jelentkezni lehet önéletrajzzal a bi.technika@gmail.com e-mail címre a térség megjelölésével.


Feladva: 2017-09-08    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: szolgálattérségSzigethalomnettóaktívcímreÓcsafőállásbankeresünkmailGyálbejelentveszolgálatvezetőtcomDunaharasztimunkanapokratérségébetechnika@gmail

Forrás: pepitahirdeto.multiapro.com

Betűvésés Budapest. Szimbolikus és spirituális faragott és fényezett kő dísztárgyak. Garantáltan egyedi kézműves alkotások Dunai görgetek kövekből! Hozhatja a saját kövét is!


Feladva: 2016-04-24    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: BudapestDunaiGarantáltandísztárgyakkövétfényezettsajátfaragottHozhatjaspirituáliskövekbőlSzimbolikusgörgetekBetűvésésalkotásokViktorkézműveskövek

Forrás: pepitahirdeto.multiapro.com

A mosott kavics 16-32 ára bruttó 4200 Ft/m3. A folyami kavics 16-32 ára bruttó 4200 Ft/m3. A dunai kavics 16-32 ára bruttó 4200 Ft/m3. A dísz kavics ára bruttó 5842 Ft/m3. A gyöngy kavics ára bruttó 5842 Ft/m3. Az osztályozott kavics ára bruttó 5842 Ft/m3. A rostált kavics ára bruttó 5842 Ft/m3. A bánya kavics ára bruttó 3500 Ft/m3. A töltő kavics ára bruttó 3000 Ft/m3. A mosott dunai folyami kavics 24-40 kerti utak, parkok lefedésére, a rostált osztályozott dísz kavics 16-32 ... további részletek >>

lábazatok díszítéséhez, szikkasztóhoz, a gyöngy kavics 4-8 és a gyöngy kavics 8-16 parkok, játszóterek lefedésére, a bánya és a töltő kavics terület feltöltésre, szerelő beton alá használható. A mosott kavics, osztályozott kavics, dísz kavics, gyöngy kavics, kulé kavics, rostált kavics, töltő kavics kapcsán felmerülő kérdéseikre szívesen válaszolunk, e-mail címünk és telefonszámaink honlapunkon megtalálhatóak.


Feladva: 2016-10-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kavicsbruttóáragyöngydíszosztályozottmosott5842rostált4200töltőfolyamidunaikulébányalefedéséreparkokfeltöltésrehonlapunkonszállításterület

Forrás: pepitahirdeto.multiapro.com

Az Ezermester Magyarország legrégibb és legnépszerűbb általános technológiai magazinja. Gépek, szerszámok, technológiák, építés, kert, újdonságok, ötletek. Facebook oldal: www.facebook.com/ezermester.hu


Feladva: 2017-09-11    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: ezermesterfacebookáltalánosoldallegnépszerűbbötleteklegrégibbújdonságokMagyarországkertajánlóépítésHirdetőtechnológiákPepitaszerszámokHobbimagazin

Forrás: pepitahirdeto.multiapro.com

A gránátalma ital hatásai legintenzívebben kúraszerű fogyasztás mellett érezhetők. A természet egyik legerőteljesebb gyümölcsének kivonata számos gyógyhatással rendelkezik, melyet az emberiség évezredek óta ismer és alkalmaz. Hogy mégis mire jó a gránátalma? Legtöbben magas antioxidáns tartalma miatt fordulnak hozzá, melynek révén lassítja az öregedés folyamatát és enyhíti annak látható jeleit. Bőrfeszesítő és hajszépítő hatása legendás. www.granatalma.bolt.hu/granatalma- hatasa


Feladva: 2016-08-31    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: granatalmagránátalmabolthatásaialkalmazBőrfeszesítőlegerőteljesebbfordulnakélettaniismerjeleitegyikmiattótaláthatótermészettartalmaévezredekannak

Forrás: pepitahirdeto.multiapro.com

Válogasson a Galaxy Játékáruház távirányítós játékai közül! A gyerekek életkorának megfelelő játékok különböző árkategóriákban. www.galaxyjatekaruhaz.hu/59-tavira nyitos-jarmuvek


Feladva: 2017-07-01    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: carrerahelikopterhelicoptermicrotávirányítóstaviranyitosgalaxyjatekaruhazméregzsákcsöppségetcsomagbólwwwindítsdjátszaniajánlottigazitávirányítóbahtml

Forrás: pepitahirdeto.multiapro.com

Fürjtápot keres? Nálunk az is van: 159,- Ft/kg A holland De Heus takarmányokat már Magyarországon is megvásárolhatja. Kiváló minőség és széles áruválaszték jellemzi. A fürjtáptól a lótápokig minden állatfajnak tudunk tápot biztosítani. Kiszállítás megoldott, viszonteladókat is kiszolgálunk.


Feladva: 2017-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: keresKiszállításKiválóFürjtápottápotmegoldottmegvásárolhatjaPadragkúttudunkviszonteladókatMagyarországonAjkaállatfajnakkiszolgálunkmárajánlóminden

Forrás: pepitahirdeto.multiapro.com

Gázmegtakarítás 12-15%. Turbo Booster Gázfogyasztás csökkentő. ÁRA FÉL ÉV ALATT MEGTÉRÜL, utána folyamatos megtakarítás! Hivatalos engedéllyel! Bemérések és beszerelési útmutató a honlapunkon! www.patikamagazin.eu/?modul=oldal& tartalom=1205809


Feladva: 2015-11-05    [Vegyes hirdetések]

Címkék, kulcsszavak: GázmegtakarításfolyamatosBudapestmeregtelenitesutánaNEODYUMwwwMEGTÉRÜLhttpALATThonlapunkonFÉLútmutatóÁRAbeszerelésicsökkentőbemérésekGázfogyasztás

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! Van a környezetében, rokoni, baráti, ismerősi körében munkanélküli, közmunkás, kisnyugdíjas, kis jövedelemért sokat dolgozó modern kori rabszolga, vagy aki folyamatosan hitelekből él és nehezére esik befizetni a számlákat? Ezek az emberek példaképek az Ön számára, vonzónak találja az életüket? Biztos benne, hogy Önnek is ezt a forgatókönyvet írta meg az élet, amelyen nem szabad változtatnia? Úgy érzi, hogy a szerencse folyamatosan elkerüli, és hogy Ön mindig a rossz ... további részletek >>

oldalra kerül? Ismer olyan embereket, családokat, akiknek szívesen elfogadná az életszínvonalát? Sokat álmodozik arról, hogy milyen jó lenne, ha Önnek is jobb élete lenne anyagilag? Sokkal egyszerűbb, mint gondolná! Van egy rossz hírem! Most egy életre elveszem Öntől azt a kifogást, hogy soha sincs szerencséje, hogy soha sincs jó időben jó helyen! Van egy jó hírem! Élete legnagyobb lehetősége kopogtat az ajtaján, amelyet sem a múltban nem kaphatott eddig meg, és a jövőben sem fog soha megkapni máshol! Miért különleges ez a lehetőség és miért teljesen más, mint amikkel eddig megkeresték Önt? Nem kell egy fillért sem befizetnie semmire sem, nem kell megvennie felesleges termékeket, szolgáltatásokat, nem kell MLM rendszerben eladnia semmit sem, nem kell külföldiek zsebét tömni, nincsenek vásárlási és egyéb kötelezettségei! Ezzel szemben már az ingyenes regisztrációjánál kap 12.000,- forintot ajándékba, amelyet felhasználhat a mindennapi vásárlásainál, nyereség részesedést kaphat több mint 10.000 kereskedő és szolgáltató forgalmából, Ön kereshet minden külföldi ember mindennapi vásárlásából, számtalan lehetőség közül választhat szabadon, kap egy ingyenes bankszámlát, kap két ajánlói weboldalt, melyeken regisztráció nélkül is minden információ megtalálható, kap egy webirodát, ahol követheti a bevételeit, tanulhat és fejlődhet nem csak üzletileg, hanem emberileg is! Amit garantálni tudok, hogy kizárólag több pénze lehet, kevesebb nem, ez által semmilyen kockázata nincs, és ha más területen tevékenykedik, akkor továbbra is foglalkozhat vele szabadon, ha szereti azt, amit csinál. Továbbá garantálom, hogy minden segítséget megkaphat, amely szükséges lehet ahhoz, hogy megvalósíthassa minden célját és álmát, amelyet elképzelt magának! Túl szépen hangzik? Ha megismer, ennél még sokkal többet is fogok mutatni Önnek! Email: rozsabusiness@gmail.com Kérdéseivel keressen bizalommal!


Feladva: 2017-02-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemegysemmindenkapkellmégSokatsohamintÖnnekamelyetsokkalmiértmáskörnyezetébenamitÉletedolgozóingyenesVannakazthíremjövedelemért

Forrás: pepitahirdeto.multiapro.com

Az arctisztítás új dimenziója Tiszta és ragyogó bőr elérése a ZEITGARD arctisztító segítségével. Az innovatív elektromos arctisztító kefe forradalmasítja a hagyományos arctisztítást. 10-szer hatékonyabban távolítja el a sminket és a szennyeződéseket anélkül, hogy a bőrt túlzottan igénybe venné. Szabadalmi oltalom alatt álló termék minden bőrtípusra! Fedezd fel a ZEITGARD-ot! Nézd meg a videót a honlapon!


Feladva: 2015-12-04    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: 8482MicroSilverarctisztítóelpusztítjasegítségévelkefeszálakbanfokontávolítjaműködikZEITGARDhigiéniamagashatékonyabbanvédőpajzskénteléréseEgyedülálló

Forrás: pepitahirdeto.multiapro.com

Ausztriai és németországi munkára keresek szakembereket. (Néhány esetben nem kell, de a legtöbb esetben valamennyi nyelvtudás szükséges.) Bővebb információ, érdeklődés a teke.eszter@prohuman.hu e-mail címen vagy a 0670 197 5293-as telefonszámon. Betöltendő munkakörök: Autogén csőhegesztők / Asztalos / AWI-CO hegesztő-lakatos / Betonelem gyártó / CNC élhajlító / CNC Esztergályos / CNC Heidenhain programozó / CNC köszörűs (Schleifer) / CNC maró gépbeállító / CNC marós gépkezelő / CNC ... további részletek >>

marós programozó / CNC Trumpf élhajlító gépkezelő / CNC Trumpf lézergépkezelő / CNC Zayer Portálmarós / Co hegesztő + lakatos / Fémszerkezet szerelő / Kapcsolószekrény szerelő / Lakatos, hegesztő / Lézergépkezelő Magyar bejelentés, külföldi kiküldetés.


Feladva: 2017-09-16    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: CNChegesztőLakatosLézergépkezelőélhajlítóesetbenprogramozómarósszerelőtekekülföldiTrumpfgépkezelővagyAWIEsztercímenlegtöbbAsztalosállásmail

Forrás: pepitahirdeto.multiapro.com

2 szoba, 4+3 fő (ágyneműt biztosítunk), nappali+étkező, felszerelt konyha, hűtőszekrény, gáztűzhely, mikrohullámú sütő, kávéfőző, tusolós fürdőszoba, WC, klíma (hűtés-, fűtés), TV, jakuzzi, kandalló (fa díj ellenében biztosítva), füvesített kert, parkoló, 12 nm-es móló+csónak, horgászatra, fürdésre, fedett terasz, hintaágy, kerti bútorok, bográcsozás, grillezés (tűzifát igény esetén biztosítok!), gyerekeknek homokozó, lengőteke, fürdőmedence bérlési lehetőség, 3db kerékpár is biztosított!


Feladva: 2016-07-20    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kandallóbiztosítokhűtőszekrényfürdésreKöröspartihorgászlakjakuzzieseténkonyhahorgászatrabiztosítottfűtésigényfelszereltcsónakkerékpárhűtéstűzifát

Forrás: pepitahirdeto.multiapro.com

Klasszikus és modern olasz konyhabútorok nagy elemválasztékával várja Önt a Lineaflex Olasz Bútoráruház és Ágybetét Stúdió.


Feladva: 2016-09-02    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: OlaszBútoráruházLineaflexÖntvárjaelemválasztékávalnagykonyhabútorokmodernStúdióKlasszikusÁgybetétkerBudapestkonyhabútor

Forrás: pepitahirdeto.multiapro.com

Társkereső weboldal baráti áron eladó. 3 in 1 megoldás. (Titkos, alkalmi, komoly). 1000-nél is több regisztrált felhasználó! .com-os, .hu-s domain nevekkel. Remek befektetés, ha komolyan gondolod. Alapozzad meg a jövődet! A részletekért hívj bátran!


Feladva: 2017-03-30    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: eladóweboldalTárskeresőnélBudapestgondolod1000AndraskomolyankomolyBundzselbefektetésalkalmiRemekTitkosnevekkelmegoldásbátrandomainhívjcom

Forrás: pepitahirdeto.multiapro.com

Nem érted a spanyol múlt időket? Magas a subjuntivo? Kevered a spanyol névmásokat? Akkor neked is segítenek spanyol videós minitanfolyamaim! A 3-6 videóból álló minitanfolyamok 1-1 nehezebb nyelvtani vagy szókincs témát dolgoznak fel. Minden tanfolyam első videója ingyenesen megnézhető!


Feladva: 2016-10-27    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: spanyolminitanfolyamoknévmásokatingyenesenJusztinnehezebbKeveredvideójavideókkalsubjuntivoelsőtanáriállóMagastanfolyamvideóbólidőketMindenmúlt

Forrás: pepitahirdeto.multiapro.com

Ha ön egy sok éven át használható és kényelmes garnitúrát szeretne prémium minőségben, jó helyen keresi! Egy szék ára 8000 Ft. Bármennyi készíthető és az asztal mérete és formája is változhat igény szerint, ha egy más garnitúrát szeretne. Új állapotban 2 év garanciát adok rá. Könnyen szállítható, mert egyszerűen szétszerelhető. A garnitúra ára lecsiszolt állapotban, festésre készen értendő, mindenki igényei szerint festheti akár, de megegyezés szerint le is festhetem. Kiszállítás is ... további részletek >>

megoldható.


Feladva: 2017-07-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: szerintegyállapotbanszeretnegarnitúrátáragarnitúramegoldhatókészíthetőfestésresokgaranciátKiszállításBármennyiprolignumfesthetem8000lecsiszoltmás

Forrás: pepitahirdeto.multiapro.com

A chiamag magas rost- és omega-3 zsírsav tartalommal rendelkezik. Természetes gyulladáscsökkentőként működik a szervezetben, ezzel elősegíti a szívbetegség és az elhízás megelőzését. A chia mag szuperélelmiszer, melynek fogyasztása előnyös az agy és az idegrendszer számára is. A kutatások megerősítették, hogy csökkenti a magas koleszterinszintet és a vérnyomást, javítja az agyi funkciókat, rendszeres fogyasztásával megelőzhető az időskori szellemi hanyatlás.


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: magchiachiamagmagascsökkentirendelkezikidőskorihogytartalommalmegelőzhetőmegerősítettékmegelőzésétzsírsavfogyasztásávalkutatásokelhízásomegaszámára

Forrás: pepitahirdeto.multiapro.com

Az Ozeki Informatikai Kft. programozás iránt elhivatott egyetmi hallgatóknak kínál diákmunka lehetőséget. Szakmai gyakorlat feltételei: - Nappali tagozatos hallgatói jogviszony - Programozó informatikus, Mérnök informatikus szakon folytatott felsőfokú tanulmányok - Kötelező tárgyak teljesítése (teljesítési igazolás, leckekönyv másolata) A jelentkezés módja: a job@ozek i.hu email címünkre küldött fényképes önéletrajzzal és jelentkezési adatlappal lehet. www.jobs.ozeki.hu/index.php?owpn=7 4


Feladva: 2017-03-24    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: KftgyakorlatSzakmaiOzekiDebreceninformatikusjelentkezésikínáligazolásProgramzóProgramozóönéletrajzzalhallgatóknakteljesítésijogviszonyfényképesiránt

Forrás: pepitahirdeto.multiapro.com

Egy lépéssel a betörők előtt! Bízza profikra otthona védelmét! Megbízható, pontos, referenciákkal rendelkező cég! Riasztó- és kamerarendszerek, távfelügyelet a legjobb árakon, Budapesten és Pest megyében! Kérje kollégánk segítségét: 06 20 452 2727 Írjon emailt, visszahívjuk!


Feladva: 2012-10-02    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: PestBudapestenvisszahívjukrendelkezőmegyébenemailtpontoskamerákÍrjonreferenciákkalriasztóksegítségétMegbízhatóAkcióskollégánkvédelmétmegyébenKérje

Forrás: pepitahirdeto.multiapro.com

Kedves Látogató! Holecskó János vagyok, a HJ-Graphics Studio vezetője. Fő tevékenységek: portré, figura rajz és festés, grafikai tervezés, dekorációs falfestés – art&design. Több mint 16 éve rajzolok, festek, foglalkozom elektronikus grafikával, végzettségem szerint keramikus vagyok. Remélem, hogy munkáim elnyerik tetszését. Ha valóban művészi szintű ajándékkal akar kedveskedni szeretteinek, vagy csak vágyik egy szép rajzolt emlékre, keressen bizalommal. Tekintse meg munkáimat!


Feladva: 2015-02-20    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: dekorációsJánosHolecskóvagyokportréfalfestésegytetszésétfoglalkozomvágyiktervezéselnyerikfestekcsakgrafikaimunkáimLátogatómunkáimatrajzolokvagy

Forrás: pepitahirdeto.multiapro.com

Exkluzív olasz italtartó földgömbök, sakkasztalok széles választékban. Rövid szállítási határidővel.Megrendelheti honlapunkon, vagy személyesen üzletünkben. 1093 Budapest közraktár utca 20./a www.matracfutar.hu www.lineaflex-butor.hu


Feladva: 2017-02-15    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: BudapestsakkasztalokolaszlineaflexwwwItaltartókmatracfutarszállításiutcaRövidközraktárválasztékbanszéles1093üzletünkbenföldgömbökszemélyesenvagy

Forrás: pepitahirdeto.multiapro.com

Sok menyasszony nem tudja, hogy egy parfümvásárlás sokkal összetettebb annál, minthogy a drogéria polcáról leemeljük a pénztárcánkhoz illő, külsőre a leglátványosabbnak bizonyuló kis üvegcsét. Egy illatnak lelke, ereje, és története van. Minden esszencia megkomponálása során szakértő parfümőrök együttes erővel dolgoznak azon, hogy minőséget, harmóniát és szépséget zárjanak egy-egy fiolába. Ilyen illatmágusok készítik a világ luxusmárkáinak, a nagy divatcégeknek illatait, és (bármilyen lelombozó) ... további részletek >>

a sztárok nevével fémjelzett parfümöket is... Itt többet is olvashatsz: www.eskuvoclassic.hu/menyasszony-parfum-kisokos-talald-meg-illat-ami-az-oltarhoz-kiser


Feladva: 2017-10-03    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: egyhogyillatmenyasszonyzárjanakösszetettebbeskuvoclassicsoránillataitbizonyulószépségetsokkalwwwmegkomponálásadivatcégeknekleglátványosabbnakkiser

Forrás: pepitahirdeto.multiapro.com

MÉHÉSZ HUZAL - keret drót dobon és tekercsben. 0,4 és 0,5 mm-es lágy - HORGANYZOTT huzal dobon 1.250,-Ft, - ROZSDAMENTES (inox) huzal dobon 2.500,-Ft/kg. Kiszerelés: 1, 2, 3, 4, 5 kg, igény szerint. (lehet nagyobb is) A meghirdetett ár, 1 kg. dobra csévélt horganyzott huzalra vonatkozik! A dobokhoz, különböző méretű huzaleresztő kapható. A termék postázása, postai díjszabás szerint. Kereskedőket, viszonteladókat is kiszolgálunk! A termékek honlapunkon közvetlenül megrendelhetők!


Feladva: 2016-11-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: huzaldobonszerinthorganyzottdrótkeretMÉHÉSZKereskedőketKfthuzalraPluszinoxdíjszabásDrótszálcsévéltROZSDAMENTESpostázásaAKCIÓdobra250termék

Forrás: pepitahirdeto.multiapro.com

Zamárdi kiadó szálláshelyek fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Sok fényképpel a szálláshelyekről és a városról! - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Egész évben nyitva tartó szálláshelyek Zamárdiiban - Weblap: www.zimmerinfo.hu/zamardi/hu.htm


Feladva: 2017-11-16    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfokiadóEgészZAMÁRDIáronhtmapartmanokszállásoklegolcsóbbzamardinyaralóházakelfogadónélkülvillákPihenőkártyadíjwwwvendégházak

Forrás: pepitahirdeto.multiapro.com

Béreljen, vagy vegyen! Miért éri meg a Fiscal Online pénztárgépet választani? - Kisméretű - Akkumulátoros - Érintőkijelzős - Könnyű, gyors papírcsere - Kis és közepes forgalmú üzletekben megállja a helyét - Felhasználó barát kezelés - Végösszeg korlát az elütések elkerülése végett - Nyugta sztornó, hogy felejtse el a sztornó füzetet - Átszemélyesíthető A bérlésről itt olvashat többet: ... további részletek >>


Feladva: 2017-07-11    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: sztornópapírcsereéribérlésrőlVégösszegATCgyorsMiértÁtszemélyesíthetőkezelésakcióKönnyűvegyenfüzetetbarátPénztárgépÉrintőkijelzősvagyFelhasználó

Forrás: pepitahirdeto.multiapro.com

Modell XO-3001US Állapot Új Anyaga: nemesacél Magas fényű Közepén pörgethető láncbetéttel Szélessége: 49-től 57-ig 6 mm Szélessége: 59-től 72-ig 8 mm Belső része domborított, így viselése nagyon kényelmes Súly: 6.70 gramm www.klugex.ekszer.center/69-nemesa cél-gyűrűk


Feladva: 2017-07-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: nemesacélKözepéntőlSzélességekényelmesKarikagyűrűnagyonfényűviseléseMagasgyűrűkígyAnyagadomborítottÁllapotcenterrésze3001USekszerBelsőModell

Forrás: pepitahirdeto.multiapro.com

Gyerekeknek, fiataloknak kreatív díszpárnák. Csiga díszpárna, teknős díszpárna, katica díszpárna, pillangó díszpárna, egér díszpárna, kutya díszpárna és még sok más... www.atalakulok.hu/termekkategoria/ diszparnak


Feladva: 2016-11-12    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: díszpárnadíszpárnákmásokkreatívsokanfiataloknakmégGyerekekneksepalakutyaállatosegérpillangókaticateknőscsiga

Forrás: pepitahirdeto.multiapro.com

Az általunk ajánlott technológiával 2 fős személyzettel, egyetlen gépjárművel elvégezhető az aszfaltburkolat javítás, bontási munkálatok nélkül. Ami még fontosabb: a javítás költsége akár 40%-al is kevesebb lehet ezzel a módszerrel, valamint a létrejövő hő-kötés miatt lényegesen tartósabb megoldást nyújt. Végül, de nem utolsó sorban a helyszínen újrahasznosítjuk az összes jelenlévő anyagot, ezáltal hulladékelszállításra sincs szükség. Mi minőséget nyújtunk! Keressen bizalommal!


Feladva: 2014-02-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: télenjavításújrahasznosítjukegyetlenkötésnyújtunkméghelyszínenszemélyzettellétrejövőminőségetamisorbanfősvalamintIlletveutolsótechnológiávalnem

Forrás: pepitahirdeto.multiapro.com

Régi és új üzemanyag tankok teljes körű javítása, homok szórás, rozsda mentesítés, vágás, hegesztés, belső üzemanyag álló bevonat készítése, külső festés, fényezés, feliratok, csíkok készítése, bicikli fényezés. Motor, autó, kamion, hajó vagy más üzemanyag tank, hozza el megjavítjuk. Felnik fényezését is vállaljuk. Látogasson el honlapunkra!


Feladva: 2017-02-27    [Autó - Motor - Jármű]

Címkék, kulcsszavak: üzemanyagfényezéskészítésetankfestésjavításavagykülsőhonlapunkrakörűhajóbevonatLátogassonteljeskamionállóvállaljuktankokautóbelsőfényezését

Forrás: pepitahirdeto.multiapro.com

Szarvason az Arborétum szomszédságában található üdülősoron összkomfortos, téliesített nyaraló saját (10 méteres) vízparttal, saját stéggel egész évben kiadó. A ház 4+2 fő befogadására alkalmas, teljesen felszerelt konyha + étkező, fürdőszoba (hideg-meleg vízzel), klíma, 8 személyes szaletli, kerti sütő ( bogrács, nyárs...stb), gyermekmedence,homokozó, gyermekjátékok,napozóágyak, hintaágy, kerékpárok, több autó részére zárt parkolási lehetőség áll a vendégek részére.


Feladva: 2015-08-18    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SzarvasonsajátrészérestbArborétumfürdőszobaparkolásistéggelnyársétkezőzártbográcsszarvaskonyhaautóvízparttalsütőszabolcsfelszerelttöbbméteres

Forrás: pepitahirdeto.multiapro.com

Olyan pénzügyi szakmát szeretnél tanulni, amivel vállalkozások alapításával, adóügyekkel és hitelügyintézéssel is foglalkozhatsz? Szeretnél pénzügyi szakértőként dolgozni és ügyintézéssel foglalkozni? Szívesen lennél Pénzügyi asszisztens, Banki könyvelő vagy Számviteli előadó? Jelentkezz Budapesten induló Pénzügyi-számviteli ügyintéző OKJ-s tanfolyamunkra! A tanfolyam árát több részletben is fizetheted. A tanfolyamot kevesebb, mint 1 év alatt is elvégezheted és pályakezdőként, akár 200.000 Ft-os ... további részletek >>

fizetésre is számíthatsz. A tanfolyamhoz szükséges szakmai előképzettség: Érettségi végzettség. Ha úgy döntöttél, hogy ez a Te szakmád, akkor jelentkezz weboldalunkra kattintva: www.tanfolyamokj.hu/penzugyi-szamviteli-ugyintezo-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: penzugyiszámvitelibudapestentanfolyamokjugyintezotanfolyamokjSzeretnéljelentkezz200amivelárátszamvitelifoglalkozniúgyakártanulnitanfolyamunkra000

Forrás: pepitahirdeto.multiapro.com

Könyvelés és bérszámfejtés kedvező áron Angyalföldön a Full Active Bt. könyvelőirodában. Egyéni vállalkozások és társas vállalkozások könyvelése kedvező áron. SZJA bevallás magánszemélyeknek kedvező áron. Könyvelését bízza hozzáértőkre! Visszamenőleges könyvelést is vállalunk. Ha bármilyen kérdése lenne könyvelés ügyben, keressen minket bizalommal. Tel: 412-08-06, Fax: 412-08-07


Feladva: 2015-01-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: áronkedvezőkönyvelésActiveFullAngyalföldönbérszámfejtés412vállalkozásokhozzáértőkreEgyéniminketbízzakönyvelőirodábankeressenKönyvelésétügybenlenne

Forrás: pepitahirdeto.multiapro.com

Amiért érdemes figyelemmel kísérnie minket: • 60-70-80 % kedvezmény! • Kifutó szériás bútorok, amíg a készlet tart! • Hetente megújuló választék! • Konyhabútor, 4-6 elemes 29.000 Ft-tól • Szobai szekrénysor 29.000 Ft-tól • Hálószobai szekrénysor 29.000 Ft-tól • Tükrös gardrób 19.000 Ft-tól • Ülőgarnitúrák 39.000 Ft-tól • Ágy 19.000 Ft-tól • Étkezőgarnitúra 19.000 Ft-tól • Tálalószekrény 19.000 Ft-tól • ... további részletek >>

Kiegészítő kisbútorok 3.000 Ft-tól


Feladva: 2016-08-30    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 8226tól000szekrénysorbútorokminketTálalószekrényfolyamatosanválasztékkísérnieÉtkezőgarnitúraAkciósmegújulófigyelemmelÁgyHetenteérdemesÜlőgarnitúrák

Forrás: pepitahirdeto.multiapro.com

Hozzávalók a tésztához: 2 tojás 1 bögre cukor 200 g tehéntúró 1 kiskanál szódabikarbóna 1/2 kiskanál só 2 bögre liszt kókuszreszelék (a díszítéshez) Hozzávalók a krémhez: 3 tojássárgája 6 evőkanál cukor 5 evőkanál liszt 7 dl tej vaníliaaroma 200 g vaj Verjük fel a tojást a cukorral, majd adjuk hozzá a tehéntúrót, a szódabikarbónát, a sót és egy bögre lisztet, keverjük össze habverővel vagy kézi robotgéppel. Adjunk hozzá még egy bögre lisztet és keverjük össze. Tegyük ... további részletek >>

hűtőszekrénybe 60 percre a tésztát. Készítsük el a krémet: Keverjük ki a tojássárgáját a cukorral majd tegyük bele a lisztet és a tejet, kavarjuk össze habverővel vagy robotgéppel, lassú tűzön kezdjük főzni. Közben folyamatosan kavargassuk, amikor elkezd főni vegyük le a tűzhelyről és ízesítsük vaníliaaromával, hagyjuk hűlni. A vajat alaposan habosítsuk fel és keverjük hozzá a krémet. Vegyük ki a hűtőből a tésztát és osszuk 6 egyenlő részre, nyújtsunk belőle 6 lapot. Előmelegített sütőben, vajjal kikent tepsi hátulján süssük mindegyik lapot pár percig, amíg egy kis színt kapnak. A tortalapokat kenjük meg a krémmel és tegyük őket egymásra, szórjuk meg kókuszreszelékkel. Hagyjuk állni pár órát, majd szeleteljük. Jó étvágyat! www.webcukraszda.hu/bogres-raffaello-torta/


Feladva: 2017-04-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: keverjükbögrelisztettegyükmajdegyhozzáösszemegliszttésztáthagyjukevőkanálcukorVegyükkrémetcukorralrobotgéppelHozzávalókvagytortahabverővel

Forrás: pepitahirdeto.multiapro.com

A GaBChat egy kifejezetten mobiltelefonra készített chat. Nem számítógépes chatből lett lekonvertálva, ezért nem tartalmaz semmilyen felesleges multimédiás elemet. Úgy lett megtervezve, hogy minimális adatforgalmat generáljon, sőt még adattakarékos felülettel is rendelkezik, így nálunk még 100 Mb-os internettel is túlzás nélkül napi több órát chatelhetsz. Sajnos egy oldal csak komprumisszumok árán lehet számítógép és mobiloptimalizált egyben. Szinte mindenhol ilyen komprumisszumok árán lehet ... további részletek >>

csak mobilról chatelni, ezért a GaBChat nélkülözi a számítógépes felületet. Nálunk nincs komprumisszum a telefonoddal! Ez nem azt jelenti, hogy számítógépről nem fog működni a chat, természetesen PC-ről is az összes szolgáltatás használható, viszont semmilyen fölösleges dizájn nincs benne, így a kinézete a végletekig egyszerű. Bár a felülete spórol az interneteden és a telefon memóriáján, de rengeteg beállítási lehetőség és szolgáltatás van a chaten, így mobilon nagyon kényelmes és egyszerű, természetesen gyors a használata. Lehetőség van a háttérszín a betűméret, a frissítési idő és a szoba hozzászólás szám beállítására, így úgy állíthatod be a chatet, hogy biztosan kényelmesen olvasható legyen a számodra. Várunk mindenkit szeretettel: www.gabchat.hu


Feladva: 2017-06-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: gabchatnemígyhogychatkomprumisszumokNálunkszámítógépesszolgáltatásvanezértúgynincsLehetőséglettmégcsaksemmilyenegytermészetesenlehetárán

Forrás: pepitahirdeto.multiapro.com

Nyugodt természeti környezetben, 2 szintes családi házban 4x4 ágyas szobák kiadók. Minimum 3 éjszakára vagy többre kiadó. A vendégházat egy időben csak egy családnak, illetve társaságnak kiadó. A szállás, legalább három éjszakára és minimum 10 fő részére foglalható. Maximum 16 fő, családoknak és baráti köröknek ideális. Minden szobában TV, WIFI. Konyha és fürdőszoba közös használatú. Nagy, parkosított udvar, ahol bográcsozni- nyársalni lehet. Parkolás zárt udvaron. Felnőtt: 2700 Ft/fő/éj + ... további részletek >>

IFA 280 Ft/fő/éj Gyerek: 0-17 éves korig 2700 Ft/fő/éj Fűtési szezonban minimum 3 éjszakára és minimum 10 főnek kiadó a vendégház. Fűtési szezonban Felnőtt: 4700 Ft/fő/éj +IFA 280 Ft/fő/éj Fűtési Szezonban Gyerek: 4700 Ft/fő/éj Eger 18 km-re, Mezőkövesd 12 km-re van Bogácshoz. Lehetőségek: Gyógyvizes strandolás, horgászás, túrázás, este a pincesori borozók, amikben hajnalig lehet szórakozni. OTP, MKB, K&H Szép kártya elfogadó hely. Érkezés: 14 órától Távozás: 10 óráig. A vendégházban lakik a tulajdonos is. www.fpvendeghaz.fw.hu piroska60@freemail.hu 06303756031 Egész évben szeretettel várom vendégeimet!


Feladva: 2017-06-07    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: minimuméjszakáraSzezonbanFűtésikiadóFarkas4700FtGyerek2700Ftegy280FtIFAFelnőttlehetBogácsvendégházPiroskaMezőkövesdMindenEgészÉrkezésfőnek

Forrás: pepitahirdeto.multiapro.com

A Vörös Reishi (pecsétviaszgomba, Ganoderma lucidum) gyógygomba méregteleníti és kiegyensúlyozza a szervezetet. Én port és kapszulát is szedek. A kapszulával jobban be tudom tartani az adagomat, ami 10 pár RG és GL kapszula. A Reishi port szeretem elszopogatni, mert egyből a szájüregből felszívódva a fogakra, ínyre és torokra is kifejti hatását. 3 éve használom a DXN Ganodermás termékeit. Személyes tapasztalataim 1 év után: ... további részletek >>

www.kavekiraly.hu/blog-2014-10-18-Megelozni_konnyebb__mint_gyogyitani_-_sajat_tapasztalataim Az RG nagyon erős méregtelenítő. Addig kutat a testben, amíg meg nem találja a panasz helyét. A GL-nek kevésbé agresszív a méregtelenítő hatása. Erőssége a regenerálásban és a kiegyensúlyozásban rejlik. A pecsétviaszgomba nem csak a testet méregteleníti és egyensúlyozza ki, hanem a lelket is. Hangulatjavító és antidepresszáns hatású. Webáruház: www.kavekiraly.hu/termekek


Feladva: 2017-01-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kavekiralyVöröstapasztalataimhttpnempecsétviaszgombaportReishiméregtelenítőGanodermaméregtelenítifelszívódvakevésbénagyonadagomattermékeitcsaknek

Forrás: pepitahirdeto.multiapro.com

Tökmagolaj eladó. Igazi, 100%-os stájer technológiás tökmagolaj a termelőtől. - 1 liter 4300 Ft. - 0,5 liter 2200 Ft. Bővebb információ honlapunkon: www.balogholaj.hu/tokmagolaj


Feladva: 2017-03-28    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: tökmagolajlitertechnológiásbalogholajstajerhttp100honlapunkonIgaziinformációeladóBővebbKerkabarabás2200FtPéterBalogh4300Fttermelőtől

Forrás: pepitahirdeto.multiapro.com

Legújabb termék, mely egyben a kedvencünk is lett. Tejes-mogyorós krémmel töltött ostya. A női táskákba is könnyedén elfér. Vidd magaddal, hogy ne csábulj el a cukros változatoknak. MOST BEVEZETŐ ÁRON MEGKÓSTOLHATOD! www.bodyfit-hungary.hu/BodyandFit- Smart-Break-feherjevel-dusitott-tej es-mogyoros-ostyaszelet


Feladva: 2017-10-05    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: ostyaBudapestváltozatoknaktöltöttcsapatcukroskrémmelFitcsábuljmogyorósBodyhogyTejeskedvencmagaddallettViddkedvencünkelféregybenMEGKÓSTOLHATOD

Forrás: pepitahirdeto.multiapro.com

Hegesztő minősítő tanfolyamok indulnak a hét minden napján. A tanfolyamra jelentkezéshez ELŐKÉPZETTSÉG nem szükséges! Az MSZ EN ISO 9606-1 szabvány szerint lehetőség van magyar illetve német (TÜV) vizsga megszerzésére is. A magyar vizsgákhoz a Magyar Hegesztőminősítő Testület operatív szervezete az MHtE, a német vizsgákhoz a TÜV Rheinland Intercert Kft. biztosítja a vizsgabiztost. Kérésre egyszerre egy vizsgadarab meghegesztésével két bizonyítvány szerezhető, MSz és DIN szerinti is!


Feladva: 2016-01-10    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: tanfolyamokHegesztőnapmindenminősítőhétegyBudapestminősítésselWeldcontrolTÜVszerintszabványszükséges9606nem287ELŐKÉPZETTSÉGindulnak

Forrás: pepitahirdeto.multiapro.com

Fix 10 000 Ft/nap áron kölcsönözhető platós, ponyvás teherautók Budapesten. 3,5 tonnás B-s jogosítvánnyal vezethető. KAUCIÓ VAN!


Feladva: 2017-03-30    [Autó - Motor - Jármű]

Címkék, kulcsszavak: áronfixbérlésteherautókTeherautóponyvásPlatóskölcsönözhetőVANnapKAUKCIÓ000vezethetőjogosítvánnyalBudapesttonnásChriscarBudapesten

Forrás: pepitahirdeto.multiapro.com

Aranyszarvas Apartmanház! Szarvason a Történelmi Magyarország szívében található Aranyszarvas Apartmanház Étterem és Grill Terasz újra megnyitotta kapuit. Vendégeink számára biztosítjuk a felejthetetlen, élményekben gazdag kikapcsolódást és pihenést. Minőségi apartmanok, 100 méter széles vízpart, óriási medencék, jacuzzik, szaunák várják a pihenni vágyókat.


Feladva: 2017-09-09    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: AranyszarvasÉtteremApartmanházvárjákSzarvaspihenéstTeraszszaunákajánlókikapcsolódástGrilljacuzzikHirdetőgazdagmedencékPepitaélményekbenóriási100

Forrás: pepitahirdeto.multiapro.com

Mindig akad, aki mindent maga csinál, mert mindenki másnál jobb, ügyesebb... Jó sokan vannak, de valahogy mégis láthatatlanok maradnak, mert azért mégsem úgy vannak az internetes megjelenés alapvetései, ahogy ők gondolják. A Pepita Hirdető kínál olyan megoldásokat, amivel láthatóvá lehet válni a weben, csak kérni és használni kell... Szolgáltatásaink ebben: www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60547


Feladva: 2016-04-23    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: látszanivannakHirdetőmertPepitalehetMindigmegjelenéssokanláthatóváinternetesügyesebbamivelnemjobbmegoldásokatvagyúgymásnálolyaninterneten

Forrás: pepitahirdeto.multiapro.com

Kizárta magát? Nem nyílik az ajtó? Akad, szorul a zár? Hívjon és megoldjuk! Minden jellegű zár probléma gyors megoldása Budapest és Pest megye területén. Díjtalan kiszállás Budapest területén. www.zarcsere.eu Zárcsere - Zárcsere gyors szerviz éjjel-nappal.


Feladva: 2017-05-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: ZárcsereBudapestzarcserezárterületénnyílikgyorsNemproblémamagátwwwKizártahttpjellegűZárnyitásMindenZárszervizmegoldjukkiszállásHívjonDíjtalan

Forrás: pepitahirdeto.multiapro.com

A Pongó Vendégház Gádoros Nagyközség központjában található, a három darab kétszemélyes (pótágyazható) szobában tusoló, WC, franciaágy, kábeltelevízió, wifi elérés áll rendelkezésre. Egy szoba légkondicionált és akadálymentesített. Minden szükséges eszközzel felszerelt közös konyhában készíthetik el a lakók ételeiket. Befogadóképesség: max. 9 fő Szobafoglalás, információ: Bencsik Sándorné: +36703299481 Elérhetőség: 5932 Gádoros, Jókai u. 5. www.pongovendeghaz.oldalunk.hu ... további részletek >>


Feladva: 2017-03-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: GádorosSándornépongovendeghazBencsikVendégházPongówwwoldalunkszobábanBefogadóképességlégkondicionáltJókaipótágyazhatóételeiketszobakétszemélyeslakók

Forrás: pepitahirdeto.multiapro.com

Lakókocsiját, lakóautóját és hajóját tárolja nálunk! Mi vigyázunk rá, hogy Ön nyugodtan gondolhasson a következő nyárra! Vállajuk még járművének javítását is: www.lakokocsidepo.hu/egyeb-szolgal tatasok


Feladva: 2016-08-04    [Autó - Motor - Jármű]

Címkék, kulcsszavak: hajójátlakokocsidepolakóautójáthttpLakókocsijátnyárraSzigetszentmiklóskövetkezőKftgondolhassonkenyérnyugodtanKalászhogylehetőségvigyázunktárolási

Forrás: pepitahirdeto.multiapro.com

Klíma javítás, klímatelepítés - akár hűtésre, akár fűtésre -, karbantartás (gázzal feltöltés, gombátlanítás, fertőtlenítés), áthelyezés garanciával!!! Klíma telepítés 4m csőhosszig nettó 43.000 Ft! Minőségi klímakészülékeink: Panasonic, Nord, Samsung, Midea, Fisher, Fujitsu, Daikin


Feladva: 2015-04-01    [Lakossági szolgáltatás]

Címkék, kulcsszavak: klimaakárgaranciávalKlímaszerelés000wwwnettóDaikincsőhosszighűtésreFujitsutelepítésklímatelepítésFisherjavításMideaáthelyezéstólSamsungNord

Forrás: pepitahirdeto.multiapro.com

Négy féle online platformról jövő jövedelemből részesülhet. Exponenciálisan növekvő kereset. Megbízható kifizetés. A ”Likes XL” már bizonyított- most toább fejlődik és aki aug . 12- ig taggá válik óriási előnnyel tud legális coinokhoz is jutni. 0.01centes kezdő árfolyam Bővebb információért jelentkezni: skype joe197238


Feladva: 2017-07-21    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8221fejlődikExponenciálisanjutninekedtoábbrészesülhetcoinokhozlehetőségmostjövedelembőllegálisbizonyítottjoe197238jövőtudmárskypeplatformrólaug

Forrás: pepitahirdeto.multiapro.com

Szünetmentes tápegység Kemot tiszta szinuszos Felhasználás terület: a teljesítmény figyelembevételével: - hűtők - hő központok - keringtető szivattyúk - búvárszivattyúk, villanymotorok www.elektroexpressz.hu/spl/499141/ UPS-SZUNETMENTES-TAPEGYSEG


Feladva: 2017-01-22    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: SZUNETMENTESelektroexpresszszinuszostisztatápegységteljesítménysplterületFelhasználáshttpsvillanymotorokbúvárszivattyúkKemotszivattyúkkeringtető300W

Forrás: pepitahirdeto.multiapro.com

Értékesítőket keresünk PC játékok, szoftverek eladásához. Jutalék alapú fizetés. Kötetlen munkaidő, magas jutalék! Nem szükséges végzettség, tapasztalat. Bővebb infó a linken: https://goo.gl/TbG2mW


Feladva: 2017-08-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: jutalékhttpsKötetlenlinkenfizetésinfóalapúBővebbeladásáhoztapasztalatszoftverekvégzettségjátékokszükségeskeresünkNemÉrtékesítőketSuhancTbG2mW

Forrás: pepitahirdeto.multiapro.com

Mobil- és infocuccok akár ingyenes szállítással, garanciával. www.techdiszkont.superwebaruhaz.hu /mobiltelefon-k79599 HP, Acer, ASUS, Samsung, LG, Nokia, Alcatel, Genius, Canyon és egyéb márkák választéka.


Feladva: 2017-03-31    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: techdiszkontMobilASUSMobilboltAcersuperwebaruhazválasztékamárkákwwwegyébgaranciávalCanyonszállítássalGeniusingyenesAlcatelakárNokiainfocuccok

Forrás: pepitahirdeto.multiapro.com

A vörös szőlőlevél magas antioxidáns tartalmáról ismert keringésfokozó hatású. Az Ultra Weich vörösszőlő levél krém enyhíti a fájdalmas feszülő érzetet a bőrfelületen és frissíti a fáradt, elnehezedett igénybe vett végtagok vérkeringését, ezzel kellemes, hidratált érzést biztosít. Minden bőrtípusra alkalmazható. Külsőleg, a bőr felületén alkalmazandó. Ingyenes szállítási lehetőséggel! www.mososzerbolt.hu/id/00245_UW_Vo rosszolo_level_krem_100_ml_


Feladva: 2016-01-27    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: hatássalbőrfelületetfokozóhidratáljaKeringésNyugtatjaKftsejtregenerációtFutureFokozzaCudywebáruházesetérekrémmosószertüneteklevélHazailábNehéz

Forrás: pepitahirdeto.multiapro.com

Ön kötött biztosítást a lakására, az autójára? Bizonyára igen a válasza. És arra, aki mindezt létrehozta, egy élet munkájával előteremtette, vagyis önmagára kötött-e biztosítást? Ne késlekedjen! Az UNIQA Puzzle balesetbiztosításával korszerű, sokoldalú és magas összegű szolgáltatásokat fizető biztosítással vértezheti fel magát, illetve családját. Tájékozódjon: nézzen bele a www.privatbiztositasok.nanoweb.hu< /a> honlapba, s keresse a Rizikókat.


Feladva: 2013-09-04    [
Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: igenegybiztosítástkötöttprivatbiztositasokválaszaszolgáltatásokatönmagárabeleösszegűvagyisBizonyáranézzenmagaselőteremtetteautójáraTájékozódjonélet

Forrás: pepitahirdeto.multiapro.com

A méh pempő nemcsak étrendkiegészítőnek kiváló, de a bőr- és hajápoláshoz is az egyik legjobb termék. A méhek állítják elő, hogy ezzel a sűrű, ragacsos anyaggal táplálják királynőjüket. A méh pempő áldásos hatásait az ember már korán felfedezte és alkalmazza ma is szinte valamennyi betegség ellen sikeresen. Hatásait annak köszönhetjük, hogy benne rendkívül sok hasznos anyag található. A létfontosságú tápanyagok mellett számos más értékes összetevőt tartalmaz, többek közt acetilkolint és 10-HDA ... további részletek >>

savat is. Ezek adják intenzív gyulladásgátló antivirális és az agyműködést elősegítő hatásait.


Feladva: 2017-07-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásaithogypempőméhkiválóértékessűrűbenneétrendkiegészítőnekintenzívkoránmásezzelnemcsakadjákmárszámoselőköszönhetjükKittiEzekemberannak

Forrás: pepitahirdeto.multiapro.com

Szeretettel várom minden lazítani vágyó vendégemet egy kellemes kikapcsolódásra Gyenesdiáson, a Balaton északi partján. Nálam hangulatos szobában, egyedi 1 órás teljes testes, meleg olajos lágy relax masszázsra van lehetőség. Amit lágy keleti zene kíséretében kényelmes matracon végzek el minden hozzám betérő személyen. Engedje meg magának ezt a lehetőséget, mert egy kis kényeztetés mindenkinek jár! Elérhető vagyok a hét minden napján reggel 8:00-22:00 0620/978/9568 Alex


Feladva: 2017-07-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: mindenlágyAlexrelaxegyGyenesdiásonElérhetőegyediEngedjevágyóAmitjárszobábanszemélyenlazítanilehetőségmindenkinekhangulatosbetérővárom9568

Forrás: pepitahirdeto.multiapro.com

SOFŐR állás FRANKFURT melletti 22 éves német cégnél. „C” jogosítvány, 95-ös bejegyzés és legalább 3 éves LKW-s (nagy kocsis) gyakorlat szükséges, némettudás NEM kell. Munkabér túlórákkal 1800€ nettó, szállás ingyenes. 0049 151 6656 6269 További infók és jelentkezés a www.nemetmunka.hu/sofor.html weboldalon.


Feladva: 2017-02-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: sofornémetFRANKFURTállásévesNEMweboldalunkon8221151némettudáshtml82220049szükségescégnélingyenesgyakorlatnemetmunkaszálláskocsiswwwmelletti

Forrás: pepitahirdeto.multiapro.com

Régen le kellett állnom a kávézással. Magas volt a vérnyomásom és volt, hogy megszédültem, nagyon dobogott a szívem. Nem tudtam élvezni az előnyeit. 3 éve viszont megkóstoltam egy nagyon finom gyógynövény tartalmú kávét. Prémium minőségű brazil Arabica kávéból készül, amihez 100% tiszta organikus Ganoderma gyógygomba kivonatot kevernek. Azóta számos problémám megszűnt, köztük a magas vérnyomás is. Éhgyomorra is iszom egyből reggel, mert lúgosít, nem marja a gyomrom. Nem ver tőle őrült ... további részletek >>

módon a szívem, szépen beszabályozza a vérnyomásom. Szépen szinten tart, nincs túlpörgés és később hirtelen levertség. Naponta megiszom kb 5-öt, amikor jól esik, már csak az íze miatt is. :) Rólam itt olvashatsz: www.kavekiraly.hu/az_en_tortenetem DXN termékek: www.kavekiraly.hu/termekek Egy jó kis videó a pecsétviasz gombáról: www.kavekiraly.hu/ganoderma


Feladva: 2016-12-26    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: NemvérnyomásomszívemEgymagastermekekkavekiralyvolthttpnagyonSzépengombárólbrazilittegybőlelőnyeitlevertségkivonatotGergelypecsétviaszmódon

Forrás: pepitahirdeto.multiapro.com

Béreljen riasztó rendszert és 3 év után az öné! Vagy válasszon akciós csomagjaink közül! Telepítéseinket az egész ország területén végezzük!


Feladva: 2016-10-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: riasztóSzolnokközülFerenccsomagjainkSzekeresakciósbefektetésselválasszonkisVagyrendszerönéutánrendszert5322126Béreljenriasztotgyorsan

Forrás: pepitahirdeto.multiapro.com

Plotter papír értékesítés. Minőségi tekercses termékek, minden méretben. Akár azonnal, raktárról. További információért látogasson el honlapunkra: www.penztargeptekercs.hu/index_ele mei/plotter.htm


Feladva: 2016-05-26    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: plotterpapírtekercseshonlapunkraMinőségilátogassonértékesítésinformációértTovábbiXIIIraktárrólBudapesthtmazonnalKftAkárTóthelemeiméretbenindex

Forrás: pepitahirdeto.multiapro.com

Vállalom: - Kft-k, Bt-k, kis- és közép vállalkozások teljes körű munkavédelmi, tűzvédelmi képviseletét - Oktatásokat, kötelező munkavédelmi kockázatértékeléseket - Új típusú Tűzvédelmi Szabályzatok készítését, zaj, fény, hő, pára mérések elvégzését Természetesen számlával. Bővebb információ, referenciák, megjelent publikációim a honlapomon megtalálhatóak: www.munkaszabo.5mp.eu


Feladva: 2016-05-08    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: munkavédelmiTűzvédelmiközépBővebbtípusúkisszámlávaléttékelések5mpKftTermészetesenkockázatmunkaszaboVállalomelvégzésétwwwZoltánmérésekkötelező

Forrás: pepitahirdeto.multiapro.com

Számlaképes cégünk vállalja lakások, házak, irodák, komplett költöztetését, lomtalanítását, épületen belüli átrendezését. Igény szerint csomagolunk vagy csomagolóanyagot kiszállítunk, rakodási, szerelési feladatokat is végzünk. Minőségi, gyors munka több éves tapasztalattal, referenciával, hétvégén is hétköznapi árakon! Akár lakáscsere lebonyolítását is vállaljuk. T: +36 (70)23 53 403, +36 (1) 787 0230


Feladva: 2017-05-22    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: csomagolunkvállaljuklakásokmunkaszerintlebonyolításátvállaljagyorsIgénylakáscserecégünkMinőségiátrendezésétAkárSzámlaképesvégzünkbelüliárakon0230

Forrás: pepitahirdeto.multiapro.com

Automata mosógépek, mosogatógépek, hűtőgépek, varrógépek, mikrosütők, porszívók és egyéb háztartási gépek helyszíni és szervizes javítása 1 év garanciával.


Feladva: 2015-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: FerencCsókajavításagépekháztartásiszervizeshpmosógépekhospitalszervizesAutomataelektrohelyszíniltpwwwMarcalváros840Győr350egyébTelporszívók

Forrás: pepitahirdeto.multiapro.com

Fellépésre, ünnepségre önnek, gyermekének, unokájának szüksége van Magyar, tájegység, illetve népviseleti ruhára? Küzdősportban vesz részt ön, gyermeke, unokája, és szüksége van egy masszív egyedi hozzávaló ruházatra? Megvett Magyar, tájegység, illetve népviseleti ruhát, amit át kell alakítani? Vett egy küzdősporthoz való cuccot, és át kell alakítani? Pusztán csak át kell varrni, megerősíteni, mert gyengén van varrva, és szétesik?


Feladva: 2016-08-17    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: kellvanegyszükségenépviseletiilletvetájegységalakítaniMagyarhozzávalógyengéngyermekénekegyedimertönnekVettmasszívmegerősíteniünnepségreamit

Forrás: pepitahirdeto.multiapro.com

A BlackStyles webshop egyedi mintás és feliratos pólók, illetve pulóverek színes választékával és igen kedvező árakkal várja a kedves vásárlókat!


Feladva: 2017-07-31    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: webshopBlackStylesTamásválasztékávalOrbánszínesPólópulóverekOnlineilletvepólókvásárlókatfeliratoskedvesmintásvárjaegyediárakkalkedvezőigen

Forrás: pepitahirdeto.multiapro.com

Kameradepó az IP kamerák, IP kamerarendszerek, éjjel látó színes IP infrakamerák webáruháza! Ön kényelmesen megrendeli az íróasztala mellől, mi rövid határidővel kiszállítjuk! Prémium kategóriájú Full HD IP kamerarendszerek a legjobb áron! Magánszemélyeket, cégeket és kivitelezőket is kiszolgálunk! Nézze meg a weboldalunkat: www.kameradepo.hu/ip-kamerarendsze r.html Kérje kollégánk segítségét: 06-20-5698848 Kameradepó webáruház a gyors, biztonságos megoldás!


Feladva: 2014-02-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: KameradepókamerarendszerekhttpolcsónFullinfrakamerákgyorsweboldalunkatKamerarendszertkategóriájúszíneswebáruházmegPrémiumlátóNézzekiszállítjukéjjel

Forrás: pepitahirdeto.multiapro.com

Pihenjen, üdüljön, kapcsolódjon ki nálunk és szülessen újjá a helyi Zsóry Gyógy-és Strandfürdőben, ami a szó szoros értelmében egy kőhajintásnyira van a Csilike apartmantól. Akcióinkról tájékozódjon a weboldalunkról: www.csilikeapartman.hu


Feladva: 2017-02-28    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: CsilikeáronkőhajintásnyiraszülessenjótegynálunkcsilikeapartmannyáronértelmébenkapcsolódjonwwwTélenszorosüdüljönhttpszóPihenjenweboldalunkrólami

Forrás: pepitahirdeto.multiapro.com

Csatlakozzon a legjobb feltételekkel a mi rendszerünkhöz! Belépési díj akár 0 Ft! Havi szolgáltatási alapdíj akár 0 Ft! A hirdetési költségek nagy részét átvállaljuk partnereinktől! Vállalkozásunk 1996 óta foglalkozik ingatlanközvetítéssel és a hozzá kapcsolódó, ezt elősegítő kiegészítő tevékenységekkel. Sikerünk alapja a költségtakarékos működés és a saját fejlesztésű know-how. Ezt a tudást és tapasztalatot adjuk át jövőbeni partnereinknek. Minden megyéből várjuk a jelentkezőket!


Feladva: 2015-12-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: MakkosknowfranchiseCentrumIngatlanlehetőségetátadásdinamikusanaztcéljábólterületenakikkörűfejlesztéseezenvállalkozóknakTeljeskiépítéseindítani

Forrás: pepitahirdeto.multiapro.com

Siófoki Aranyparton apartmanok szabad strand mellett kiadók. Földszinti 3 szobás,fürdőszobás, konyhával nappalival, Tv, hűtő, kertkapcsolatos apartman 4-5-6 főnek. emeleti 1 szobás fürdőszobás, tv. hűtő felszereltséggel. Ebből 2 db van. Szép kártyát elfogadunk. Légkondi igényelhető térítés ellenében. Bővebben: gosyapartmanok.info


Feladva: 2016-09-29    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: hűtőfürdőszobásszobásapartmanokSiófokiBővebbenvízpartimellettellenébenstrandtérítésszabadigényelhetőemeletiLégkondifőnekAranypartonelfogadunkSzép

Forrás: pepitahirdeto.multiapro.com

5 személyes KLÍMÁS lakókocsi bérelhető. Az elő-sátorban igényesen felszerelt konyha. A nagy árnyékot nyújtó nyitott terasz alatt kellemes az étkezés, pihenés egy jó beszélgetésre, ahol az estéket hangulatosan lehet eltölteni. A bérleti díj tartalmazza: a villany, víz használatát (tisztálkodásra a vizesblokkban van mód), 1 személygépkocsi parkolását a lakókocsi mellett, a kb. 150 m-re lévő strandra a belépést. Ágynemű van, huzat, lepedő, konyharuha hozandó. Házi állat nem hozható!


Feladva: 2015-10-31    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: vanlakókocsiestéketÁgyneműárnyékottisztálkodásraszemélyesaholbelépéstnagyhasználatátAlsóörshozhatóbeszélgetésrestrandrarészvízSándornemegydíj

Forrás: pepitahirdeto.multiapro.com

ZENEBOLTUNK MEGLEPETÉSE Webáruházunkban a Zenebolt teljes választéka elérhető. Hogy még kényelmesebb legyen a vásárlás, mostantól 16.000 Ft feletti vásárlás esetén a megrendelt termékeket Magyarország egész területén ingyen szállítjuk házhoz!


Feladva: 2017-07-11    [Zene - Hangszer]

Címkék, kulcsszavak: ZENEBOLTvásárlásszállítjukZENEBOLTUNKmostantólházhozMEGLEPETÉSE000WebáruházunkbanfelettiteljeseseténválasztékamegrendeltelérhetőtermékeketKALÁKAmég

Forrás: pepitahirdeto.multiapro.com

Házi ápolást, idősgondozást vállalok szakképzett ápoló képesítéssel. Folyamatos 24 órás bentlakásos ápolásra vállalok bármilyen beteget, vagy gondozásra, felügyeletre szoruló idős nénit, bácsit. Kórházi gyakorlattal, demens betegelállásában is jártas, empátiával, sok türelemmel rendelkező, önmagára igényes, ápolt, tiszta, mosolygós, leinformálható középkorú, beteg centrikus nővér vagyok. Kérem, keressen bizalommal! Kovácsné Erika Tel: 06-30-463-6404


Feladva: 2017-01-11    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ErikaKovácsnévállalokidősgondozásrendelkezőnénitvagyokórásHáiápolástürelemmelidősnővérfolyamatossokszorulóbetegcentrikusképesítésselempátiával463

Forrás: pepitahirdeto.multiapro.com

Kínai és Gyári mobiltelefonok, táblagépek szervizelése! Adatmentés Töltés javítás Függetlenítés Szoftveres javítás Kijelző csere Albertirsa Pesti út 97 06305805905


Feladva: 2017-09-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: AlbertirsaKínaijavításTöltésAdatmentésszervizelése06305805905táblagépekPestimobiltelefonokGyáricsereKijelzőAttilaPetrovicsSzoftveresMobilszervíz

Forrás: pepitahirdeto.multiapro.com

Keresünk németországi intenzíves ápolásra szoruló betegekhez ápolókat, gyermekápolókat, diplomás nővéreket, két heti váltásban, jó kereseti lehetőséggel. Jelentkezni német nyelvű fényképes önéletrajzzal lehet e-mailben. Elvárások: -honosított (Anerkennung) vagy honosítható bizonyítvány -középszintű német nyelvtudás(B2-es nyelvvizsga) -munkatapasztalat Bővebb információ telefonon: H-P, 9-16 óráig!


Feladva: 2017-10-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németnémetországiElvárásokkétmunkatapasztalatMohácsmailbennővéreketnyelvvizsgaKftlehetdiplomásnyelvtudás2011önéletrajzzalgyermekápolókatKezeknyelvű

Forrás: pepitahirdeto.multiapro.com

Aprósütemények, teasütemények, linzersütemények rendelhetők, közvetlenül a gyártótól! Házias jellegű, kézzel gyártott, minőségi édesipari termékek, nagy választékban! Bővebb tájékoztatás, termékbemutatás, rendelés felvétel a honlapunkon elérhetők!


Feladva: 2015-11-09    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: rendelésHáziaswwwtermékekteasüteményekhttpédesipariAprósüteményekelérhetőkminőségiSütihonlapunkongyártottPatakifelvételkézzelAprósüteményjellegű

Forrás: pepitahirdeto.multiapro.com

Eladó Pestszentimrén 50 nm-es családi ház. Összkomfortos, 1,5 szobás, étkezős konyha, kamra, kádas fürdőszoba, és külön vécé van. A fűtést az egész házban gáz-cirkó, a meleg vizet pedig gáz bojler biztosítja. A nappaliban egy cserépkályha is van, ami igény szerint használható. Rezsi alacsony a kellemes meleg ellenére. A 394 nm-es telken, szerelőaknával rendelkező nagy garázs, és melléképületek vannak, víz, ipari áram, gáz bevezetve. Dryvit szigetelés van a házon. Riasztóval felszerelt ház. Fúrt ... további részletek >>

kúttal a locsolás és egyéb megoldható. Központi helyen van a közlekedése is kiváló. 5-10 percre 54, 55, 84E, 89E, 94E, 166, 166A, 254E, 266, 294E, buszjáratok,10 percre a vasútállomás amivel a Nyugati pályaudvar 35 percre van. Központi rendelőintézet, iskola, óvoda, Posta, bankok, boltok, bevásárló központok a közelben. Érdeklődni, hétköznapokon +36704281107 vagy +36307449824 telefonszámon és a szabopap.judit@gmail.com email címen lehet.


Feladva: 2017-11-18    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vangázpercreKözpontimelegházbevásárlófelszereltpedigNyugatimelléképületekkonyhajudit@gmail84ERezsiutcaboltokRiasztóvalvizetamivelgarázsnagy

Forrás: pepitahirdeto.multiapro.com

Eddig az MLM-ben az új emberek látták el pénzzel a már meglévő hálózatot. Nálunk ez most megfordul, az MLM történetében először: a már bent lévő, kereső emberek segítik meg az újonnan érkezőket!!! Sőt arra sem kérlek hogy abba amit már elkezdtél. Érdekel hogyan? Nézd végig a 8 perces videót és csatlakozz pénzügyi kockázat nélkül! www.youtube.com/watch?time_continu e=6&v=1t-isPFBqLA


Feladva: 2017-10-04    [Pénzkeresés - MLM]

Címkék, kulcsszavak: máremberekMLMhogyanKONCEPCIÓérkezőketmegfordulwwwÉrdekelÜZLETIújonnanmosthttpselkezdtélLEHETŐSÉGmegNálunknélkülsegítikkockázathálózatotamit

Forrás: pepitahirdeto.multiapro.com

Frappáns – vicces és hasznos ajándék ötletek nagyon jó áron Mindenkinek! Ha csak ötletekre vágysz, akkor is szívesen látunk weboldalunkon vagy facebook oldalunkon! Nálunk minden alkalomra találsz jó ötletet, legyen az születésnap, névnap, karácsony, évforduló, Valentin-nap, nőnap, ballagás, házavató! Kínálatunkat folyamatosan frissítjük. Személyes átvételi lehetőségünk Budapesten, a Márton utca 5. szám alatt, ahol kipróbálhatod termékeinket. Honlapunk: http://atomzsir.hu


Feladva: 2016-09-30    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: atomzsirajándékötletekkipróbálhatodlátunkfolyamatosanhasznoslegyenaholszívesenKínálatunkatviccesötletetalattakkorházavató8211találszszámvágysz

Forrás: pepitahirdeto.multiapro.com

A reggeli futás hatásai a nap további részére azontúl, hogy megadják a kellő lendületet, még szellemi teljesítményünket is képesek javítani. Ha lassú tempóban végezzük, szervezetünkben felszabadul a kreativitás hormonja, melynek nagy hasznát vehetjük a napi problémák megoldásában. A futás és zsírégetés közti kapcsolat sokak számára a legnagyobb ösztönzést adja ahhoz, hogy ezt a mozgásformát válasszák. A megfelelő pulzusszámot elérve beindul a zsíranyagcsere, ennek köszönhetően érhetjük el a ... további részletek >>

szép, tónusos izomzatot. Futás kezdőknek és haladóknak - hasznos tippek weboldalunkon!


Feladva: 2016-11-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Futászsírégetéshogyköztitónusosfelszabadulmozgásformátkellőszépszervezetünkbeneztmegadjákmegoldásábanérhetjükvégezzükazontúlproblémákköszönhetően

Forrás: pepitahirdeto.multiapro.com

Kedves Vendégek! Sok szeretettel várjuk Önöket a Büki Gyógyfürdő bejáratától 250 m-re található apartmanházainkban!


Feladva: 2016-08-17    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SzállásÖnöketvárjukszeretettelSokVendégekapartmanházainkbanKedvestalálhatóBükfürdő250ApartmanbejáratátólMolnárGyógyfürdőBükfürdőnBüki

Forrás: pepitahirdeto.multiapro.com

VATTACUKOR ÁRUSÍTÁS MEGRENDELÉSE RENDEZVÉNYEKRE! Az új édesség „Fairy Floss” magyarul annyit tesz: TÜNDÉRPEHELY. Gyermek-napok, koncertek, falu-, városnapok, családi napok, rendezvények rendszeres, megbízható résztvevői vagyunk! Manapság egy rendezvény már nem is képzelhető el vattacukor nélkül! Árainkat megegyezés szerint alakítjuk! Gépeink az összes élelmiszer higiéniai követelménynek megfelelnek! Számlaképesen várunk minden megrendelést, ahol arra szükség van.


Feladva: 2017-05-04    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: vattacukorRENDEZVÉNYEKREMEGRENDELÉSEÁRUSÍTÁSnapokmárszükségvárosnapokösszes8222rendezvényarrafaluGépeinkédességegyaholkoncertekalakítjukGyermek

Forrás: pepitahirdeto.multiapro.com

Új és használt ipari csavarkompresszorok széles választékban! - 5,5 kw-tól 150 kw-ig - gyári új - felújított kompresszorok garanciával - alap gép - frekvencia váltós - légtartály - hûtveszárító - országos szervíz szolgálat 690.000.- Ft-tól Pitair KFT Tel: 06-20-330-6665 www.pitair.hu


Feladva: 2017-04-26    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: pitairKFTtólszervízlégtartályszélesTelváltóscsavarkompresszorokfrekvenciaiparigéphasznált000alapRáckeve690garanciávaljavításszolgálatországos

Forrás: pepitahirdeto.multiapro.com

Állást keres? Vizsgázik? A táblázatkezelés, az adatbázis-kezelés egyáltalán nem nehéz! Meg fogja látni, mennyire egyszerű az Excel, az Access, vagy a Word, a PowerPoint. Milyen szép dolgokat lehet Corel vagy Flash segítségével létrehozni. Egyszerűen, gyorsan megérthető. Forduljon hozzám! Tapasztalataim szerint az egyéni foglalkozás előnye, hogy kevesebb idő alatt, hatékonyabban lehet elsajátítani az új ismereteket, mivel csak Önre figyelek, mindennel csak addig foglalkozunk, ameddig ... további részletek >>

Ön igényli, nem kell senkihez sem igazodnia. Fontos előny az is, hogy nincs ”kihagyott” óra. Csoportban, ha Ön nem ér rá, nem tud az órára eljönni, a csoport halad tovább, Így Önnek, ha a lépést tartani akarja, pótolnia kell a kimaradt óra anyagát. Szívesen tanítok csoportokat is, ebben is hosszú múltra tekinthetek vissza.


Feladva: 2016-07-21    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nemtáblázatkezeléshogyóravagykelllehet8221kezelésadatbázisEgyszerűencsakkevesebbtovábblétrehoznimindennelExcelanyagátelőnyeVizsgázikhalad

Forrás: pepitahirdeto.multiapro.com

Non Stop Lakatos Budapest! Non-Stop Zármentés Budapest. A Non Stop Zárszerviz Budapest és környéke vállalja zárak cseréjét és javítását, postaládák zárcseréjét. Hevederzárak szerelése, javítása. Ellopták a kulcsait?Illetéktelen személyhez került a kulcs? Zárcsere!Ne váljon betörés ill. lopás áldozatává! A zárcserére és a biztonságtechnikára fordított összeg, többszörösen megtérülhet! Minket éjjel-nappal hívhat, mindig fix árakon dolgozunk. Munkánkról és a beépített anyagokról mindig ... további részletek >>

számlát és garanciát adunk! Tehát zárcsere, zárszerviz, lakatos munkák, vagyonvédelem és hevederzár szerelés Budapesten. Zárjavítás Budapest 0-24! Műanyag bejárati ajtó javítás és zárcsere. Felhúzó kilincses ajtók javítása és zárcseréje garanciával. HI-SEC ajtó zárcsere és javítás. Az elvégzett munkára és a beépített anyagokra garanciát adunk! Hevederzárak kínai ajtókra is! Kínai ajtó zárcsere és javítás. Hívjon bizalommal, minőség és szakértelem megfizethető áron! Hevederzár szerelés Budapesten és Pest Megyében. Minőségi hevederzárak kedvező áron, akár 3 év garanciával. Gyors és precíz, kiváló szakmunka a hevederzár specialistától! Személyre szabott vagyonvédelmi szaktanácsadás. A legjobb hevederzár árak! Biztibuk hevederzár, Prezidium hevederzár. Hevederzár zárbetétek kedvező áron. Hevederzár zárcsere, olcsón minőségi anyagokkal. Hevederzárak műanyag ajtókra is!!! Hevederzár kínai ajtóra is!!! Hívhat non-stop!


Feladva: 2016-10-12    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: HevederzárzárcserenonStopBudapestHevederzárakkínaizárszervizjavításajtóáronlakatosajtókraműanyagjavításagaranciávalmindigminőségiadunkgaranciát

Forrás: pepitahirdeto.multiapro.com

Bécsi úti referenciaszalonba felelősségteljes, munkájára igényes lelkes és kreatív, a szakma iránt elkötelezett fodrász munkatársat keresünk! Ha érdekelnek a vegyszermentes csúcs technológiák, és a környezet tudatos anyagok, és szeretnéd a legjobbat ajánlani vendégeidnek, nálunk a helyed! Elérhetőség: 20/ 323-7254-s számon!


Feladva: 2017-05-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkanyagokirántBudapestszámontudatosszakmaGabriella7254környezetkreatívNovotni323technológiáklelkesFodrásztElérhetőségcsúcsigényeshelyed

Forrás: pepitahirdeto.multiapro.com

Mixerbeton bedolgozás meggyorsításához és könnyebbé tételéhez rendelhet nálunk betonszivattyút huszonhárom méteres gémhossztól egészen ötven méteresig, melyeket igény esetén meg is lehet hosszabbítani földre fektetett csövek összeszerelésével. Óradíjainkat megtalálja weboldalunkon mixerbeton árlistánkban!


Feladva: 2014-01-16    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: mixerbetonbetonarwwwlehetbetonszivattyútárlistánkbanmegnálunkeseténrendelhetweboldalunkonigénytételéhezmegtaláljamelyeketkönnyebbéÓradíjainkatötven

Forrás: pepitahirdeto.multiapro.com

Minőségi 4-8 tojásos leves és köret tészták kaphatók, megrendelhetők. A termékek hagyományos összetétellel, de modern technológiával készülnek! 100% Magyar Termék!


Feladva: 2016-10-10    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: kaphatókTerméktésztákMagyarköret100leveskészülnektojásostechnológiávalMinőségimodernKondorosösszetétellelkondorositesztahagyományosgyártótól

Forrás: pepitahirdeto.multiapro.com

Palatetõ tisztítás, festés, javítás, felújítás cseréptetõ tisztítása festése felújítása Cserepes és trapéz lemeztetõk tisztítása festése! Garanciával!


Feladva: 2017-03-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 245festésetisztításatrapézmegszüntetéseCserepesBeázásokfelújításacseréptetfelújításjavításGaranciávalfestéstisztításPalatetLajoslemeztetKocsis

Forrás: pepitahirdeto.multiapro.com

Számtalan pénzkeresési lehetőség van arra, hogy otthonról dolgozva jövedelmed legyen. A weboldalon megosztok veled néhány ötletet, lehetőséget ebben a témában. Bővebb információ a weboldalon: http://allasokotthon.uw.hu/


Feladva: 2016-07-18    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: weboldalonotthonrólvanötletetlehetőségnéhánypénzkeresésiveledSzámtalanallasokotthonmegosztokálláshttplegyenmunkaajánlatokjövedelmedvégezhetőBővebb

Forrás: pepitahirdeto.multiapro.com

Legyen igényes autójára, nem mindegy a megjelenés! Nézzen be hozzánk, minőségi munka, korrekt árak. Kérjen időpontot, hogy ne kelljen várakoznia. Kézi autómosó, Sárvár.(a régi Opel szervízben) www.tibronc.wixsite.com/kezi-autom oso-sarvar


Feladva: 2017-03-03    [Autó - Motor - Jármű]

Címkék, kulcsszavak: SárvárkeziNagyrégiminőségiSzombathelyihozzánksarvarautómosóNézzenautomosovárakozniamegjelenéskelljenmindegycomhogynemwixsiteidőpontotautójára

Forrás: pepitahirdeto.multiapro.com

Elkötelezettségünk a szeműveg szerelmeseinek a mindennapjait megkönnyiteni, hogy könnyen gyorsan a legjobb minőség eljusson otthonába! Webáruházunkban optikai keretek, illetve napszemüvegek közül választhat.


Feladva: 2017-09-02    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: 8221INGYENESszeptemberbenegészkeretregyermekmindenISKOLA30SzemüvegfutárkódotakcióeztIskolakezdésiHasználdSZÁLLÍTÁSSAL

Forrás: pepitahirdeto.multiapro.com

A fogyókúra étrend követése során el kell felejtenünk a cukrot. Míg korábban a kávét, a kakaót, a teát előszeretettel cukroztuk, nem beszélve a házilag készült süteményekről, melyekből szintén nem sajnáltuk a fehércukrot, a fogyókúra étrend valami egészen másnak a kezdete. Egy olyan életmódnak, melyben a cukrot egészségesebb édesítővel váltjuk fel vagy hozzáadott formában teljesen kiszorítjuk a mindennapjainkból. Érdemes vásárláskor is odafigyelni arra, hogy az egyes termékek címkéjén mennyi ... további részletek >>

hozzáadott cukor van feltüntetve. Meg fogunk lepődni, hogy még az egészségesnek vélt paradicsompüré is nagy mennyiségben tartalmazza! Fogyókúra étrend tanácsok itt!


Feladva: 2017-08-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: étrendFogyókúracukrotnemhozzáadottméghogyfogyókúrásfeltüntetveÉrdemeskávéttartalmazzamelybenittvanszinténmindennapjainkbólkorábbanmennyiségben

Forrás: pepitahirdeto.multiapro.com

Yerba Mate Tea ------ yerbamate.hu ------ A mate tea egy 100% természetes, egészséges energia ital! Nagy segítség minden futónak és rendszeres fizikai tevékenységet végzőnek. A mate tea növeli a kitartást, a fizikai teljesítőképességet és javítja a hangulatot. A természet alkotta, mi juttatjuk el hozzád! Tudj meg többet oldalunkon: yerbamate.hu


Feladva: 2016-10-21    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teamateyerbamatetermészetesfizikaiTudjegészségeshozzádjuttatjukvégzőnek100alkottatevékenységetegytermészetrendszeresYerbahangulatotfutónakNagy

Forrás: pepitahirdeto.multiapro.com

Ki az ön kedvenc STAR WARS szereplője? A jókhoz húz a szíve, mint Luke Skywalker, Anakin Skywalker, Obi-Wan Kenobi, Yoda, Han Solo, Leia Organa, Padmé Amidala, Jar Jar Binks, Csubakka, Qui-Gon Jinn, Poe Dameron, Finn (FN-2187) vagy Ray? Netán a droidokat - R2-D2, C-3Po és BB-8 - szereti? Esetleg a sötét oldalon álló Darth Wader, Kylo Ren, Darth Maul, Palpatine alias Darth Sidious, Dooku gróf / Darth Tyrannus, Grievous tábornok, vagy Jabba a kedvenc hőse? Böngésszen termékeink között, és találja ... további részletek >>

meg az Önnek vagy Star Wars rajongó családtagjának, barátjának leginkább megfelelő ajándékot. Csillagok háborúja - Star Wars Shop www.starwars.boltaneten.hu


Feladva: 2017-01-18    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: WarsStarDarthvagykedvencJarSkywalkerWebshopBinksstarwarsMaulObicsaládtagjánakNetánJabbahttpRenrajongóRaytábornokAmidalaShopKyloAnakin

Forrás: pepitahirdeto.multiapro.com

Alan speciális mentőként dolgozik, amíg egy nap egy bányaszerencsétlenségnél elveszti a látását. Úgy érzi, kicsúszik lába alól a talaj. Már-már teljesen belesüllyed az önsajnálatba, amikor összeismerkedik egy fiatal tanárnővel, aki képes őt pocsék állapotából kirángatni. A nőnek sem könnyű, hiszen ő meg egy autóbalesetben sérült meg. Kapcsolatuk hát nem mindennapi, de újabb fordulat történik: találnak egy donort, így a férfi visszanyeri látását. Vajon kapcsolatuk az újabb fordulat ellenére ... további részletek >>

megmarad olyannak, mint a kezdetekkor? http://adamobooks.com/termek-Vakon-szeretni-87.html


Feladva: 2016-09-30    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: egykapcsolatukmárcomadamobookslátásátmegszeretnifordulatVakonújabbamígmindennapitermekállapotábóldolgoziknempocsékVajontalajmentőkénthát

Forrás: pepitahirdeto.multiapro.com

Gázkészülékek, Eladás, Gázkészülék Alkatrész, Gorenje, Vendéglátóipari Gép, Hőtárolós Kályha, Gázkészülék, Klímatechnika, Klímaberendezés, Pelgrim, Elekthermax, Nagykonyhai Gép, Konyhafelszerelések, Javítás, Szerviz, Ipari Fűtéstechnika, Pelgrim Klíma, Teka, Háztartási Gép.


Feladva: 2014-02-07    [Lakossági szolgáltatás]

Címkék, kulcsszavak: PelgrimSzervizGépXIVCímGázkészülék4009Iparitől4000470TelŐrnagyKlímaberendezésTekaKlímatechnikaKlímaemaxKályhahttpFűtéstechnikaHőtárolós

Forrás: pepitahirdeto.multiapro.com

Segítünk berendezni, kérje Önnek szóló ajánlatunkat: www.hu-mago.hu/boltok-tervezese-sz erelese Vállaljuk boltok: felmérését, tervezését, látványterv készítését, összeszerelését, bontását. Szolgáltatásaink: » Boltok tervezése, szerelése » Bevásárlókocsi felújítás » Galvanizálás » Raktári állvány építés » Sorompó telepítés Új és használt forgalmazott termékeink megtekintéséhez látogasson el weboldalunkra!


Feladva: 2017-04-17    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 187BoltokszerelésetervezéseösszeszerelésétkérjeállványkészítésétweboldalunkraberendezniRaktárilátványtervlátogassonSegítünkGalvanizálástervezésétmago

Forrás: pepitahirdeto.multiapro.com

Otthon végezhető internetes munka. Javaslom jövedelem kiegészítésként. Semmi más dolgod nincs, csak 4 jegyű kódokat beírni. Nincs regisztrációs díj, nem kell eladni és értékesíteni sem. Fizetés egy kód után 10 cent, idő ráfordítástól függően. 2-3 óra alatt akár 30 ezer forint is lehet. Ha érdekel, ezen a linken tudsz regisztrálni: www.moduredrse.win/3885730528703/


Feladva: 2017-11-16    [
Pénzkeresés - MLM]

Címkék, kulcsszavak: Nincsforintmunkaegy3885730528703kódokatezerinternetesFizetéswinjegyűakárvégezhetősemmoduredrsecsakalattOtthonértékesítenihttpdolgodóramás

Forrás: pepitahirdeto.multiapro.com

Ha Ön és cége, vállalkozása > termékeinek, valamint szolgáltatásainak új piacot keres > szabad kapacitását szeretné lekötni > szellemi termékeit szeretné értékesíteni > Telephelyét, ingatlanát óhajtja eladni > együttműködésre törekszik külföldi cégekkel > képviseletet óhajt külföldön > reklámra, vagy telemarketingre van szüksége, akkor cégünkben megbízható partnerre talál!


Feladva: 2016-02-13    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: szeretnéképviseletettermékeitmegbízhatócégecégekkelszellemicégünkbenPartnerkülföldilekötniakkorBusinesstörekszikkapacitásátszükségeEuroszabadvan

Forrás: pepitahirdeto.multiapro.com

Vezetőket és munkatársakat keresek online munkához. Számodra mi a legfontosabb: - egészség? - pénz? - szabadidő? - anyagi függetlenség? Nem kell választanod, mert kitartó munkával mindegyik elérhető . Csatlakozz a Moringa Life csapatához. Velünk és egy automatizált rendszer segítségével építsd fel saját üzleted.


Feladva: 2017-06-15    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekVezetőketfelAlizelérhetőpénzépítsdKádármindegyikegészségsegítségévelmunkávallegfontosabbrendszerkitartóSzámodraautomatizáltmertcomegy

Forrás: pepitahirdeto.multiapro.com

Rajtad is múlik, hogy NE legyenek katasztrófák, NE pusztuljon ki a világ! www.onfejlesztes6.webnode.hu/


Feladva: 2017-06-19    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: webnodeRamsbergonfejlesztes6ÉvahttpHalmaivilágNyárinépusztuljonDorfstrkatasztrófákOberelegyenekhogymúlikRajtadBayern

Forrás: pepitahirdeto.multiapro.com

Grundig Vch 9131 2-in-1 14.4V típusú akkumulátoros porszívó. - Nagy teljesítményű és hosszú élettartamú 14,4 V-os NiMH újratölthető akkumulátor - Nagy teljesítményű elektromos kefe - Működési idő: Kb 25perc - Portartály: 500ml - Hatékony szűrőrendszer ciklontechnológiával és mosható HEPA szűrővel - Kivehető morzsaporszívó - Számlával, fél év jótállással és 14 napos pénz visszafizetési garanciával. Ingyenes házhoz szállítással megrendelhető az alábbi linken: ... további részletek >>


Feladva: 2017-09-18    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: akkumulátorosporszívó9131teljesítményűVchNagyGrundigporszivokIngyenesKivehetőakkusMűködésiházhozszűrővelkefetípusúszállítássalHEPAelektromoswww

Forrás: pepitahirdeto.multiapro.com

RASZTA haj (dreadlock) - készítés (póthajjal is) , - javítás, - karban tartás, - nagygenerál, - hosszabbítás... Sokéves intenzív szakmai tapasztalattal, profiktól, a Westendnél! Speciális, ragacsmentes technikával dolgozunk! Minden infót megtalálsz a Honlapon, időpontért írj üzenetet itt! www.facebook.com/HaircoholiX.Szalo n


Feladva: 2015-07-29    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: rasztaHaircoholiXcomprofiktólkészítéshttpjavításírjWestendnélpóthajjalidőpontértoldalontapasztalattalSzalondreadlockszakmaihajmegtalálszintenzív

Forrás: pepitahirdeto.multiapro.com

A Penda 1997. februárjában a Betéti Társaság-ból Kft.-vé alakult, mely a mai napig is 100%-ban magyar tulajdonban van. A vállalat immár 20 éve a termelőeszköz forgalmazók és felhasználók igényeinek kielégítésére törekszik. Húzó termékeink: rendsodrók, szárzúzók, ekék, traktorok, rendkezelők, kaszák, bálázók, pótkocsik, permetező gépek, vetőgépek. Négy telephelyen, Békéscsabán, Kecskeméten, Kiskunmajsán és Nagykőrösön szerződéses partnereink raktározzák és adják ki áruinkat.


Feladva: 2017-08-31    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: PendaKftekékszárzúzókrendsodrókáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetétitörekszik

Forrás: pepitahirdeto.multiapro.com

Hordozható, vezeték nélküli, újratölthető. 6 hónap garanciával. A készüléket ott használhatja, ahol Önnek szüksége van rá. Többé nem szükséges a gyakran túl rövid áthidalókábelekkel vesződnie. A Start-Booster (12 V) segítségével azok az autók, teherautók, vagy generátormotorok is könnyen újraindíthatók, melyek nehezen hozzáférhető, vagy távoli helyen állnak. A bikázót 12 V-os szivargyújtó kábellel is újra lehet tölteni és mint hordozható energiaforrást is lehet használni. Postai utánvéttel is!


Feladva: 2016-09-20    [Autó - Motor - Jármű]

Címkék, kulcsszavak: hordozhatólehetvagymintÖnneknehezenAUTÓvesződnietölteniaholmelyekATLASZáthidalókábelekkelújrahasználhatjaújraindíthatókbikázórövidkábellelott

Forrás: pepitahirdeto.multiapro.com

Kiadó próbatermek Csepelen! Érdeklődni: telefonon!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: próbatermekKiadóÉrdeklődniCsepelenBudapestTulajpróbateremtelefonon

Forrás: pepitahirdeto.multiapro.com

Modern mégis minden igényt kielégítő konyhabútor, fürdőszoba bútor, egyedi bútor, gardróbszekrény tervezése és teljes körű kivitelezése. Igény szerint 3D látványterv készítés ingyenesen minden bútorhoz! Szükséged lenne egy modern konyhabútorra, fürdőszoba bútorra, gardróbszekrényre? Nálunk mindezt kompletten megrendelheted. Ingyenes és kötelezettségektől mentes árajánlat kérés a weboldalunkon, vagy akár üzenetben! Weboldal: www.londonbutor.hu Email: i nfo@londonbutor.hu


Feladva: 2016-10-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: mindenbútoregyedifürdőszobamodernIngyeneslondonbutorhttptervezéseweboldalgardróbszekrénymindeztLondonkattintvaNálunklátványtervvelingyenesenvagy

Forrás: pepitahirdeto.multiapro.com

Összkomfortos 3 szobás ház eladó! Nagy kerttel és melléképülettel rendelkezik.


Feladva: 2017-08-15    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: OldigeszrendelkezikKépírónémelléképülettelmesszekerttelnincsNagyBalatonhozeladóházszobásÖsszkomfortosSzentgáloskérIbolya

Forrás: pepitahirdeto.multiapro.com

Cégünk kárpitozott bútorok gyártásával foglalkozik. Nyitható, forgatható, ágyazható sarokgarnitúrák, 3-2-1 ülőgarnitúrák, kanapék, heverők, franciaágyak szivacsos, rugós kivitelben. Több száz fajta szövetből, bőrből, textilbőrből válogathat. Bútorainkat egyedi méretben is elkészítjük, vagy hozott kép alapján is megtervezzük az Ön igényeinek megfelelően!


Feladva: 2016-09-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: textilbőrbőlkanapékmegtervezzükkerbőrbőlülőgarnitúrákalapjánBudapestszövetbőlsarokgarnitúrákképKftfajtaágyazhatóhozottBútorszázforgathatóvagy

Forrás: pepitahirdeto.multiapro.com

Saeco, Jura, Solis használt automata kávégépek forgalmazása, javítása. Minden kávéfőzőre 6 hónap garancia. Országos házhoz szállítás. Ár: 35.000 HUF.-tól. Házhoz szállítás 2.000 HUF. www.caffeshop.hu/index.php/caffesh op


Feladva: 2015-04-27    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: HUFautomataJuraSaecocaffeshopMindenNagywwwjavításakávéfőzőkforgalmazása2000kávégépekszállításHázhozhasználttólSolis35000garanciahónapSásd

Forrás: pepitahirdeto.multiapro.com

A mai - sokak szerint torz - Alaptörvény is rögzíti, hogy Magyarországon a legfőbb döntéshozó a Parlament! 2018-ban választások lesznek... Nap mint nap látod a direkt és indirekt ajánlatokat arra, kire és melyik pártra szavazz. Hogy milyen sokat tett már érted az egyik és milyen sokat fog a másik... Szinte biztos, hogy ezek a kampányszövegek csak a fül simogatására szolgálnak! Válassz inkább olyan képviselőt, aki a környezetedet ismeri és képviselni akarja a Te gondjaidat. Ha pedig ... további részletek >>

nem jól teszi, nem képvisel Téged, akkor elérhető a számodra, hogy meg tudjad kérdezni, amikor csak akarod, hogy miért nem teszi! Egyet ne tegyél! Azt, hogy nem mész el szavazni! Azonnal be fog a kihagyott helyre türemkedni valami olyan erő, amely biztosan nem a Te érdekeidet fogja képviselni! A választás egy olyan alapjog, mint a levegővétel. Természetes és az élethez szükséges! A vezérek kora már rég elmúlt... Olyan Parlament kell(ene), ahol minden Magyarországon élő embert képviselnek az ország házában!


Feladva: 2017-02-06    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: jelentkezésétországgyűlésivárjukforinthogyjövőkapcsolatbadolgokegymillióbelőleLépjkezedbeösszegyűjtőkneklettképviselőjelöltjeicímresajátaláírást

Forrás: pepitahirdeto.multiapro.com

----Pick téliszalámi reklám áron! ---- Pick eredeti téliszalámi ára : 4390 Ft/kg Herz eredeti téliszalámi ára : 4390 Ft/kg Csongrádi füstölt kolbász ára : 1190 Ft/kg Pick paprikás szalámi ára : 990 Ft/db ---- Budapest XI. Bocskai út 42 sz. ----- ---- Telefon: 061/3611-609 ---- Web: http://www.lazarhus.hu Email:lazarhusmintabolt@gmail.com< /a>


Feladva: 2016-08-16    [
Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: áraPicktéliszalámiLázár4390Budapesteredetiszalámi1190Hús3611kolbász061füstöltárakTelefonCsongrádicomHúsboltBocskailazarhusmintabolt@gmail

Forrás: pepitahirdeto.multiapro.com

Szeretném eladni ezt a szekrényt! Több, mint 100 éves, fából készült! Hibátlan állapotú! 40.000.- Ft. (a kombinált rész három vízszintes részből áll, szállítható!) Egerben található! Érdeklődni: 20/9680-016.


Feladva: 2017-10-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 100mintTöbbEgerbenévesELADÓrészbőlSZEKRÉNYvízszintesháromrészszekrényt016kombináltezt9680000eladniÉrdeklődniállapotúSzeretnémtalálhatóáll

Forrás: pepitahirdeto.multiapro.com

Rövid- és hosszú ujjú bababody rendelhető kiváló minőségben és mosást tűrő nyomással, felirattal, többféle mintával. Rocker és motoros babáknak is, online rendeléssel. Webáruházunkban leadott rendelését 3-5 napon belül kiszállítjuk az ország bármely területére. www.rockpont.polomania.hu/termekek /4857_Babaruha-Rocker_es_motoros_be bibody


Feladva: 2017-08-24    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: motorosbababodyRockerujjúkiszállítjukmintávalhosszúbelültöbbféleRövidnaponfelirattalBudapestrendelésétnyomássalRockPontleadotttűrőbébiknek

Forrás: pepitahirdeto.multiapro.com

LOVAT SZERETŐ személynek etető, trágyázó, gondozó állás + BETANÍTOTT MUNKÁS (kb.50-50%) Keressük azt a lovakhoz értő személyt aki eteti, trágyázza és gondozza a tulajdonos lovait és utána betanított munkásként dolgozik az üzemben. (csomagol, pakol, stb- és itt van bejelentve) A Munka Mannheim-nél van. Német nyelvtudás (erős A2) szükséges. Magyar a cégnél nincs. Ez az állás NINCS fenn a weboldalunkon. Ennél a cégnél van CNC kezelő és HEGESZTŐ állás is. (15€ bruttó-tól) TÖBB INFÓ rólunk: ... további részletek >>

www.nemetmunka.hu A lóápoló / betanított munkás kezdő fizetése11€-bruttó-tól, megegyezés szerint. Állásainknál mindig direkt a német cég a munkaadó! (NEM Zeitfirmák, mert munkaerőkölcsönzőkkel nem dolgozunk.) A munkaközvetítés ingyenes. A szállás megoldott. Hosszútávú Németországi munkát keresőket keresünk Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1./ E-mailben: info@nemetmunka.hu 2./ Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3./ Telefonon munkaidőben a magyar 06 1 920 3433 ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9,00-17,00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-11-13    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németbetanítottMunkanemetmunkaálláswwwnincsvanmunkásTeamIngyeneslóápolómailbentólmagyarnembruttócég8364Telefononvagycégnéldirektstb

Forrás: pepitahirdeto.multiapro.com

Üdvözölünk, minden kedves vásárlót, a háztartási eszközök való világában. Kellemes böngészést, és vásárlást kívánunk! - Kerámia termékek - Konyhai felszerelés - Elektromos cigaretta - Virágtartó kellékek - Takarító eszközök - Üveg, porcelán étkészlet


Feladva: 2017-04-27    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: eszközökvalóAkciósElektromosháztartásifelszerelésvásárlótKonyhaikedvesétkészlettermékekmindenporcelánKerámiaÜdvözölünkÜvegkívánunkMagyarország

Forrás: pepitahirdeto.multiapro.com

Évjárat: 2013/07 Állapot: Megkímélt Kivitel: Ferdehátú Futott kilométer: 97253 km Műszaki vizsga érvényessége: 2019.07.02 Üzemanyag típusa: Benzin Hengerűrtartalom: 1596 cm3 Teljesítmény: 117 kW / 160 LE Sebességváltó: Manuális 6 fokozat Belső felszereltség: CD-s rádió, elektromos ablak, elektromos tükör állítás, állítható kormány, multikormány, ülésmagasság állítás, elektromos ülés állítás, bluetooth-os kihangosító, vezetőoldali légzsák, utasoldali légzsák, oldal légzsák, ... további részletek >>

függönylégzsák Műszaki felszereltség: ABS, ASR, ESP (menetstabilizátor), szervokormány, immobiliser,központi zár Külső felszereltség: metálfény, színezett üveg, ködlámpa Még jobb választás, mert... Magyarországi, rendszeresen karbantartott, keveset futott, nem dohányzó, garázsban tartott, szerviz könyv, első tulajdonostól MAGYARORSZÁGI LEINFORMÁLT GÉPKOCSI KILOMÉTER GARANCIÁVAL! www.autodual.hu/index.fcgi?rx=&menuparam5=20&item=340_1#item


Feladva: 2017-09-28    [Autó - Motor - Jármű]

Címkék, kulcsszavak: légzsákállításelektromosfelszereltségKILOMÉTERfutottMűszakiitemMAGYARORSZÁGI97253tulajdonostólkormánySCTirendszeresenTeljesítménymenuparam5zároldal

Forrás: pepitahirdeto.multiapro.com

A magyar fejlesztésű és gyártású KREA gravitációs kéményrendszer a családi házak ideális kéménye. A kéménybe beköthető bármikor szilárd tüzelésű (cserép) kályha, kandalló, vagy akár kazán. Alkalmas atmoszférikus gázkészülékek füstgáz elvezetésére is, de megfelelő kiegészítőkkel egyszerűen és olcsón alkalmassá tehető turbós, ezen belül kondenzációs kazánok füstgáz elvezetésére égéslevegő ellátással együtt. Kedvező ár, hosszú élettartam, Kivitelezése egyszerű, akár saját kezűleg is elvégezhető. A ... további részletek >>

termékre 30 év garanciát vállalunk. A műszaki dokumentációk megtalálhatóak a Szegedi Székhelyünk és a Dunántúli Telephelyünk honlapjain! Országos házhoz szállítás : 12 000 Ft. Magyar Kéménygyártó Kft. Tüzeléstechnikai szaküzlet 8638 Balatonlelle, Kossuth Lajos utca 50/A Nyitva : H-P 8.00-16.00-ig. Tel.: 0630/8492544 www.kemenygyarto-balatonlelle.hu www.kemenygyarto.hu


Feladva: 2016-08-19    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: balatonlellekemenygyartoelvezetéséreKREAwwwfüstgázakárMagyardokumentációkAlkalmasélettartamkéményeTel000ezeneladóműszakikazánhosszúideálisKft

Forrás: pepitahirdeto.multiapro.com

Cégünk a nagy múltú olasz Eva Calor termékeit forgalmazza,melyek közt találhatók légbefúvásos és csatornázható pellet kályhák, kandalló betétek, vízteres pellet kályhák. Működésük korszerű elektronikának köszönhetően teljes biztonság mellett automatikusan történik. Pellet kályháink mellett szóló érvek: automatikus gyújtás, működése előre beprogramozható akár a hét mindennapjára, a leggazdaságosabb modern fűtési technológia, a gyorsan elért beállított hőmérséklet után EKO üzemmód vagy STAND BY ... további részletek >>

állapot, rendkívül magas hatásfokú és környezetbarát megújuló tüzelőanyaggal működő készülékek. A ma elérhető automata fűtési rendszerek közül a legolcsóbb a pellettel való fűtés!


Feladva: 2017-09-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: pelletkályháknagyfűtésimellettautomatikusantüzelőanyaggalhétmúltúEKOkandallótörténikműködőmindennapjáraolaszüzemmódbetétekkályháinkkészülékek

Forrás: pepitahirdeto.multiapro.com

Kútfúrás. Engedélyes kutak fúrása. Víznyelők fúrása kedvező áron! Bízza szakemberre! Tökölön, Dunaharasztiban, Soroksáron. Kézi és gépi kútfúrás. Csepel-szigeten és környékén. Budapesten és környékén. Szentendrei szigeten, Pest megyében. Minőségi anyagokkal és szűrőkkel. SZAKMUNKA, precíz kivitelezés, megfizethető árak. Cső átmérő: 40 mm-től 125 mm-ig. Hívjon bizalommal!


Feladva: 2014-09-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kútfúrásfúrásamegyébenPestszigetenMegfizethetőkörnyékénáronkedvező9642PrecízCsepelbizalommalSZAKMUNKAVíznyelőkHívjonszűrőkkelgépikutak125mm

Forrás: pepitahirdeto.multiapro.com

Az EveNue a budapesti jelmezkölcsönző, ahol a változatos jelmezek között válogathatsz. Itt megtalálod a stílusodnak és alkalomnak megfelelő jelmezt! Farsangi jelmez, Halloween jelmez, party kellék, Star Wars jelmez, Darth Vader jelmez, kalóz jelmez, cica jelmez, boszorkány jelmez, pókember jelmez...


Feladva: 2016-10-05    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: jelmezjelmezkölcsönzőEveNuekellékpartycicamegfelelőbudapestikalózalkalomnakVaderstílusodnakVIIDarthmegtalálodBudapestWarsIttStarválogathatsz

Forrás: pepitahirdeto.multiapro.com

Vendégházunk a Dunakanyarban, Börzsöny egyik legszebb részén található, ahol patakcsobogásra és madárdalra ébredhet. Az emeleten három szoba várja a Kedves Vendégeket. Téli börzsönyi túra után meleg szaunával, nyáron fűtött medencével tesszük komfortossá a nálunk töltött napokat. A gyermekek örömére, előttünk jár a királyréti kisvasút. Szeretettel várjuk mindazokat, akik nyugalomban, jó levegőn, családias környezetben szeretnék szabadságukat eltölteni.


Feladva: 2016-04-01    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: börzsönyimedencévelpihenésszabadságukatvárjakirályrétiegyikfűtöttszeretnékszobajárBörzsönynyáronkörnyezetbenháromelőttünkDunakanyarbanszaunával

Forrás: pepitahirdeto.multiapro.com

Befektetőt, társat keresünk, 50-100 Mft-tal, azonnal kezdhető társasházak építéséhez, közre működéssel vagy a nélkül. Biztos megtérülést, garanciát, biztonságot ajánlunk. Biztosan Ön is tudja, hogy most lakásokba megéri befektetni. Jelentkezni a haza i@upcmail.hu e-mail címen.


Feladva: 2017-10-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: építéséhezkeresünkBefektetőthogyközrepesttudjaKftBiztosantársasházakcímenFinancialajánlunkkezdhetőmailEurópabiztonságotazonnalhazai@upcmailtal

Forrás: pepitahirdeto.multiapro.com

Angol - igény szerint, minden szinten: - nyelvoktatás, korrepetálás, kiegészítő tanítás, - szintentartás, felzárkóztatás, - felvételire, nyelvvizsgára, érettségire, állásinterjúra, pótvizsgára, osztályozó vizsgára felkészítés, - tanulócsoportok mentorálása, konzultáció, - fordítás, - online tolmácsolás (előre egyeztetett idópontban) - az angol nyelvhez és kultúrterülethez tartozó témában célirányos felkészítés Tanítási módszerem: részletes magyarázat, stabil elméleti ... további részletek >>

alapok, házi feladat, gyakorlatorientáltság Óradíj és Fizetés: tanóra: 2700 Ft/50 perc fordítás, tolmácsolás: megegyezés szerint fizetés módja: átutalással bankszámlára Számlaképes vagyok. Rugalmas időbeosztással várom a tanulni vágyókat! A rendszeresség az egyik legfontosabb a nyelvtanulás során. Elfoglalt vagy? Sok a dolgod? Nem probléma: a tanóra időtartama megegyezés alapján akár 20 perc is lehet (ennek megfelelő árral)!


Feladva: 2017-04-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: angoltanórafizetésszerinttolmácsolásfordításpercfelkészítésmegegyezésidőtartamaalapokkorrepetálásegyikkultúrterülethezmódjaosztályozóelméletistabil

Forrás: pepitahirdeto.multiapro.com

100%-os hidegen sajtolt mákolaj eladó a préselőtől: - 1 liter 4.900 Ft. - 0,5 liter 2.500 Ft. - 0,2 liter 1.250 Ft. Bővebb információ honlapunkon...


Feladva: 2016-12-25    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: litereladómákolaj100BővebbPéter250Balogh500900préselőtőlsajtolthonlapunkonhidegeninformáció

Forrás: pepitahirdeto.multiapro.com

Becsületes, nemzetközi üzlet a legnagyobb, piacvezető céggel, a DXN-nel A legjobb minőségű kávé 100% tiszta Ganoderma kivonattal Profi weboldal 16 nyelven a regisztrációval: -minden szükséges tréninganyaggal és -üzletépítéshez szükséges eszközzel Páratlan marketing terv: -folyamatos bónusz felhalmozás, -nincs havonkénti nullázódás! Csatlakozz most: www.kavekiraly.hu/uzleti_lehetoseg


Feladva: 2016-03-03    [Pénzkeresés - MLM]

Címkék, kulcsszavak: Ganodermaüzletnemzetköziszükséges100kávéDXNlehetosegfolyamatosweboldalcéggeluzletitervProfipiacvezetőkavekiralymarketingkivonattallegnagyobbnel

Forrás: pepitahirdeto.multiapro.com

Reménytelennek érzed a nyelvtanulást? Nyelvtanárból sok van. Nyelvészből, a nyelvtant matematikai szinten ismerő tanárokból is... De olyan aki ugyan úgy beszéli a németet, mint a Magyart és jól is tud oktatni, abból kevés van. Ezt azok biztosan tudják akik horribilis összegeket költöttek már nyelvtanfolyamokra és magánórákra. Tudjuk, hogy vannak anyanyelvi tanárok, de ők magyarul nem tudnak, ami sokaknak egy leküzdhetetlen akadály. Nekünk két tanár áll rendelkezésre, akik mindkét nyelvet ... további részletek >>

anyanyelvi szinten beszélik. Egyikőjük 20 éves Németországban élés és tanulás után költözött haza és ad órákat Debrecenben, a másik tanárnő pedig még most is kint él és tanít Skype-on keresztül! Más teendőtök sincs, mint foglalni egy ingyenes próbaórát az alábbi weboldalon keresztül: www.nemetulegynemettol.hu


Feladva: 2016-09-28    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: szintenanyanyelviegyvankeresztülakikmintmásikTudjukérzedbeszéliksincsakadályakiDebrecenbenmagánórákraReménytelenneknemetulegynemettolkevésolyan

Forrás: pepitahirdeto.multiapro.com

Hidraulika importőr cégünk megvételre hirdet: Hidraulika szivattyú, hidraulika pumpa, hidraulika fogaskerék szivattyú, hidraulika axial szivattyú, hidraulika szelep, hidraulika vezérlő, hidraulika útváltó, hidraulika tömb, hidraulika ágyú, hidraulika tőke, hidraulika henger, hidraulika munkahenger, hidraulika teleszkóp, hidraulika billentő henger, hidraulika


Feladva: 2017-10-17    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: hidraulikaszivattyúhengermegvételreágyúcégünktömbimportőrútváltóNagytarcsavezérlőPaszkalszelepPhilippaxialbillentőfogaskerékteleszkóppumpatőke

Forrás: pepitahirdeto.multiapro.com

Ha igen, akkor a lehető legjobb helyen jársz! Az UtazzFillerekért.hu segít benne, hogy a lehető legolcsóbban és legmegbízhatóbb módon foglalhasd le álmaid nyaralását, belföldi utazását, párnapos városlátogatását vagy esetleg a számodra legkedvezőbb repülőjegyet. Egyszerűen fogalmazva: levadásszuk Neked a legjobb ajánlatokat! Kell ennél több? Csapatunk tapasztalt, profi utazókból áll, akik az elmúlt évtizedben bejárták a világ összes kontinensét és rengeteg tapasztalatot halmoztak fel, ... további részletek >>

megismerkedtek a legnépszerűbb helyekkel és minden fontos infót gondosan feljegyeztek az adott desztinációról. Küldetésünk és célunk nem más, mint hogy a naponta frissülő utazási ajánlatok közül a legjobbakat és a legkedvezőbbeket kiválogatni utazni vágyó közönségünk számára. A wellness hotel, last minute utak és olcsó repülőjegy ajánlatok szövevényes világában ez nem olyan egyszerű feladat, mint aminek hangzik. Az UtazzFillerekért.hu oldalon nem csak a legolcsóbb repülőjegy kínálat, utazási opciók, szállás ajánlatok, vagy akár ingyenes nyaralás lehetőségek érhetők el, de könnyen inspirációt meríthetsz következő utazásodhoz, pihenésedhez is. Exkluzív választékkal jelentkezünk továbbá mind a belföldi nyaralás, mind pedig a külföldi utazás ajánlatok terén. Oldalunkon egyszerűen hozzáférhetsz autóbérlés keresőnkhöz, választhatsz magadnak útikönyvet és köthetsz utasbiztosítást – egyszóval mindent megtalálsz, ami a tökéletes utazás előkészítéséhez szükséges lehet! Belföldi és külföldi utazás ajánlatok egy helyen Ahhoz, hogy naprakész lehess és azonnal kihasználhasd a legkedvezőbb, legizgalmasabb utazási ajánlatokat és belföldi pihenés lehetőségeket, egyszerűen iratkozz fel hírlevelünkre e-mail címed megadásával oldalunk bal felső részén és lájkold Facebook oldalunkat! Amennyiben ajánlataink között nem találsz megfelelőt, szívesen segítünk megtalálni a számodra legjobb repülőjegy és szállás opciót. Írj nekünk bátran!


Feladva: 2016-10-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: ajánlatoklegjobbbelföldinemutazásUtazzFillerekértegyszerűenhogyajánlatokatutazásirepülőjegyvagymintszálláshelyenszámodralehetőlegkedvezőbbmind

Forrás: pepitahirdeto.multiapro.com

Sok szeretettel várunk mindenkit webáruházunkba! Azokat is, akik szeretik a bársonytalpúakat és azokat is, akik az irántuk rajongó barátaikat, vagy hozzátartozóikat szeretnék meglepni az itt található több száz Cickaság valamelyikével. Rugalmas ügyintézéssel igyekszünk a különleges kéréseknek is eleget tenni, valamint többféle fizetési és szállítási móddal tesszük a vásárlást még inkább egyénre szabottá. A Cickaságok köre folyamatosan változik majd a Te igényeid szerint, így várjuk a ... további részletek >>

véleményedet, illetve javaslatokat, amit direkt el is küldhetsz a honlapunkon, továbbá a hivatalos Facebook oldalunkon. (www.facebook.com/Cickasarok.hu)


Feladva: 2017-09-11    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: FacebookCickasarokakikazokatkéréseknekígymeglepnimégwebáruházunkbahivataloskülönlegesoldalunkonszerintszeretnékvásárlástmindenkittovábbáigyekszünk

Forrás: pepitahirdeto.multiapro.com

Vásároljon első kézből a Devon fürdőszobabútorok magyarországi forgalmazójától, nagy és kiskereskedelmi kiszolgálás, kedvező ár! Fürdőszobabútoraink széles választékával várjuk önöket csepeli raktár áruházunkban. Bútoraink festett fényes fehér MDF előlappal rendelkeznek, lapraszerelt állapotban, karton dobozban kerülnek átadásra. www.majerszerviz.hu/furdoszobabuto r.html


Feladva: 2017-09-19    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: furdoszobabutorDevonválasztékávalkézbőlMDFszélesmajerszervizelsőfehérFürdőszobabútorainkwwwVásároljonfényeskedvezőátadásraajánlófestettkiszolgálás

Forrás: pepitahirdeto.multiapro.com

Kínálatunkban több mint 1000 féle fa bútor. Prémium minőségű tömörfa bútorok, szállítás Magyarország teljes területére.


Feladva: 2017-10-04    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: bútortömörfaPepitaminőségűMirekPrémiumféle1000területéremintteljestöbbMagyarországKínálatunkbanszállításajánlásbútorokHirdető

Forrás: pepitahirdeto.multiapro.com

MTZ-re és más gyártmányú traktorra! Hazai gyártású kiváló minőségű homlokrakodók kedvező áron, 25 - 200 LE–ig, szinte minden traktor típusra, szállítással, üzembe helyezéssel, rövid határidővel, készletről. BB. Junior 1.4 homlokrakodó: Emelőmagasság max.: 3,9 m. Terhelhetőség: 2500 kg. Emelőerő: 1800 kg. Felszereltség: - Traktor típus szerinti adaptációs alváz - Joystick vezérlés - Kihelyezett 3. hidraulikakör - Lengés csillapítás - Szállítás, üzembe helyezés ... további részletek >>


Feladva: 2015-11-09    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: homlokrakodóüzembeTraktorhelyezés200szerintiJuniorárontípuskészletrőlSzállításkedvezőhatáridővelcsillapításhomlokrakodókFelszereltségrövidLengés

Forrás: pepitahirdeto.multiapro.com

Lakberendezés Egyéni Igényekre Teljes körű Építészeti és Belsőépítészeti 3D Látványtervezést kínálunk: Tervezőknek · Gyártóknak · Beruházóknak · Magánszemélyeknek


Feladva: 2017-07-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 183MagánszemélyeknekIgényekreEgyéniBeruházóknakLakberendezésGyártóknakajánlóTervezőknekHirdetőkínálunkPepitaLátványtervezéstLátványtervezésValósághű

Forrás: pepitahirdeto.multiapro.com

Kényeztető kozmetikai kezelések, masszázs és alakformálás Budán a Mechwart ligetnél. · Kozmetikai kezelések · Masszázs · Sminktetoválás · Manikűr - Pedikűr Kozmetikai webshopunk: www.algothermshop.hu


Feladva: 2017-10-02    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: 183KozmetikaiMasszázskezelésekligetnélEsztétikaalgothermshopMechwartAlgothermwwwBudánwebshopunkalakformálásKényeztetőPedikűrkerManikűrBudapest

Forrás: pepitahirdeto.multiapro.com

Minőségi gránit sírkövek széles választékával állunk rendelkezésére, kedvező áron, teljes temetői kivitelezéssel. Látogasson el bemutatókertünkbe, ahol megtekintheti hatalmas választékunkat elkészült síremlékeinkből. Szeretettel várjuk monori, ceglédi, és kecskeméti bemutatókertünkben! Keresse fel honlapunkat www.granitsirko.hu, és kérjen személyre szabott árajánlatot, vagy érdeklődjön telefonon: +36 30 431 58 58


Feladva: 2017-05-20    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: gránitgranitsirkosíremléksíremlékeinkbőláronwwwAkcióselkészültkedvezőhonlapunkatválasztékunkat431rendelkezésérefelhatalmastelefononállunkKeresse

Forrás: pepitahirdeto.multiapro.com

Új tervezésű 2016.évi benzinmotoros fűnyírók a GÜDE től. 1, Az alap: Fűnyíró ECO WHEELER 461 P 95322 2, A TOP: Fűnyíró BIG WHEELER 461 4in1 95333 3, A RITKASÁG: Fűnyíró BIG WHEELER Trike 515 D 95375 4, A LUXUS : Fűnyíró BIG WHEELER 565 BS Önindítós: 95363 www.fjs.hu/benzinmotoros-gepek-k54 072


Feladva: 2016-04-01    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 251WHEELERnyíróBIGbenzinmotorosGÜDEfűnyírók46195322gepekSzolgECOKerLUXUSalapfjsminőség95375tőlwwwnémet515httpakciósTrike95363évi

Forrás: pepitahirdeto.multiapro.com

Akrobatikus tűzzsonglőr és tűztánc show, színpadi pirotechnika, tűzijáték, UV & LED show, gólyalábasok, rendezvényszervezés. Acrobatic firejuggler and firedance show, stage pyrotechnics, fireworks, UV & LED show, stilts, event organizing.


Feladva: 2016-05-08    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: showtűzzsonglőrLEDfiredanceAkrobatikusandBudapestfirejugglerBeátaorganizingAcrobaticILLÉSeventrendezvényszervezéscsapatstiltsgólyalábasokprodukció

Forrás: pepitahirdeto.multiapro.com

Háromgenerációs, 266 m2 nettó alapterületű, 3 szintes, csodálatos panorámájú családi ház Solymár csendes, forgalommentes zsákutcájában eladó. 5 szoba + 34 m2-es nappali, 2 fürdőszoba + zuhanyozó + WC, 30 m2-es garázs, 2 erkély, 46 m2-es terasz + 1 külön bejáratú lakás (szoba, konyha, étkező, fürdőszoba, tároló). A telek 742 m2, termő gyümölcsfákkal. Irányár: 55 millió Ft


Feladva: 2015-09-28    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: fürdőszobaHáromgenerációsszobaSolymárházcsaládi411alapterületűeladó3138nettóétkezőzsákutcájában927266konyhaforgalommentesÉrdeklődnicsendesPéter

Forrás: pepitahirdeto.multiapro.com

Helló! 30 éves szakmai gyakorlattal és tapasztalattal vállalunk szobafestést, mázolást, tapétázást. Díszléc, stukkó, rozetta, bordűr felrakását, díszítő festést. Kisebb-nagyobb munkák akár azonnali kezdéssel is! Vállalunk még: gipszkarton szerelést, parkettázást, lambériázást. Hideg-meleg burkolást, tető szigetelést. Ajtók-ablakok kibontását, beépítését. Ha szeretne tiszta, szép, korrekt munkavégzést megbízható szakiktól, kérem keressen! A szomszédos megyékben is dolgozunk szívesen!


Feladva: 2016-02-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SzépgyakorlattalVállalunkMihálymeleglakásfelújításmunkátkorrektmázolástHidegtapétázásterületénnagyobbtisztaszobafestéstlambériázástmázolásmegyék

Forrás: pepitahirdeto.multiapro.com

Mire jó az aloe ital? Az ókorban is ismerték gyulladásokkal és fertőzésekkel szemben kifejtett jótékony hatásait. Napjainkban is használják a vírusok, baktériumok, gombák ellen, segítségével kezelhetünk bőrbetegségeket, influenzát, bélgyulladásokat. Az aloe vera ital más szempontból is nagyon egészséges. A kutatások megerősítették, hogy képes szabályozni a vércukorszintet és fokozni az inzulinérzékenységet. Aki rendszeresen fogyasztja, csökkentheti a cukorbetegség kialakulásának esélyét. ... további részletek >>

Közvetett módon a fogyást is támogatja. Aloe vera ital melletti érvek és rendelés weboldalunkon!


Feladva: 2017-08-22    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: italAloeveraMireKittiinzulinérzékenységetmásfogyástNapjainkbanKellérfokoznibélgyulladásokatmódonhatásaitvércukorszintetinfluenzátjótékonyKözvetett

Forrás: pepitahirdeto.multiapro.com

Eladó gondola és végzáró. Gondola: 32.000.-/fm (nettó) oldalanként 4 sor polccal Végzáró: 23.000.-/fm (nettó) 4 sor polccal Könnyen szerelhető, tisztítható. További információ: www.polcozzunk.eu


Feladva: 2016-10-10    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: VégzáróGondola000polcozzunkpolccalsornettówwwoldalankéntinformációTovábbiEladótisztíthatóSzigetszentmiklósszerelhetőpolcrendszerKönnyenfém

Forrás: pepitahirdeto.multiapro.com

A vesekő diéta segítségével megelőzhető a kövek kialakulása. Egy kis odafigyeléssel könnyen kivitelezhető, hogy kevesebb sót fogyasszunk, együnk több zöldséget, gyümölcsöt, csökkentsük a kávéfogyasztást. Ha már kialakult, a vesekő eltávolítása lehetséges akár otthoni módszerekkel is. Ehhez használhatunk vízhajtó teákat vagy speciálisan összeállított teakeveréket. A népi orvoslásnak az egyik leghatékonyabb gyógynövénye a vesekő tünetei ellen a nyírfalevél, melynek teája megakadályozza a kő ... további részletek >>

kialakulását, de a meglévő követ is képes elmorzsolni. Gyors és biztonságos beavatkozás az endoszkópos kőeltávolítás, mely után a beteg gyorsan felépül.


Feladva: 2017-03-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vesekőeltávolításakövetgyümölcsötleghatékonyabbkisbetegEhhezmeglévőzöldségetegyikEgyutánmódszerekkelkialakulásáttöbborvoslásnakkialakulásamely

Forrás: pepitahirdeto.multiapro.com

A stressz korunk népbetegsége, melyet a rohanó életformának köszönhetünk. Oldalunkkal segítséget szeretnénk nyújtani mindazoknak, akik felismerik, hogy legfőbb érték az egészség és ennek megőrzéséért tenni is akarnak valamit. Stresszoldó technikák: www.blog.topponleszel.com


Feladva: 2017-04-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: StresszoldótechnikáknépbetegségeakikkorunkvalamitmindazoknakstresszakarnaknyújtaniTrénertenniszeretnénkElmemegőrzéséértsegítségetennekOldalunkkal

Forrás: pepitahirdeto.multiapro.com

Gondja van egészségével? Érszűkületes? Csontritkulása van, vagy lúgosítani szeretné szervezetét? Esetleg cukorszintjén szeretne javítani? Látogassa meg oldalamat www.vitalioninfo.lapunk.hu Ajánlataim segítik Önt egészsége megőrzésében és jobbá tételében: allergia, bőrproblémák/ ekcéma,pikkelysömör,herpesz,lábszár fekély/erősödik immunrendszere, pótolja vashiányát, változókori problémákra, vízhajtó,alvássegítő, nyugtató, emésztéssegítő,cisztára,és daganatos betegségek megelőzésére.


Feladva: 2015-12-27    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vanszeretneÖntcukorszintjéncisztáralábszárfekélyVitalionsegítikEsetlegemésztéssegítőherpeszHRIAjánlataimszervezetétnyugtatópikkelysömörlapunkekcéma

Forrás: pepitahirdeto.multiapro.com

Német piacra gyártott I. osztályú, prémium minőségű franciaágy, az ottani Deutsch Qualität elvének megfelelő minőségben, akár felső közép-kategóriás aloe vera-s extra szivacsos, rugós és memory-réteges NASA matracokkal, különböző színnel és mérettel(160/180) P1-es minőségű anyagokból a forgalmi értékük 50%-áért. Ágykeret ácsráccsal már 119.000 Ft-ért. Az ár az ágy méretének, funkciójának és anyagának függvényében változik. www.franciaagy.net/franciaagyak/florida-franciaagy Aktuális és ... további részletek >>

tényleges árukészletünkről érdeklődjön személyesen vagy telefonon üzletünkben, ahol állunk szíves rendelkezésére. Jelen hirdetés nem minősül ajánlatnak, a változtatás jogát a hirdető fenntartja.


Feladva: 2017-04-13    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: minőségűfranciaagyfloridahirdetőfranciaágyszínneltelefononkategóriáswwwácsráccsalprémiumajánlatnakkülönbözővagyváltozikközépÁgykeretosztályúfelső

Forrás: pepitahirdeto.multiapro.com

24 h ápoló/háztartásvezető állásunk van LANDSHUT-ban, a család a munkáltató. Idős otthonos ÁPOLÓ-i állásaink BAJORORSZÁGBAN vannak, feltétel eü. végzettség. Az AMBULANTE mobil ápolói állásunk FRANKFURTBAN van eü. végzettséggel és jogosítvánnyal rendelkezők részére. A szállás mindhárom helyen megoldott. Némettudás szükséges szintje állástól függően A2-től B1-B2-ig. További infók a www.nemetmunka.hu/apolo.html weboldalunkon, ahol regisztrációs lehetőség is van. Érdeklődni munkaidőben a ... további részletek >>

+36 1 920 3433 budapesti, vagy a +49 8641 6949 000 német vezetékes számokon lehet. Várjuk jelentkezését! Német Munka Team


Feladva: 2017-02-10    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: vanMunkaNémetÁPOLÓállásunkTeamszámokonjogosítvánnyalállásainkállástólvezetékesvégzettséggellehetőségszintje000FRANKFURTBANregisztrációsIdősotthonos

Forrás: pepitahirdeto.multiapro.com

Melyek a szájszárazság okai? A szájszárazság oka lehet stresszes helyzet, idegeskedés, ilyenkor természetes, hogy a szervezet így reagál. Azonban, ha gyakran észleljük a száj kiszáradását, érdemes alaposabban utánanézni, mi lehet a háttérben. A szájszárazság ellen akkor tudjuk megtalálni a megfelelő terápiát, ha ismerjük a kiváltó okot. Amennyiben rendszeresen gyógyszert szedünk, olvassuk el a mellékhatásokat, hiszen sok fájdalomcsillapító, gyulladáscsökkentő, vérnyomáscsökkentő gyógyszer is ... további részletek >>

okozhatja a nyáltermelődés csökkenését. A szájszárazság oka ugyanakkor lehet betegség is, pl. cukorbetegség vagy Parkinson-kór.


Feladva: 2016-11-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: szájszárazságlehetokaokaiMelyekugyanakkorszájhiszenhelyzetmegfelelőészleljükmellékhatásokatstresszesmegtalálnigyakranolvassuktudjukcsökkenésétkór

Forrás: pepitahirdeto.multiapro.com

Mistyque FehérneműSzalon Online Márkás termékek: Triumph, Sloggi, Felina, Skiny, Misty, Bahama. Rider papucsok, minőségi fehérneműk, fürdőruhák, harisnyák, zoknik - KIFUTÓ MODELLEK KEDVEZŐ ÁRON! Kínálatunkból: FIORE 40 den-es, mintás harisnyanadrágok, több színben: 1.550 Ft. SKINY Essentials Tolerance női trikó (kék vagy narancs): 4.250 Ft. Átadás személyesen: Budapesten (XVII. ker.), Bálványoson (Somogy), vagy országos kiszállítással. Webáruházunk: www.mistyque.hu


Feladva: 2015-11-27    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: mistyqueMárkásországosfehérneműkOnlinevagyFehérneműSzalonpapucsokRiderSKINYfürdőruháknarancsmintáskékdenminőségitrikóFIORESomogynőiTolerance

Forrás: pepitahirdeto.multiapro.com

Lepje meg gyermekét, szeretteit, barátait, ismerőseit egy igazán különleges ajándékkal, egy HAPPY BIRTHDAY dallamot játszó serleg-focilabda vagy egy rózsaszín virág alakú tortatűzijátékkal, tortagyertyával! Kiszállítás postai, vagy futár csomagban!


Feladva: 2014-11-22    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: egyserlegvirágrózsaszínfocilabdagyermekétlatvanypont@gmailjátszómegmaildallamotLepjetortagyertyávalBIRTHDAY0775SzegedtortatűzijátékkalHAPPY863

Forrás: pepitahirdeto.multiapro.com

Dunai görgeteg kövek, úgy ahogyan a természet megalkotta őket és megmunkálva...


Feladva: 2015-11-24    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: görgetegDunaikövekBudapestViktormegmunkálvaőketmegalkottatermészetahogyanúgy

Forrás: pepitahirdeto.multiapro.com

Igényes megjelenésű klímás autók sofőrrel kérhetőek. Kiállás Budapesten díjtalan. Autóink rendelhetők már 6.000.-/óra díjtól. Számoljon velünk, részletekért klikkeljen a www.szepauto.5mp.eu oldalra.


Feladva: 2017-03-20    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: KiállásCsaládivelünkkérhetőekpartiSzámoljonsofőrrelCégesdíjtólautókRendezvényóraklímásAutó000megjelenésűoldalraEsküvőmárIgényes5mpRichárd

Forrás: pepitahirdeto.multiapro.com

Asztali sörcsapolók, hogy mindig legyen hideg sör a vendég előtt! Kell-e bármit még mondani ahhoz, hogy ellátogasson a honlapunkra?


Feladva: 2017-07-15    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hogysörcsapolókAsztalimégDebrecenbármitajánlóKellHirdetőelőttPepitavendégsörhonlapunkrahidegellátogassonlegyenmindigahhozmondani

Forrás: pepitahirdeto.multiapro.com

Fürjtojás kapható Étkezési fürjtojás 25 Ft/db Keltetni való fürjtojás 30 Ft/db Tenyészetkód: 9541049


Feladva: 2015-11-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: fürjtojáskaphatófürjTenyésztojás1850való1100Keltetni650ÉtkezésiolívaolajbanSzigethalompácoltGyulaFüstöltPénzes550

Forrás: pepitahirdeto.multiapro.com

Látogasson el hozzánk, ha különleges alkalomra való gyertyát keres! Akár belföldről, akár külföldről érkező igény esetén -nagy volumenű munkák tekintetében - alvállalkozóként is szívesen közreműködünk! Legyen szó akár rusztikus, akár adventi gyertya, vagy egyéb más gyertya készítésről, szívesen várjuk megkeresését! Örömünkre szolgál, hogy olyan termékek, gyertyák gyártását végezzük, melyek a hangulatteremtés szimbólumai!


Feladva: 2017-03-28    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: adventigyertyaBarbaraKismindenes

Forrás: pepitahirdeto.multiapro.com

Tökéletesen tisztítja a többféle felületet. Univerzális alkalmazású: fürdőszoba, konyha, terasz és erkély. Használja fazekakhoz, odaégett maradékokhoz, mosogatókhoz, üvegekhez, porcelánhoz. Erős és biztonságos - a biológiailag lebomló. Nagyon szennyezett, pl. kenőanyagokkal szennyezett kezet is lehet vele mosni 500 g-os kiszerelésben. ERŐS ÉS BIZTONSÁGOS - KÉZKÍMÉLŐ - KÖRNYEZETBARÁT Azért is foglalkozom vele, mert én is használom a saját háztartásomban. Emellett keresek pénzt is vele, ... további részletek >>

mert megismertetem mindazokkal, akiket szintén érdekel...


Feladva: 2017-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: veleBIZTONSÁGOSERŐSUniverzálisszennyezettmertkonyhapasztabiológiailagfürdőszobapénztlebonthatóporcelánhozalkalmazásúkeresekkiszerelésbenzöld500

Forrás: pepitahirdeto.multiapro.com

A porckopás, más néven arthrosis, az ízületeket érintő betegség. Azoknak, akiknél a porckopás okozta problémák jelentkeznek, ajánlott glükozamint és kondroinint együttesen tartalmazó étrend-kiegészítő szedése, mely segít fenntartani a porcok rugalmasságát, vízzel való telítettségét, tápanyag ellátottságát, így védve az ízületeket a porckopástól. A Chondrosamin® az enyhe és középsúlyos esetekben, 2-3 hét alatt már képes a fájdalmat is csökkenteni. Javasolt évente több alkalommal ... további részletek >>

kúraszerűen megismételni a használatát. Tudjon meg többet: www.gyapjumarket.hu/spl/268919/Etrendkiegeszitok-taplalekkiegeszitok


Feladva: 2016-11-19    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: porckopásízületeketétrendarthrosisChondrosamincsökkenteniajánlottporckopástólmástöbbetfenntartanifájdalmatjelentkeznekDebrecenmegsegítképesvédve

Forrás: pepitahirdeto.multiapro.com

D-vitamin az egyik legalapvetőbb, legtöbb szervre ható építőeleme az emberi szervezetnek, amely hatással van nemcsak a csontok és az idegrendszer fejlődésére, de az immunrendszer működésére is. A magyar lakosság 95 százaléka D-vitamin hiányos. Ajánlott, októbertől - márciusig a D-vitamin kapszula formában történő bevitele!


Feladva: 2016-12-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vitaminvanFerencnéhiányoshatássalKerepesiszázalékaamelyalapfeltételelakosságszervezetnekbeviteleéletmagyaremberitörténőnapfényműködéséreformában

Forrás: pepitahirdeto.multiapro.com

Egyre több az anyagi helyzetével elégedetlen fiatal! A harmadik ikszbe lépve már senki nem engedheti meg azt a luxust, hogy ne törődjön saját és családja jövőjével. Legkésőbb harmincas évei során mindenkinek szembesülnie kell azzal, hogy felelősséggel tartozik saját és esetleges családja jövőjéért, ha tetszik ha nem. Éppen ezért 30-as éveiben kell alaposan megterveznie a jövőjét pénzügyei szempontból is. Nem kifogás, hogy a jövőt senki nem látja előre, hiszen ha van egy terve, még egy ... további részletek >>

bizonytalanságból eredő esetleges akadályokat is sokkal jobban fogja venni. A most negyvenes éveiben járó szendvicsgeneráció 15-20 év múlva szorult helyzetbe kerülhet, hiszen amellett, hogy a gyermekeit támogatja majd, valószínűleg részben a szüleiről is gondoskodnia kell. Ön mikor tervezi, hogy megtegye a szükséges lépéseket ahhoz, hogy emberi életet éljen nyugdíjas korában? Felajánlom az elégedetlen fiataloknak egy zseniális lehetőséget, mert sokszor még családalapítás előtt vannak, még van idejük pár év kemény munkájával, hosszú ideig élvezni a boldog életet. Ha nem lépnek időben, akkor sajnos nagy az esélye, hogy sokan egyre lentebb fognak csúszni az életben, és ez a társadalomra is súlyos kihatása lesz! Ha valaki saját magán nem akar segíteni, akkor mi sem tudunk segíteni, de ha hajlandó megismerni új lehetőségeket, akkor minden segítséget meg tudunk adni annak érdekében, hogy a családjuknak sokkal jobb életszínvonalat biztosítsanak Jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-03-28    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmegegyresajátakkoregyelégedetlenkelléletetesetlegestudunkéveibenfiatalsokkalsenkihelyzetévelanyagihiszencsaládjatöbbvansegíteni

Forrás: pepitahirdeto.multiapro.com

Olcsó, gyors személyszállítást végzünk Ausztriába, Németországba


Feladva: 2017-03-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: NémetországbavégzünkszemélyszállítástgyorsOlcsóBudapestEutaxiKisbusszalAusztriába

Forrás: pepitahirdeto.multiapro.com

Kompresszor, vákuumszivattyú, javítás, felújítás, szerviz, sűrítőegység, mechanika, pneumatika, vezérlés, szabályozás, hajtás motor, elektromosság ... MINDEN EGY HELYEN! 06-30-243-4771 Márkafüggetlenül, minden típus javítása.


Feladva: 2016-10-19    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: javításmindenKompresszorfelújításEGYMárkafüggetlenülelektromosságvákuumszivattyú4771motor243hajtáskerhtmszabályozásXVIItartalomjavitasvezérlésRak

Forrás: pepitahirdeto.multiapro.com

Badacsony és vonzáskörzetében lévő kiadó szálláshelyek fényképes gyűjtőoldala. (~ 120 szállás) Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Több mint 1000 fényképpel a szálláshelyekről és a településekről! - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Egész évben nyitvatartó szálláshelyek Badacsonyban - Weboldal: ... további részletek >>


Feladva: 2017-04-26    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: badacsonyszálláshelyekszállás120zimmerinfokiadóSzéchenyilévőnélkülhttpnyaralóházakkártyavonzáskörzetébendíjWeboldalvillákSZÉPközvetítésipanziók

Forrás: pepitahirdeto.multiapro.com

ENERGETIKAI tanúsítvány elkészítése akár még aznap (egyeztetés szükséges)! 1 évnél hosszabb időre adna ki épületet, lakást, vagy üzleti ingatlant? Új ingatlanba szeretne beköltözni? Akkor Önnek valószínűleg szüksége lesz az ingatlanához tartozó ENERGETIKAI TANÚSÍTVÁNYRA (vagy más néven épület ZÖLDKÁRTYÁRA), amely 2012-től jogszabály szerint is részét kell képezze a legtöbb épület, ház és lakás adásvételi vagy bérbeadási folyamatának. #zoldkartya #zoldkartyamiskolc ajanlat ... további részletek >>

(kukac) tornay (pont) hu energetika(pont)tornay(pont)hu +36 70 599 05 62 www.energetika.tornay.hu


Feladva: 2016-06-29    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: tornaypontENERGETIKAIvagyépületenergetikaTanusításamely599ÖnnekházhosszabbZÖLDKÁRTYÁRAAkkorévnélnévenajanlatbeköltöznilegtöbbszükségesmás

Forrás: pepitahirdeto.multiapro.com

Az aki 40 évesen 123 kg-ot nyomott a mérlegen, így számos gyógyíthatatlan egészségügyi probléma küszöbén állt, most elárulja hogy mi indította be nála a fogyást.


Feladva: 2017-09-17    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: httpgyógyíthatatlanegyfogyástszámosátólnálaígytesttömegemindítottamérlegenmeghogynyomottszabadultamelárulja123Hogyanmostévesenálltakibit

Forrás: pepitahirdeto.multiapro.com

Minden nap 1x, ha belépsz a weboldalra, 200 TP Tőzsdearanypontot írunk jóvá. Pénzt kereshetsz: Rendszeres használattal (pl.: 3 nap belépése után, extra kuponkód, + kitüntetés) Tőzsdei tartalom elolvasásával, (KuponKód feltöltéssel, vagy automatikusan) Tanulással, videó megnézésével, online, illetve személyes rendezvényeinken, tanfolyamainkon való részvétellel. Promóciókban való segítséggel Facebook - Like & Megosztási aktivitással Meghívási aktivitással (Erre több lehetőség is van)


Feladva: 2015-01-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: valónapKuponKódaktivitássalszemélyestartalomMeghívásiTőzsdearanypontotilletveTőzsdeiMegosztási200onlinekitüntetésLikeweboldalramegnézésévelextra

Forrás: pepitahirdeto.multiapro.com

Vállaljuk műanyag, illetve alumínium redőnyök javítását. GURTNICSERE SZÉKESFEHÉRVÁR ÉS KÖRNYÉKE. Műanyag ablakok, ajtók beállítása, javítása, törött vasalatok cseréje. Hőszigetelt üvegek cseréje műanyag szerkezetekben. HÉTVÉGÉN IS!


Feladva: 2016-05-08    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: műanyagSZÉKESFEHÉRVÁRcseréjebeállításaRedőnyszervizajtókFejérHÉTVÉGÉNablakokredőnyjavításszerkezetekbenKÖRNYÉKEajtóAblakGURTNICSEREüvegekjavítását

Forrás: pepitahirdeto.multiapro.com

Keresek mindenféle Zsolnay, Herendi és egyéb porcelánt megvételre. Érdekelnek többek közt figurák, szobrok, bonbonierek, étkészletek, vázák, eozin mázas alkotások stb... Az ország bármely részére szívesen elmegyek! Ezeken kívül egyéb antik tárgyak is érdekelnek! Hívjon, vagy írjon bátran! Elérhetőség a honlapon!


Feladva: 2016-10-09    [Régiség - Művészet]

Címkék, kulcsszavak: egyébérdekelnekporcelántHerendiZsolnayétkészletekElérhetőségKeresekelmegyekbonbonierekbátranBudapestszívesenszobrokírjonajandekokrészérefigurák

Forrás: pepitahirdeto.multiapro.com

Cégünk a legjobb áron vesz motor, hajtómű és hidraulika olajat nagy tételben is országosan. A szállítás díjtalan! Tel: 06 20 590 5340


Feladva: 2017-04-19    [Autó - Motor - Jármű]

Címkék, kulcsszavak: országosanolajatFáradthidraulikahajtómű5340motor590veszTelárondíjtalanlegjobbszállításCégünkAttilatételbenfelvásárlásnagyolaj

Forrás: pepitahirdeto.multiapro.com

Lökhárító, motoridom javítás és műanyag karosszéria javítás, horpadás javítás, műanyaghegesztés. Sérült, törött lökhárítók, fényszórók és egyéb műanyag alkatrészek javítása. Robogók, nagymotorok műanyag burkolatainak javítása. Műanyag háztartási, és egyéb eszközök javítása. Képek és árak itt: http://muanyagjavitas.hu Tel. : (30) 9 124- 279 Budapest 1105, Halom u. 42. http://muanyagjavitas.hu


Feladva: 2017-01-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: javításMűanyagjavításamuanyagjavitashttpegyébBudapestLökhárítófényszórókZentaiKépeklökhárítókMŰANYAGJAVÍTÁStörötteszközökSérültHalom1105horpadás

Forrás: pepitahirdeto.multiapro.com

Közösségi napelempark tulajdon részeinek MLM-ben való értékesítésére üzletkötőket keresek. Egyedi. Hosszútávú. 25 évig fizet! Euró alapú jutalékos kifizetés! Internetes munka kifejlesztve.


Feladva: 2017-07-01    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kereseküzletkötőketEurórészeinekfizettulajdonévignapelemparkHosszútávúKözösségiEgyediBudapestkifejlesztveajánlómunkaHirdetőInternetesértékesítésére

Forrás: pepitahirdeto.multiapro.com

Megbízható, kipróbált, havidíj mentes rádiós riasztórendszerek telefonos és GSM értesítéssel, vezeték nélküli érzékelők, hangjelzők közvetlenül a forgalmazótól. Szerelésre előkészített komplett riasztórendszerek, melyeket csak fel kell szerelnie. Keressen minket!


Feladva: 2015-01-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: riasztórendszereknélkülivezetékRiasztodepoGSMRiasztódepóTelwebáruházaelőkészítettrádióswwwSzerelésrementesminketforgalmazótólhavidíjKeressenkell

Forrás: pepitahirdeto.multiapro.com

Mindennemű régiség felvásárlása azonnali készpénz fizetéssel: antik bútor, festmény, szőnyeg, szobor (fa, bronz), óra,(kar, asztali és fali álló), ezüst tárgy, (gyertyatartó, cukordoboz, tálca, evőeszköz, hiányos is) porcelán (Herendi, Zsolnay, Meissen) arany ékszer (fél drága, drágaköves, törtarany is), csillár (asztali, álló, fali lámpa) zongora, régi tv, rádió, bélyeg, kitüntetés, képeslap, írógép, varrógép! Lakásokat, házakat hagyatékkal együtt is megvásárolunk! Cim: BP. 1137. SZENT ... további részletek >>

ISTVÁN KRT. 12 ARANY-EZÜST VÉTEL: NE ADJA EL ÉKSZEREIT TÖRT ARANY ÁRBAN, MERT MI FAZONARANYKÉNT MAGASABB ÁRON MEGVÁSÁROLJUK ÖNTŐL, TOVÁBBÁ ÜZLETÜNK VILÁGPIACI ÁR FÖLÖTT VÁSÁROL TÖRT ARANYAT, BEFEKTETÉSI ÉRMÉT, FOGARANYAT, ILLETVE BÁRMILYEN ARANYAT, KARÁTSZÁMTÓL ÉS MENNYISÉGTŐL FÜGGETLENÜL!!! BUDAPESTEN ÉS VIDÉKEN IS. A KISZÁLLÁS DÍJTALAN. Tel.: 06702862076,


Feladva: 2017-09-22    [Régiség - Művészet]

Címkék, kulcsszavak: ARANYTÖRTARANYATfaliállóEZÜSTasztaliantikVIDÉKEN1137cukordobozbélyegfizetésselMERTdrágaBUDAPESTENCimgyertyatartóVÁSÁROLrádiókészpénzÁRBAN

Forrás: pepitahirdeto.multiapro.com

Győr - Pápa - Kisbér - Tata - Csorna térségébe biztonsági őr, portás munkatársakat keresünk főállásban, bejelentve, szabadság, betegszabadság kifizetéssel. Jelentkezni lehet önéletrajzzal, a bi.technika@gmail.com e-mail címre.


Feladva: 2017-07-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: portásbiztonságiIldikómailkeresünkOrbáncommunkatársakatGönczinétechnika@gmailállásönéletrajzzallehettérségébeJelentkezniCsornakifizetésselTata

Forrás: pepitahirdeto.multiapro.com

Ásványból készült ékszerek, nyakláncok, karkötők hihetetlen árakon, most nagyszerű kedvezményekkel a Lili Bizsu Webáruházban. Karkötők már 290 Ft-os akciós ártól! www.lilibizsu.hu/fokat/5627b9518x2 82-ASVANY-EKSZEREK


Feladva: 2017-04-10    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: LiliKarkötőkBizsuakciókedvezményekkelásványékszernagyszerűmostártólárakonakcióshihetetlen290FtnyakláncokmárékszerekkészültWebáruházbanÁsványból

Forrás: pepitahirdeto.multiapro.com

Portálunkon olyan magánkollégiumokról találsz információkat, melyek a leginkább megfelelnek igényeidnek, ha hosszabb távra keresel lakhatást (nemcsak néhány napra). Ennek érdekében: - a magánkollégiumok Budapest belvárosához közel, metrómegálló mellett helyezkednek el - a kiadó szobák jellemzően egyszemélyesek - a legtöbb szobához a szobából nyíló privát fürdőszoba tartozik - a kiadó szobák árai rendkívül kedvezőek - minden szoba külön bejáratú, berendezett, minden ... további részletek >>

magánkollégium gépesített Reméljük, honlapunk segítségével te is hamarosan megtalálod a számodra ideális kollégiumi szobát!


Feladva: 2017-09-11    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: szobákkiadómindenkollégiumiegyszemélyesekhonlapunknapraáraiinformációkatjellemzőenReméljüknéhánytalálszhelyezkednekgépesítettnemcsakmelletttartozik

Forrás: pepitahirdeto.multiapro.com

Profi weboldal készítés olcsón, garanciával.


Feladva: 2016-12-18    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: ProfikészítésweboldalBudapestKftBridgeDiamondgaranciávalolcsón

Forrás: pepitahirdeto.multiapro.com

Több mint 10 éve foglalkozunk PIANÍNÓ és ZONGORA szállítással. Szállítóink profi, gyakorlott szakemberek! Vállaljuk magánszemélyek, és cégek PIANÍNÓ és ZONGORA szállítását, alkalmanként, vagy rendszeres időközönként is! Továbbá vállaljuk Cégek és Magánszemélyek Költöztetését Budapesten és Vidéken egyaránt! Pianínó Szállítás, Költöztetés Budapest, Szállítás, Lomtalanítás, Költöztetés kalkulátor, Költöztetés olcsón a PianinoSzallitas.eu weboldalon AKCIÓS ÁRAKON!


Feladva: 2016-03-11    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KöltöztetésPianinóMagánszemélyekCégekvállaljukSzállításBudapestZONGORAPianínószállításolcsóngyakorlottprofikalkulátorSzállítóinkLomtalanításTovábbá

Forrás: pepitahirdeto.multiapro.com

Építőioarban jártas embereket keresek. Segédmunkást, festőt, burkolót. Csapatok, brigádok ne jelentkezzenek! Csak egy-egy embert keresek mindegyik szakmában! Heti fizetéssel. Azonnali munka. Teljes munkaidőben. További részletekért hívja : Tel :06203535081 vagy 06209674893


Feladva: 2017-08-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresekburkolótfestőtSegédmunkástegyCsakBernátTeljesjelentkezzenekKissmunkabrigádokAzonnaliCsapatok06209674893fizetésselvagyHeti06203535081Tel

Forrás: pepitahirdeto.multiapro.com

Szeretne gyorsan weblapot? Kínálatunkban előzetesen megtekinthető, kattintható kész weblapok közül válogathat. Jelenleg 50 különböző kész weblap közül tud választani. De van itt még valami ... Bevezető akciónk keretében most reklám és látogató növelő szolgáltatást is biztosítunk minden olyan weblap megrendelőnknek, aki lakosságnak szolgáltat, vagy értékesít és a rendelésével eléri a 20.000 Ft-ot akár egy összegben, akár a második negyedéves díj befizetése után.


Feladva: 2017-10-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: mégakárweboldalaweblapnincsÖnnekközülkészakiSzeretnekeretébenkülönbözőmegrendelőnknekakciónkösszegbenJelenlegBevezetőegyválogathatolyanvalami

Forrás: pepitahirdeto.multiapro.com

Szeretnéd meglátogatni Peru legismertebb nevezetességeit mint Machu Picchu romjai, a Titicaca-tó vagy a Colca-kanyon? Esetleg olyan látnivalók érdekelnek, amikről olvastál de nem szerepelnek az utazási irodák ajánlataiban? Jelenlegi perui lakosként több éves latin-amerikai barangolásaim tapasztalatával vállalom személyre szabott nyaralások megszervezését és lebonyolítását magyar nyelvű utaskísérőként kedvező áron. Info: www.facebook.com/peruinyaralas és www.payasyougoholidayperu.com


Feladva: 2016-08-24    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: peruiáronnyaraláscomwwwPeruajánlataibankanyonInfomeglátogatnivállalomirodákColcaSzeretnédtapasztalatávalutazásivagykedvezőLimabarangolásaim

Forrás: pepitahirdeto.multiapro.com

Termelőtől eladó nordmann fenyő mindenféle méretben 1 m - 3,5 m-ig. Ugyan itt lucfenyő is eladó. Ár megegyezés szerint. Tel: +36203910904


Feladva: 2017-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: eladószerintSurdmegegyezésSándorSzegedilucfenyőKarácsonyfaittUgyanméretbenmindenfélefenyő36203910904nordmannTelTermelőtől

Forrás: pepitahirdeto.multiapro.com

Könyvelés - Cégalapítás - Székhelyszolgálat Hosszított esti és hétvégi elérhetőséggel állunk Ügyfeleink rendelkezésére. Jelenlegi és leendő partnereinkkel a kölcsönös és feltétlen bizalmon alapuló baráti és üzleti kapcsolatra törekszünk, hiszen ebben a szakmában ez elengedhetetlen. Kft, Bt könyvelése 7.000 Ft-tól Egyéni vállalkozó könyvelése 6.500 Ft-tól Székhelyszolgálat 4500 Ft-tól Cégalapítás 19.990 Ft-tól Célunk, hogy az Ön számára is hasznos segítség lehessünk ... további részletek >>

mindennapjaihoz. Reméljük, hamarosan Önt is ügyfeleink körében üdvözölhetjük, s egyúttal várjuk mielőbbi jelentkezését. Részletes információ weboldalunkon!


Feladva: 2016-10-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: tólmindenMostügyfeleinkCégalapításSzékhelyszolgálatingyenKönyveléskönyveléseÜgyfelünknekegyúttalbarátiszámáraelérhetőséggelEgyéniüdvözölhetjükalapuló

Forrás: pepitahirdeto.multiapro.com

Az Ozeki Kft. debreceni irodájába megbízható, pontos, szorgalmas, önálló feladatvégzésre képes asszisztens munkatársat keres céges ügyeinek intézésére. Középfokú angol nyelvismeret szükséges. A foglalkoztatás napi 8 órás főállású bejelentett munkaviszony keretében történik. A munkaidő reggel 7:30 és 16:30 óra között van 1 órás ebédszünettel. Ez a munka nem igényel kiváló kommunikációs képességet, hanem jó adminisztrációs készséget, pontosságot és nagy monotonitás tűrést valamint terhelhetőséget ... további részletek >>

kíván meg. Jelentkezés: job@ozeki.hu e-mail címre beküldött fényképes önéletrajzzal és a pozícióhoz kapcsolódó jelentkezési adatlap pontos kitöltésével. A jelentkezési adatlapot a www.jobs.ozeki.hu/index.php?owpn=12 oldalon található asszisztensi pozíciót bemutató oldal alsó részén találja meg és onnan töltheti le. Kérjük, olvassa el alaposan a pozíciót bemutató oldalt, hogy a pozícióhoz kapcsolódó összes fontos információt megismerhesse.


Feladva: 2016-08-02    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: ozekiórásasszisztenskapcsolódómegpozícióhozjelentkezésipontosbemutatópozíciótKftbejelentettmegismerhessefényképeskeresolvassanagyDebrecenoldalon

Forrás: pepitahirdeto.multiapro.com

Kitartó, lelkes embereket keresek Bio termékek katalógusból történő árusításához. A munka teljes mértékben otthon végezhető, és nagyon egyszerű, mivel AUTOMATIZÁLT WEBOLDAL segítségével történik, költség és kötelezettségmentesen. Gyes mellett, nyugdíj mellett, de akár munka mellett is, minimális időráfordítással növelheted a bevételed. MUNKATÁRSKÉNT stabil jövedelem lehetősége egy nemzetközi üzlet partnereként - Nincs felső korlát. Annyit kereshetsz, amennyit csak szeretnél. - Az EU ... további részletek >>

országaiban is nyitott a lehetőség! Válassz most BIO készítményeket a mesterséges szemét helyett! Nézd meg a KÍNÁLATOT: www.egeszsegbomba.mylifecare.hu 100% elégedettségi garancia! Regisztrációs és tagsági díj helyett ajándékokkal és folyamatos akciókkal várunk Téged: + AJÁNDÉK utalvány + AJÁNDÉK VIP hűségkártya + AJÁNDÉK katalógus + AJÁNDÉK magazin + AJÁNDÉK termék Hozd létre ingyenesen felhasználói Partner fiókodat és rakd kosárba meglepetéseinket! Ha kedvet érzel hozzá, és szívesen keresnél pénzt ilyen formában, akkor részletesen tájékozódhatsz a weboldalon. Jelentkezzél fel hírleveleinkre is! www.egeszsegbomba.mylifecare.hu A felmerülő kérdéseidre szívesen válaszolok az alábbi e-mail címen: szerencseneked@gmail.com


Feladva: 2016-11-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AJÁNDÉKmellettmunkahelyettszívesenBIOmylifecareegeszsegbombahttphírleveleinkreakciókkalnemzetközikeresekhozzámegcímenHozdszeretnélegyszerűfel

Forrás: pepitahirdeto.multiapro.com

Esküvői fehérgalamb röptetést vállalok Tarcal 150 km-es körzetében. A röptetés történhet kosárból 2, 5, 10, 15 vagy 20 galambbal, valamint kézből is engedhető 1-1 galamb. Az összes kategóriához szaktanácsadás jár, a megjelenés és a kosár is alkalomhoz illő. A galambok szállítása Tarcalon ingyenes, Tarcal 150 km-es körzetében 80 Ft/km. Megrendelés telefonon. További információkért az alábbi telefonszámon, vagy üzenetben elérhet! Tegye meghitté élete nagy napját!


Feladva: 2016-01-22    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: Tarcalröptetés150vagyfehérgalambEsküvőikörzetébenjárelérhetszaktanácsadáscímenvállalokkategóriáhozmailröptetéstingyenesösszesTarcalongalambhttp

Forrás: pepitahirdeto.multiapro.com

Cigány (lovari) nyelvoktatás, középfokú állami nyelvvizsgára szakszerű felkészítés (10 hét, 80 óra)! Vizsga- és oktatási anyagokat (órai jegyzeteket is) biztosítok cigány és magyar nyelven. A képzés helye: a Nyugati Oktató Központban Jelentkezés: az alábbi elérhetőségeken.


Feladva: 2015-05-08    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 06204284486cigánylovariBudapestvagyVizsgaLászlóóraciganynyelvoktatasÁgostonJelentkezéshétwwwDemeternyelvenfelkészítéshttpKözpontbanmagyarLink

Forrás: pepitahirdeto.multiapro.com

Professzionális, személyre szabott doboktatás, egyéni időbeosztásban! Kezdőknek, haladóknak, korosztálytól függetlenül, minden zenei stílusban! Földesi Dobiskola!


Feladva: 2016-01-26    [Zene - Hangszer]

Címkék, kulcsszavak: egyéniDobiskoladoboktatásFöldesiidőbeosztásbanszabottstílusbanszemélyrezeneiProfesszionálismindenfüggetlenülkorosztálytólhaladóknakKezdőknek

Forrás: pepitahirdeto.multiapro.com

1991 óta működő faipari cég garanciával vállalja, egyedi igények szerinti konyha, szoba, gyerekszoba, fürdőszobabútorok, polcrendszerek, beépített szekrények, valamint irodabútorok, egyedi bútorok készítését, és különféle asztalos munkákat. Bemutatótermünkben rendelkezésre állnak anyagminták, melyekből kiválaszthatja az ön által elképzelt egyedi kialakítású bútorát, valamint a webáruházunkban forgalmazott bútorainkból néhány darabot.


Feladva: 2015-11-17    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: egyedivalamintKoráncégbútorainkbólBútorkészítésanyagmintákbeépítettfaipariforgalmazottállnakpolcrendszerekműködőwebáruházunkbanrendelkezésreóta1991

Forrás: pepitahirdeto.multiapro.com

A krill omega 3 gélkapszula magas omega-3 zsírsav tartalmával csökkenti a keringési betegségek valószínűségét. Az idősebbeket és az egyre gyakrabban a fiatalabb korosztályt is érintő vérnyomás-, koleszterinproblémák, érrendszeri betegségek ellen sokat tehetünk, ha rendszeresen pótoljuk az omega-3 zsírsavakat A krill omega 3 gélkapszula kellő mennyiségben tartalmazza ezt az esszenciális tápanyagot, mely a legtöbb ember étrendjéből hiányzik - pedig minden életkorban nélkülözhetetlen. Segíti az ... további részletek >>

idegrendszer egészséges működését, növeli a fizikai és a szellemi teljesítményt, csökkenti a gyulladásokat és helyreállítja a hormonháztartás egyensúlyát. Krill omega 3 gélkapszula ára itt!


Feladva: 2016-09-23    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: omegaKrillgélkapszulacsökkentibetegségeknélkülözhetetlenkeringésieztgyulladásokatérrendszeriéletkorbantartalmávaltartalmazzakoleszterinproblémákminden

Forrás: pepitahirdeto.multiapro.com

Professzionális segítségre és gyógyításra számíthat az UNIQA legújabb betegségbiztosításával, ha egy súlyos, „rettegett” betegség ütné fel Önnél a fejét. A Best Doctors közreműködésével felkutatjuk Önnek az adott betegség legjobb specialistáit a világon, teljes körűen megszervezzük és térítjük a külföldi gyógykezelését 2 millió euró összeghatárig. Tájékozódjon honlapomon a Med TopDoc betegségbiztosításról, vagy kérjen tájékoztatót!


Feladva: 2015-01-18    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: MedbetegségTopDocBestlegújabbteljesbetegségbiztosítássalfejéthonlapomonUNIQAvilágonÖnnélTájékozódjonszámíthatspecialistáitfelösszeghatáriglegjobb

Forrás: pepitahirdeto.multiapro.com

Használjon kerámia, vagy indukciós Midea főzőlapot és felejtse el a hosszas és fárasztó tisztogatást! A szennyeződések könnyen eltávolíthatók, a kifolyt anyag nem tud odaégni és így főzés után a készülék letisztítása sokkal kevesebb fáradtsággal jár mint a hagyományos gáz főzőlapok esetében. www.midea.bolt.hu/midea-midea-mchf 645-főzőlap-p-61.html


Feladva: 2017-09-18    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: mideafőzőlapindukcióskerámiahtmlfőzőlapotjárnemfáradtsággalanyagmchf645vagykevesebbkifolytsokkaleltávolíthatókHasználjonboltletisztításakönnyen

Forrás: pepitahirdeto.multiapro.com

Használt számítógépek, laptopok és számítástechnikai kiegészítők, alkatrészek széles kínálatával várjuk üzletünkben Bonyhádon. 7150 Bonyhád, Rákóczi F. u. 1 Tel.: 0620/40-40-500


Feladva: 2017-09-05    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: kiegészítőkszámítástechnikailaptopokBonyhádszámítógépekHasználtalkatrészekbonyhadcomputerhttpsRákóczi7150BonyhádonSzámítástechnikaüzletünkbenvárjuk500

Forrás: pepitahirdeto.multiapro.com

Szeretnél egy könnyen megjegyezhető domain nevet és egy weboldalt? Esetleg tetszenek a rövidebb, pár betűből álló domain kombinációk? Vagy egy régi, koros domainnel szeretnéd segíteni a weboldaladat, hogy már az elején előnnyel indulj a többi lappal szemben? Bővebb információ és az eladó weboldalak teljes listája itt tekinthető meg: www.eladhatatlan.hu/elado-domain-w eboldal


Feladva: 2016-04-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: domainegyeladóweboldalakweboldalbetűbőlakciósanweboldaladatpárinformációneveksegítenieladorövidebbBővebbszeretnédeladhatatlantetszenekszemben

Forrás: pepitahirdeto.multiapro.com

Ha egy teljesen legálisan működő, most induló osztrák céggel szívesen dolgoznál együtt - ahol az összes tulajdonost más üzletekből régebb óta személyesen ismerünk -, akkor nincs mire várnod, itt a hét minden egyes napja pénzgyártásról szól!


Feladva: 2017-09-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: együttRomanoczkiakkordolgoználszólFerencismerünkszívesenpénzgyártásrólPénzgyártásszemélyesencéggelnapjaótaosztrákegyesrégebbindulómindenmost

Forrás: pepitahirdeto.multiapro.com

Otthoni internetes munka: Becsületes, nemzetközi üzlet a legnagyobb, piacvezető céggel, a DXN-nel. A legjobb minőségű gyógyító egészségeskávé 100% tiszta Ganoderma kivonattal. Profi weboldal 20 nyelven a regisztrációval: -minden szükséges tréninganyaggal és -üzletépítéshez szükséges eszközzel Páratlan marketing terv: -folyamatos bónusz felhalmozás, -nincs havonkénti nullázódás! -bónusz végtelen mélységig DXN, a legnagyobb Ganoderma vállalat!


Feladva: 2016-03-11    [Pénzkeresés - MLM]

Címkék, kulcsszavak: GanodermaüzletlegnagyobbnemzetköziDXN100szükségesbónuszlegjobbTakácsnincsregisztrációvalnelkávéfelhalmozásnyelvencéggelvállalatonlinefolyamatos

Forrás: pepitahirdeto.multiapro.com

AZOKNAK AKIK NEM AKARNAK ELŐRE BEFEKTETNI!!!! Csatlakozz hozzánk. Teendőd ingyenesen beregisztrálni és saját linkeden ingyenes tagokat gyűjteni. Miből lesz a pénzed?? Ha ügyesen dolgozol, gyűjtöd az ingyenes tagjaid, valaki a felső vonalból be fogja aktiválni az irodád, magyarul elindítja a te üzleti vállalkozásod. Ahogy érkezik irodádba a jutalékod, eldöntheted, fejleszted tovább, vagy megelégszel azzal a plusz jövedelemmel amit így fogsz elérni. A felső vonal nem csak téged fog ... további részletek >>

aktiválni, hanem azokat az ingyenes tagjaid is, akik szintén gyűjtik saját tagjaikat. Itt nem kell kattintgatni, videót nézni!! Semmi más dolgod nincs, mint ingyenes tagokat csatlakoztass. A regisztrációhoz szükséges adatokat emailben küldjed meg nekem! Teljes név, az üzletben használni kívánt felhasználó név, email cím, jelszó, Facebookos elérhetőséged.


Feladva: 2017-09-29    [Pénzkeresés - MLM]

Címkék, kulcsszavak: ingyenesnemaktiválnitagokatüzletinévsajátFelsőakiktagjaidkattintgatniérkezikKálváriaFacebookoshanemdolgozolRegisztráciohózjövedelemmelCsatlakozz

Forrás: pepitahirdeto.multiapro.com

Ponyvák széles választéka! Cégünk napellenző termékekre szakosodott weboldalt hozott létre, melyen különböző napellenző terméket töltöttünk fel. Megtalálható könyökkaros napellenző, állványos napellenző, illetve számos napellenző ponyva közül választhat. Budapest és környékén ingyenes kiszállással vállaljuk munkáinkat. Elrepedt vagy eltört? Nem gond megjavítjuk- Hívja a 061 445 42 31


Feladva: 2017-06-27    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: napellenzőBudapestbeépítésElrepedtszámoshozottszerelésmunkáinkatilletveweboldaltjavításvállaljukállványosszakosodott445kiszállássalkönyökkaros061

Forrás: pepitahirdeto.multiapro.com

Betonozható nyers kavics, osztályozott kavics értékesítés féláron! Nyers kavics 700 Ft/tonna. Osztályozott kavics: megrendeléstől függően 1650 Ft/tonna nettó áron. Szemcseméretek: 4-8 mm 8-16 mm és 16-24 mm. Nyers kavics esetében, kitermeléstől függően akár évi 1-2 millió tonna eladása is lehetséges jól szervezett logisztika esetén. Azon cégek jelentkezését várjuk akik nagyobb mennyiséget rendelnek.


Feladva: 2017-06-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: NyerskavicstonnafüggőenféláronkavicsOsztályozott700eseténÚtépítőkkitermeléstőllogisztikaesetébenértékesítésszervezettrendelnekBetonozhatójólIlona

Forrás: pepitahirdeto.multiapro.com

Angol használt ruhák kaphatók bálás kiszerelésben, kiváló minőségben. A ruhák Manchester részéről háztól-házig gyűjtésből valók. Többféle bálából és árkategóriából választhat. A bálák eredeti csomagolásban vannak, így a minősége 100%-ig garantált! További kínálatunk: fajtára válogatott ruházat, munkaruhák, lakástextil, big-bag gyűjtőzsákos, játék, plüss, fehérnemű kiszállítás már 100 kg-tól! 20 éves tapasztalattal várjuk minden régi és új vásárlóinkat! Érdeklődés-rendelésfelvétel: ... további részletek >>

06307819494


Feladva: 2017-03-09    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: ruhák100használtígytapasztalattalházigbigAngolvannakévesháztóllakástextilBálagoldcsomagolásbantólrészérőlmunkaruhákmárkáseredetiManchestermár

Forrás: pepitahirdeto.multiapro.com

Falpanelt keresel? A legnagyobb választék falpanelekből a KERMA Design webáruházban: gipsz, farost, fa, pvc, cukornád, műbőr, polisztirol, poliuretán, beton falpanelek. Tervezés, gyártás, és kivitelezés! KERMA www.kerma.hu #falpanel #kerma #műbőr #design #burkolat #bőrpanel


Feladva: 2017-09-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kermadesignfalpanelműbőrakkorkereselburkolatpoliuretánFalpaneltpolisztirolDebrecencukornádKftpvcfarostfalwwwgipszkivitelezéswebáruházbanbeton

Forrás: pepitahirdeto.multiapro.com

A FÉRFI DIVATNAK NINCS TÖBBÉ TITKA A SPARTOO ELŐTT! 2006-ban elindulva, a Spartoo először is cipőkre specializálódott. Az éves alatt kiszélesítettük kínálatunkat, számos divatos táskával valamint egy szuper elegáns ruhakollekcióval Mottónk: a divat. Ennek köszönhető, hogy jelenleg széles választékban megtalálhatja férfiaknak kínált modelljeinket, melyek természetesen a 100% divatot képviselik! NÉZZE MEG ONLINE FÉRFIAK SZÁMÁRA KÍNÁLT SZÉLES CIPŐ-, TÁSKA- ÉS RUHAVÁLASZTÉKUNKAT! ... további részletek >>

Bármilyen legyen is a stílusa: rocker, laza vagy inkább divatos, a SPARTOO.HU-n biztosan megtalálja az Önnek tetsző darabot. Férficipő kínálatunkban több száz tornacipőt, bakancsot, sportcipőt, városi- vagy deszkás cipőt ajánlunk figyelmébe. Továbbá rendelkezésére bocsájtunk egy teljes kollekciót férfiruházatból (farmerek, nadrágok, pulóverek, ingek...). valamint a legutóbbi divattrendeknek megfelelő táskákat is. TALÁLJA MEG HONLAPUNKON A LEGJOBB MÁRKÁKAT! Nike, Converse, Pataugas, Birkenstock, Vans... A Spartoo a legjobb márkákat sorakoztatja fel férfidivat világából. Nézze át újdonságok rovatunkat és felfedezze a divat legújabb trendjeit, melyekre mindenki ráharap. Ne felejtse el átnézni tippjeinket sem, ahol találhat cipőket olcsón, melyek a 100%-os divatot képviselik. www.spartoo.hu/ferfi.php


Feladva: 2017-07-15    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: spartoo100férfidivatdivatotMEGvagymelyekmárkákategySZÉLESlegjobbdivatosdivatKÍNÁLTvalamintNézzeképviselikvilágábólcipőtmodelljeinketTÁSKÁK

Forrás: pepitahirdeto.multiapro.com

,,Magosan az aszalt gyümölcsökkel” Nézz be hozzánk, a weboldalunkra és kedvedre válogathatsz a sok csemege közül. Minden héten új termékekkel újítjuk meg kínálatunkat!


Feladva: 2016-10-10    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: aszaltkedvedreolajoskínálatunkatweboldalunkragyümölcsökmeghozzánkújítjukNézztermékekkel8221hétengyümölcsökkelMindenközülMagosancsemegeZsámbok

Forrás: pepitahirdeto.multiapro.com

Saját weboldalt szeretnél, olcsón, minőségi, környezetbarát tárhellyel, akkor jó helyen jársz. Egy WordPress oldalt kb 1 óra alatt el lehet készíteni. A legolcsóbb tárhellyel ez havi 199 Ft bruttó amiért 2 Gb tárhelyet és rengeteg szolgáltatást adunk.


Feladva: 2013-11-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: 199tárhellyelweboldalttárhelyetoldaltSajátamiértWordPressBytebruttóEgyAlfajársztólhavihelyenmárakkorcsomagoklegolcsóbbkörnyezetbarátadunk

Forrás: pepitahirdeto.multiapro.com

HONDA GL 1500 GOLD WING - 1989-07 HAVI 74 KW 101 LE 154.982 KM !! 2018-05-ig érvényes MŰSZAKIVAL, 2 GYÁRI kulccsal,Jó állapotú első- hátsó gumikkal és féktárcsákkal, Barna BŐR ÜLÉSEK, AM/FM RÁDIÓ, TOLATÁS FUNKCIÓ, Elöl-hátul kiépített 12V rendszer, Kéz és Térdfűtés, MAGYARORSZÁGI RENDSZÁMOS!!!!!! Rendezett MAGYAR okmányokkal, azonnal megvásárolható!!!!! Eladó: 1.199.000.- Ft (Csereár 1.299.000 .-Ft) Akár hétvégén is megtekinthető, előzetes egyeztetés alapján! További képekért és ... további részletek >>

járművekért kérem keresse fel honlapunkat! www.markamotor.hu/magyar/motorok/gl-1500-gold-wing/legujabbak/osszes Teljes körű ügyintézés, Magyar rendszámos motorok névre írása, igény esetén friss Szerviz! Házhoz szállításban tudunk segíteni!


Feladva: 2017-11-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: WINGGOLDMAGYAR1500000RENDSZÁMOSHONDAmotorokHirdetőTovábbiféktárcsákkalrendszerosszes154199szállításbanPepitaképekértgumikkalKézTeljes101

Forrás: pepitahirdeto.multiapro.com

Rendelhető !!!!!!! ZEITGARD 1 arctisztító készülék a ragyogóan tiszta bőrért Zeitgard Discover Az arctisztítás új dimenziója Tiszta és ragyogó bőr elérése a ZEITGARD 1 arctisztító készülék segítségével. Az innovatív elektromos arctisztító kefe forradalmasítja a hagyományos arctisztítást. 10-szer hatékonyabban távolítja el a sminket és a szennyeződéseket anélkül, hogy a bőrt túlzottan igénybe venné. Egyedülálló higiénia A kefeszálakban található MicroSilver BG™ antibakteriális ... további részletek >>

hatóanyag biztosítja a higiénikus használatot. A MicroSilver BG™ védőpajzsként működik: elpusztítja a bőrről a kefeszálakra átkerülő baktériumokat, és megakadályozza az újraképződésüket. A bőrtisztítás új dimenziója Az innovatív ZEITGARD 1 arctisztító készülék forradalmasítja a hagyományos arctisztítást. Egyszerre hatékony és kíméletes a bőrhöz. Az elektromos arctisztító készülék és a kifejezetten hozzá kifejlesztett arctisztító készítmény láthatatlan hálót képez a bőrön, melynek segítségével a bőrön található szennyeződéseket eltávolítja. Használatukkal bőröd felkészíted az arcápolás további lépéseire. A bőr finom lesz, simább és ragyogó. Innovatív Zeitgard Innovative Principle ZEITGARD 1 arctisztító készülék A ZEITGARD arctisztító rendszert a legapróbb részletekig átgondoltuk: az oszcilláló mozgású kefe még a pórusok mélyén található szennyeződéseket is eltávolítja. A speciálisan a keféhez kifejlesztett arctisztító készítmények textúráját pedig úgy alakítottuk ki, hogy könnyedén eltávolítsa a bőr felső, elhalt hámrétegeit is. Az eredmény láthatóan tiszta és ragyogó bőr. Az arctisztító készülék keféjében rejlik az egyedisége Az egyedileg kidolgozott, legömbölyített végű kefeszálaknak köszönhetően lágyan tisztítja a bőrt. A kefe fejének 7.000 rezgés/perces sebessége gondoskodik az alapos tisztításról, ami lehetővé teszi a szennyeződések és a smink eltávolítását az arcbőrről. Tiszta és ragyogó arcbőrt eredményez. Tapasztald meg te magad! Könnyű használni Zeitgard Application Sugárzóan tiszta bőr 1 perc alatt? Bőrgyógyászatilag igazolt: a bőrgyógyászati vizsgálatok azt bizonyítják, hogy a ZEITGARD 1 arctisztító készülékkel 10-szer hatékonyabb az arctisztítás, összehasonlítva a hagyományos kézi tisztítással. Tisztítsd az arcbőr különböző területeit (homlok, orr, arc mindkét oldala, áll) körülbelül 20 másodpercig területenként. Bőröd olyan tapintású lesz, mint egy alapos krémezés után. Hatékony ápolás Ragyogó arcbőr 1 perc alatt. Használd naponta 1 percig a gyorsan látható eredmény érdekében. A ZEITGARD 1 arctisztító készülék és a ZEITGARD arctisztító készítmények tökéletesen kiegészítik egymást. Látható eredmény Javítja a bőr állapotát a mélytisztítás eredményeképpen Hatékonyabb felkészülés az arcápolás további lépéseire Ragyogóbb arcszín a bőr élénkebb mikrokeringésének köszönhetően Feszesebb, simább bőr


Feladva: 2016-10-23    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: arctisztítóZEITGARDbőrkészülékRagyogótisztakefehogytalálhatóeredményhagyományosszennyeződéseketInnovatívarctisztításdimenziója8482alattszerlesz

Forrás: pepitahirdeto.multiapro.com

Most akciósan eladó! Ha egy igazi terepjárót szeretne, elfogadható áron! Garázsban tartott, márkaszervizben szervizelt, szerviz által igazolhatóan rendszeresen szervizelve. Ára:3.000.000.-Ft Jelentkezni: 06202632620


Feladva: 2017-10-02    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 000általegyszervizeladószervizeltakciósanmárkaszervizbenMost06202632620tartottGyömrőJelentkezniGarázsbanZsuzsannaáronHazaiÁraelfogadhatócruiser

Forrás: pepitahirdeto.multiapro.com

Születésnap? Évforduló? Esküvő? Sütiben, tortában a Várfok Cuki a nyerő! Sütemények, torták, sós és édes finomságok, fagylaltok, jégkása, üdítő, tea és kávé különlegességek! Előrendelést telefonon is felveszünk!


Feladva: 2017-07-11    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: VárfokjégkásaSütibenfagylaltokEsküvőfinomságokÉvfordulóédesSzületésnapfelveszünksósBudapesttelefonontortákajánlóElőrendeléstSüteményekHirdetőkávé

Forrás: pepitahirdeto.multiapro.com

Tulajdonságok: - LED televízió, 40 cm (15,6”) képátlóval - USB bemenet - HD DVB-T/C közvetítés USB feljátszása - Időeltolódás funkció (Timeshift) - Multimédiás fájlok lejátszása pendrájvról - Támogatott formátumok: DivX, XviD, MP3, WMA, JPEG - Dinamikus kontraszt: 8.000:1 - Fényerő: 300 cd/m2 - Visszahatási ütemidő: 5 ms - HD READY (1366 x 768) - Beépített HD DVB-T/C (MPEG4, MPEG2) tuner - PAL, SECAM BG/DK/I/NICAM, AV bemenet i NTSC 4,43 - Képfelbontás: WXGA 1366 x 768 Px - ... további részletek >>

Látószög: 150°/150° - Elektronikus műsorkalauz (EPG) - Teletext - Több nyelvű menü - Digitális fésűs szűrő (DCF) - ZOOM - Ekvalizer - Kikapcsolás-időzítő - Automatikus kikapcsolás - Gyermekóvintézkedés - Hotel üzemmód - Kimeneti teljesítmény: 2x 3 W - VESA méretben (100 x 100 mm) - Csatlakoztatható: HDMI, SCART, AV bemenet, VGA, PC Audio bemenet, USB, CI slot - Fogyasztása készültségi üzemmódban: 20 W / 0,5 W - A készülék méretei (sz x ma x mé): 376 x 240 x 38 mm - Méretek állvánnyal (sz x ma x mé): 376 x 274 x 120 mm - Tömege (készülék/csomagolás): 1,3/2,5 kg Ugrás a televízióhoz: www.aqua.hu/sencor-sle-1660m4-156-hd-ready-led-tv-303503.html


Feladva: 2017-07-15    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: bemenetUSBledready1660m4768sleDVB3761366sencorkikapcsolás100készülék150LátószögTimeshiftKimenetiMPEG4Pepita274fésűsWMAfunkcióüzemmód

Forrás: pepitahirdeto.multiapro.com

Szállítás, költöztetés, árufuvarozás és minden más egyéb, ami belefér egy 1.5 t-ás Mazda dobozos kisteherautóba, azt korrekt, áfamentes fuvarköltséggel elszállítja Önnek a Thomka Trans fuvarozó cég. Hívjon bizalommal, akár hétvégén is!


Feladva: 2017-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: fuvarozásThomkaköltöztetésSzállításHívjonkorrektmáscégaztmindenfuvarozóautóbacomTransteheherárúwordpresskisthomkatransönnekdobozoshttpGöd

Forrás: pepitahirdeto.multiapro.com

Nem érzed magad biztonságban? Úgy érzed veszélyben van az életed? Van megoldás!!! Egy különleges harcművészet. A leghatékonyabb önvédelmi technikák. Az alapok 6 hónap alatt elsajátíthatóak. A támadó erejét használd fel a győzelemhez! - Önvédelmi tanácsok - Utcai szituációk kezelése - Jogtalan támadások elhárítása - Pszichikai felkészítés Ne legyél áldozat!


Feladva: 2017-09-26    [Sport - Kemping - Túra]

Címkék, kulcsszavak: BajaÖnvédelmiVanönvédelemérzederejétmegoldástámadásokNemtámadó06304670677JogtalanBajánelsajátíthatóakInfoválságindulkezelésealattvégéighónap

Forrás: pepitahirdeto.multiapro.com

A Balaton-felvidéken, Badacsonyhoz 5 km távolságra káptalantótii szálláshelyek fényképes gyüjtőoldala. Kiadó panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Sok fényképpel a szálláshelyekről és a faluról. - Weblap: