0.26 Üzlet - Befektetés - Pénzügyek hirdetések - ingyen apróhirdetés egyszerűen

• Üzlet - Befektetés - Pénzügyek

Nem tudja, hogy melyik lakástakarék szerződést válassza? Oldalunkon rengeteg hasznos információt megtalál. Kalkulátorunk segítségével megnézheti mekkora összeget kap. Kérje díjmentesen segítségünket, akár online. www.lakastakarekokosan.hu/blog/156 -melyik-lakastakarekot-valasszam Mire kell odafigyelni, mik lehetnek a buktatók? Ha érdeklődik, látogasson el honlapunkra, vagy kérjen díjmentes visszahívást.


Feladva: 2017-08-14    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: lakástakarékdíjmentesenrengeteglehetnekOkosanKérjeOldalunkonmikkapválasszaodafigyelniösszegetvisszahívástszerződéstkellmekkoradíjmentesMirekérjen

Forrás: pepitahirdeto.multiapro.com

Befektetési arany termékeinket azonnal, a fizetéssel egyidőben, készpénzért veheti meg Bp. 1085 József krt. 40. alatti központunkban és az oldalunkon felsorolt pénzváltókban. A pénzváltókban a választék és készlet mennyisége is kisebb mint a központban. Fizethet átutalással is, ilyen esetben hívjon minket telefonon! Központunkban és a készlettel rendelkező pénzváltókban (a budapestiek kivételével) el is adhatja aranyát, a központ mellett már Debrecenben is azonnal megkapja az ... további részletek >>

ellenértéket! A feltüntetett árakon kívül nincs semmilyen más költség. A vételi ár csak a fényképen látható és sérülésmentes csomagolású aranytömbökre, illetve a sérülésmentes érmékre vonatkozik. A listában nem szereplő aranytömböket és érméket is megvásároljuk egyedi ár alapján. www.correctgold.hu/befektetesi_arany


Feladva: 2017-07-14    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: pénzváltókbanaranybefektetesisérülésmentesazonnalKözpontunkbansemmilyenválasztékwwwközpontfizetésselhívjonnincsfelsoroltalapjánaranyáttermékeinket

Forrás: pepitahirdeto.multiapro.com

Hitelkártyák, személyi hitelek, egyesítése egy hitelbe! Jelenlegi hiteleinek havi törlesztését akár 50-40%-ra is le tudjuk csökkenteni. Még mielőtt fizetésképtelenné válik, jelentkezzen! Az ügyintézésért jutalékot nem kérünk, bankokkal vagyunk szerződve! Szűcsné B. Erzsi Személyi kölcsön értékesítő vezető 1214 Budapest Csepeli út 83. Telefon: 06-30-841-0329 E-mail: i nfo.szbe@gmail.com Web: www.hitel-city.hu és www.hitelügyintézés.com


Feladva: 2017-07-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzemélyiegyesítésehitelekcomBudapestcitytörlesztésétvezetőSándorjutalékothitelhaviértékesítőSzűcsügyintézésértszbe@gmailhiteleinekkölcsöninfo

Forrás: pepitahirdeto.multiapro.com

Amennyiben Önnek, vagy a cégének jogi problémája az alábbiak valamelyikével összefügg, keressen bizalommal! Gazdasági jog: - gazdasági társaságok alapítása, működésükkel kapcsolatos ügyek, egyéb cégjogi kérdések - cégek szerződéses vitái, cégek közötti kártérítéses ügyek - csőd, felszámolás Munkajog: - munkaviszonnyal kapcsolatos ügyek Polgári jog: - szerződésekkel kapcsolatos ügyek - szerződéskötés, azok teljesítésével kapcsolatos problémák, szerződések megszüntetése stb... - ... további részletek >>

ingatlan adásvételi szerződések - öröklés - tulajdonjog - kártérítés - élettársi kapcsolatokkal összefüggő kérdések, vagyoni viszonyok Családjog: - válás - gyermek elhelyezés - házassági vagyonjog Büntetőjog: - gazdasági, illetve vagyon elleni bűncselekmények Sportjog: - átigazolási és fegyelmi ügyek, ezekhez kapcsolódó speciális munkajogi kérdések, hivatásos és amatőr szerződések - sportszervezetek alapításával, működésével kapcsolatos ügyek - szponzorálási és arculat-átviteli szerződések


Feladva: 2017-07-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ügyekkapcsolatosszerződésekkérdésekgazdaságijogbizalommalcégekszerződéseselhelyezésvalamelyikévelezekhezadásvételiHirdetőátviteliházasságialábbiak

Forrás: pepitahirdeto.multiapro.com

Ennyiért még szórólapot sem kap! Kezdő weboldalaknak, weboldalakon, webáruházakban megjelenő akcióknak és internetes figyelemfelhívásoknak kifejezetten ideális! Egyszerűen használható kezelőfelületen beállítható, módosítható, ha kell...


Feladva: 2017-06-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: 000szórólapotfigyelemfelhívásoknakméginternetesEnnyiértakcióknakajánlókellmegjelenőHirdetőmódosíthatówebáruházakbanPepitabeállíthatóweboldalakonért

Forrás: pepitahirdeto.multiapro.com

A bevásárlóközpontok, plázák, mallok világszerte méltán népszerűek... Olyan igényt elégítenek ki, amivel mindenki nyer! Magyarországon is jelentősen növekedik az e-kereskedelem. Számtalan webáruházat találhatunk, jót is és kevésbé jót is... Azoknak a kereskedőknek figyelmére mindenképpen számítunk, akik már megtapasztalták a saját webhelyeiken nem csak az éppen hatályos jogszabályoknak kell megfelelni, hanem folyamatosan karban kell tartani a webhelyet, annak az elérhetőségét, különben a ... további részletek >>

látogatottság, vele együtt az üzleti eredmény is elmarad. Azok figyelmére is számítunk, akik (esetleg földrajzi adottságaik miatt?) fejlődésre csak az interneten keresztül számíthatnak. Internetes kereskedelemről van szó, pláza szerű webes környezetben! Nem feltétlenül mindenki alkalmas azonnal árusítani termékét, interneten forgalmazható szolgáltatását. Ismerjük meg egymást! Ön tudni szeretné, hogy miképp lehet kereskedő webplázánkban, mi pedig azt, hogy Ön milyen gyakorlattal (ismeretekkel) rendelkezik már az internetes kereskedelemben, milyen árucikkeket, termékcsoportokat forgalmazna. Ezen a helyen biztonságosan üzenetet küldhet, egy rövid bemutatkozást, cégismertetőt kérünk! Ha van webhelye, kérjük írja meg webcímét is! Minden olvasónak köszönet az érdeklődésért, az üzenetekre a legrövidebb időn belül válaszolunk!


Feladva: 2017-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: márNemhogyjótvaninternetenakikesetlegmilyenplázaszámítunkfigyelméreinternetesmegkellMagyarországonmindenkicsakkérjükegymástüzletinyeridőn

Forrás: pepitahirdeto.multiapro.com

Az Inlernet WorldWide AG svájci részvénytársaság egy olyan Globális Emberbaráti Fizetési Rendszert (Global Philanthropic Payment System) működtet, amely az üzleti élet minden területén jelentős előnyt biztosít a kereskedőknek és a szolgáltatóknak, valamint a vásárlóknak és ügyfeleknek egyaránt. A Globális Emberbaráti Fizetési Rendszer megelőzi korát, sokkal több előnyt nyújt a már ismert, és régóta használt fizetési rendszerekkel szemben (készpénz, utalvány, bankkártya, PayPal, Okos telefonos ... további részletek >>

fizetés, kripto valuta, stb.), ugyanakkor maximálisan biztonságos, költségkímélő, gyors, egyszerű, jelentős forgalomnövekedést biztosíthat a kereskedőknek, szolgáltatóknak, és sokkal előnyösebb vásárlást jelent a vásárlóknak és ügyfeleknek. Előnyök a vásárlók és ügyfelek részére: Megismerkedtem egy lehetőséggel, amely forradalmasítja a fizetést és teljesen kiküszöböli a bankkártya költségeit, a kockázatát és még készpénzre se lesz szükséged, ahhoz hogy fizetni tudj! Most indul a bevezetése és Te az első között lehetsz! Tudod miért lényeges ez? Mert a cég minden olyan embernek, aki most megmutatja másnak is ezt a fizetési rendszert, a másik ember vásárlási értékének átlagosan a 0,5%-át jóváírja! És ez még nem minden! Mert ha az ismerősöd, akinek megmutattad, ajánlja az ismerősének, akkor ugyanezt az átlagos 0,5%-ot megkapod összesen négy szintig! Akár nemzetközi szinten is! És még mindig nincs vége! Jogosult lehetsz olyan jutalékokra is, amelyeket akár végtelen mélységig is megkaphatsz! Akár nemzetközi szinten is! Bankkártyánál tudsz ilyen lehetőségről? Mennyit keresel abból, ha az ismerősöd bankkártyával fizet? De ez még nem minden! A saját vásárlásod értékének rövid távon átlagosan a 7%-át visszakapod! Közép távon pedig akár az elköltött pénzed 66%-át is visszakaphatod! Bankszámla, bankkártya és készpénz nélkül is tudsz vásárolni! Nincs többé bankkártya adataival való visszaélés! Semmilyen eszközre, vagy tárgyra nincs szükség ahhoz, hogy valaki fizetni tudjon! Ha szó szerint semmi nincs nálad, akkor is tudsz vásárolni és tudsz fizetni. Nem az a kérdés, hogy mennyi idő alatt terjed el ez a korszakalkotó fizetési mód a világban, hanem az, hogy Te hány millió ember mindennapi vásárlásából szeretnél profitálni folyamatosan, minden egyes másodpercben, amikor ezzel az egyszerű módszerrel fizetnek. Tudod mit jelent ez? Azt, hogy akár 5-10 alatt milliárdos lehetsz. Nem kell semmire sem befizetned, nem kell befektetned, nem kell sem MLM, sem más módon eladnod semmit sem, nincsenek vásárlási és egyéb kötelezettségeid, és nyugodtan foglalkozhatsz azzal a tevékenységgel, amellyel szeretnél. Mikor alkalmas a számodra, hogy megmutassam mindezt? Mikortól szeretnél pénzt keresni abból, amiből az elkövetkezendő generációnak lesz az egyik jelentős bevétele a földön? Email: rozsabusiness@gmail.com


Feladva: 2017-04-19    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: nemhogyakármindenfizetésitudsznincsmégbankkártyasemolyanszeretnéljelentőskelllehetszfizetnisokkalGlobálisahhozmostegyszolgáltatóknaklesz

Forrás: pepitahirdeto.multiapro.com

Társkereső weboldal baráti áron eladó. 3 in 1 megoldás. (Titkos, alkalmi, komoly). 1000-nél is több regisztrált felhasználó! .com-os, .hu-s domain nevekkel. Remek befektetés, ha komolyan gondolod. Alapozzad meg a jövődet! A részletekért hívj bátran!


Feladva: 2017-03-30    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: eladóweboldalTárskeresőnélBudapestgondolod1000AndraskomolyankomolyBundzselbefektetésalkalmiRemekTitkosnevekkelmegoldásbátrandomainhívjcom

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Mennyiért vásárolt az elmúlt hónapban? 50.000,- forintért? 100.000,- forintért? Esetleg többért? Mennyi visszatérítést kapott a vásárlásai után? 1%-ot? 2 %-ot? 5%-ot? Van egy rossz hírem az Ön számára! A múlt hónapban elköltött pénzét már soha nem fogja visszakapni! A jövő hónapban is így fog vásárolni, vagy kipróbálja azt a rendkívüli lehetőséget, melynek következtében azonnal visszakaphatja a kereskedő által adott kedvezmény akár 15%-át, és rövid-közép távon az elköltött pénze akár ... további részletek >>

66%-át! Nem tudom érti-e? Pl.: Ha a kereskedő adna Önnek 5% visszatérítést, akkor ennyit nyert, és vége, ennyi volt! Ha viszont a legtöbb esetben ugyan ott, ugyan azt megveszi, de rajtunk keresztül, akkor nem kap 5% visszatérítést, „csak” 4,5%-ot, viszont utána még több részletben visszakaphatja az elköltött pénzének akár 66%-át is! Tényleg olyan gazdag, hogy minden hónapban hajlandó 50-100 ezer forintot elveszíteni? Keressen bizalommal kérdéseivel! rozsabusiness@gmail.com


Feladva: 2017-03-29    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: visszatérítésthónapbanakárelköltöttnemugyankereskedőutánvásárlásaikapottMennyi100visszakaphatjaakkorforintért000viszontaztKeressenvisszakapni

Forrás: pepitahirdeto.multiapro.com

Pályázzon a különböző EU-s és állami támogatásokért! A Széchenyi 2020 program keretében meghirdetett felhívásokra a pályázatait - visszafizetési garancia mellett - rövid határidőre elkészítjük. Ne maradjon le a támogatásokról! Részletek a honlapunkon! Vagy ne írasson pályázatot: www.civishitel.hu/ne-irasson-palya zatot-/


Feladva: 2017-02-07    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: sikerdíjasanmaradjonprogramPályázatíráselkészítjük2020határidőreSzéchenyirövidtámogatásokértmellettállamigaranciakülönbözővisszafizetésiPályázzon

Forrás: pepitahirdeto.multiapro.com

Albérletből könnyedén saját otthonba! Kérd segítségünket! Üzenetben megadott telefonszámon is visszahívunk. Albérletben te is saját lakásról álmodozol? Esetleg meglévő lakásodat bővítenéd, vagy cserélnéd nagyobbra? Amiben segíteni tudunk: Havi 20.000 forinttal, 30 %-os vissza nem térítendő állami támogatással, OBA garanciával, kamatadó- és járulékmentesség. Álmaid otthona neked is elérhető! Kérd üzenetben ingyenes visszahívásunkat telefonszámod és egy számodra megfelelő időpont ... további részletek >>

megjelölésével. Segítünk megteremteni, eligazítunk a lehetőségek között. Tájékoztatást nyújtunk személyesen. www.otthonteremtes-biztonsaggal.webnode.hu/ bindererika56@gmail.com


Feladva: 2016-12-26    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: sajátüzenetbenKérdvagycomtámogatássalOTTHONeligazítunknagyobbravisszahívunkbindererika56@gmailállamiALBÉRLETmegteremtenicserélnédtelefonszámonwebnode

Forrás: pepitahirdeto.multiapro.com

Állami támogatás kihelyezésével foglalkozom és mindenféle hitel közvetítésével, valamint biztosításokkal. Ingyenes tanácsadás, igényfelméréssel egybekötve, hogy legalább az információ meglegyen, ami nélkül hozzuk meg sorra a rossz döntéseinket. Kiválasztjuk együtt a legjobb megoldást és elmondom mit hogyan kell csinálni ahhoz, hogy saját otthonod melegét érezd és a saját kertedet szépítsd. Kérjetek visszahívást tőlem itt: www.otthonteremtes-biztonsaggal.webnode.hu vagy itt: ... további részletek >>


Feladva: 2016-11-06    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: hogytámogatásÁllamitanácsadásIngyenesittsajátotthonteremtesegybekötvedöntéseinkethttpigényfelmérésselahhozrossztőlemcsinálniBudapestsorrakell

Forrás: pepitahirdeto.multiapro.com

Meglévő hiteleinek törlesztő részletét, akár havi 50%-ra is, tudjuk csökkenteni. Hitelkártyák, személyi hitelek, folyószámla hitelkeret összevonásával. Hitelt szeretne? Regisztráljon! Hitelét jutalékmentesen intézzük! Szűcsné B. Erzsi: 30/841-0329, Szűcs Sándor: 30/841-0330. Mielőtt lépne, feltétlenül keressen bennünket! i nfo.szbe@gmail.com, h itelciti@gmail.com


Feladva: 2016-10-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: Szűcsné841comhitelekbennünketXXIszemélyikeressenBudapestintézzükHitelkártyákfeltétlenErzsébetjutalékmentesencsökkentenilépneCSOKHiteléttudjuk

Forrás: pepitahirdeto.multiapro.com

Könyvelés - Cégalapítás - Székhelyszolgálat Hosszított esti és hétvégi elérhetőséggel állunk Ügyfeleink rendelkezésére. Jelenlegi és leendő partnereinkkel a kölcsönös és feltétlen bizalmon alapuló baráti és üzleti kapcsolatra törekszünk, hiszen ebben a szakmában ez elengedhetetlen. Kft, Bt könyvelése 7.000 Ft-tól Egyéni vállalkozó könyvelése 6.500 Ft-tól Székhelyszolgálat 4500 Ft-tól Cégalapítás 19.990 Ft-tól Célunk, hogy az Ön számára is hasznos segítség lehessünk ... további részletek >>

mindennapjaihoz. Reméljük, hamarosan Önt is ügyfeleink körében üdvözölhetjük, s egyúttal várjuk mielőbbi jelentkezését. Részletes információ weboldalunkon!


Feladva: 2016-10-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: tólmindenMostügyfeleinkCégalapításSzékhelyszolgálatingyenKönyveléskönyveléseÜgyfelünknekegyúttalbarátiszámáraelérhetőséggelEgyéniüdvözölhetjükalapuló

Forrás: pepitahirdeto.multiapro.com

Elégedetlen a könyvelőjével? Új vállalkozást tervez? Adótanácsadásra van szüksége? Ne késlekedjen, keressen bennünket! Szombathely belvárosában több mint 15 éves szakmai tapasztalattal, valamint ügyvédi és könyvvizsgálói háttér biztosításával várjuk leendő megrendelőink jelentkezését Szombathely agglomerációs körzetéből is. Ügyfeleink igénye esetén a könyvelési anyagok a vállalkozás telephelyén történő átadása lehetséges. Teljes körű számviteli szolgáltatás ellátását vállaljuk egyéni ... további részletek >>

vállalkozók, Kkt-k, Bt-k, Kft-k, Rt-k, részére.


Feladva: 2016-10-05    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzombathelyszolgáltatásszámvitelikörűTeljesKftegyénimintkönyvelőjévelvállalkozásleendőtöbbvállaljukElégedetlenanyagokvárjukbelvárosábanellátását

Forrás: pepitahirdeto.multiapro.com

Pályázatírás másképpen Biztosan sok helyen olvashatja, hogy ingyenes pályázatírás, ingyenes tanácsadás stb. …. de elege van, hogy a végén MINDIG MINDENT ÖNNEK KELL KITALÁLNIA???? Ráadásul a számla kiállítása után a lehető leghamarabb el is feledkeznek Önről? Ha szeretné, hogy…. - 15 perc „ingyenes tanácsadás” helyett tényleg EGYÜTT GONDOLKOZZANAK ÖNNEL - egyetlen gépbeszerzés helyett KOMPLETTEN, egyben vizsgálnák cégének valódi szükségeit - valóban ... további részletek >>

TEHERMENTESÍTSÉK az összes pályázatírással kapcsolatos papírmunkától - VÉGIGKÍSÉRJÉK az egész pályázati folyamatot az előlegtől a záró-ellenőrzésig - KAPCSOLATI TŐKÉT is kapjon pályázatához, ne csak egy számlát a pályázat megnyerésekor Akkor kérjen időpontot a +36 30 928 3621 telefonszámon (vagy montaltechkft@gmail.com e-mail-en) Zakor Beátától és várjuk Önt budaörsi irodánkban.


Feladva: 2016-09-29    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ingyeneshogytanácsadáshelyettpályázatírás8230zárószeretnéZakorvalóbanÖNNEKmegnyerésekorGONDOLKOZZANAKBiztosanelőlegtőlÖnrőlmailszükségeitMINDENT

Forrás: pepitahirdeto.multiapro.com

Mindenki számára egyszerűen és gyorsan kezelhető, folyamatosan a hatályos jogszabályok szerint fejlesztett számlázó program, készletnyilvántartó program és házipénztár szoftver. A programok DEMO változata díjmentesen kipróbálható! Díjmentes belföldi szállítás akár másnapra, letöltés esetén munkaidőben akár 1 órán belüli használatba vétel. CD-s változatban is igényelhető, több száz referenciával, ügyfélszolgálattal, NAV igazolással. www.naturasoft.hu/szamlazo_program .php


Feladva: 2016-08-17    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: programszámlázónaturasoftakáregyszerűenszállításváltozatbanBudapestbelföldiszamlazofejlesztettvételDíjmentesszerinthasználatbakipróbálhatówwwbelüli

Forrás: pepitahirdeto.multiapro.com

Ha van egy vállalkozási ötlete, de nincs (elég) pénze a megvalósítására hívjon, írjon, segítünk. Keresünk Önnek egy olyan befektetőt, aki addig finanszírozza vállalkozását, amíg az szükséges. Szolgáltatásunk sikerdíjas! Részletek a honlapunkon: www.civishitel.hu/vallalkozoi-hite lek


Feladva: 2016-07-23    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: pénzenincsötleteegyvansegítünkHitelirodaamígírjonCívishitelvállalkozásáthívjonfinanszírozzamegvalósításáraaddigakielégbefektetőthonlapunkon

Forrás: pepitahirdeto.multiapro.com

Tisza parti üdülőfaluban, különleges adottságokkal és széles vendégkörrel rendelkező 40 fő befogadására alkalmas étterem 30 fős terasszal, teljes berendezéssel, gépekkel családi okok miatt eladó. Az étterem 2015-ben épült, tetőtérben lakás, vagy vendégszobák kialakítására van lehetőség. Füvesített, gyümölcsfákkal, locsolórendszerrel ellátott, valamint belső parkolónak kialakított 1300 nm-es telken az épület 138 nm + terasz + tetőtér beépítési lehetőség. Az ingatlan Szegedtől 25 km-re, ... további részletek >>

Mártélyon, a természet közvetlen közelében, pusztai kilátással, ugyanakkor főút mellett helyezkedik el. Kiváló vendéglátás-turisztikai célra, vagy akár egy komplex családi birtok berendezésére. Az ingatlan csatornázott, központi fűtéses. Az étterem gépesített konyhával, pizza kemencékkel, raktárakkal, előkészítőkkel ellátott, igényesen berendezett és felszerelt. Az állandó vendégkör gyors megtérülést eredményez, ezáltal befektetésnek is kiváló lehetőség! A megadott ár irányár!


Feladva: 2016-07-19    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: étteremlehetőségcsaládiberendezésselteljesvagykiválóellátottingatlaneladóFüvesítettmegtérüléstugyanakkorokokpizza138adottságokkalkomplexvanegy

Forrás: pepitahirdeto.multiapro.com

Szabaduljon meg adóssággal terhelt cégétől, akár több milliós tartozás esetén is. Eladósodott veszteséges, banki vagy köztartozással terhelt,tagi hitel és házipénztár gondokkal küzdő, csődközeli cégek ÁTVÉTELE, kiközvetítése belföldi partnerek részére. Hivatalos, gyors ügyintézés, jogi garanciával. (Végrehajtás, végelszámolás NEM AKADÁLY) 15 MFt feletti adósság esetén is! Problémás cégek adás vétele, ügyvezető kölcsönzés, cégalapítás.


Feladva: 2016-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: cégekeseténterheltSzabaduljonNEMkiközvetítésebankiügyvezetőKatalinvégelszámolásÁTVÉTELEveszteségesvételeMagyarVégrehajtáscsődközeliEladósodottadás

Forrás: pepitahirdeto.multiapro.com

Síremlékek és urnák műanyagból! A Magyar Szabadalmi Hivatal által kizárólagos ipari-jogvédelemmel ellátott műanyag síremlék. Könnyű, akár egyénileg felállítható, szállítható, mozgatható, mosható, csavarozható elemekből áll, névtábla, váza, fed lap, anyagában színezhető, esetleg, külön igény szerint fényezhető, nagyon praktikus, esztétikus és kedvező árfekvésű síremlék! Olyan befektetők jelentkezését várjuk, akiket a termékek gyártási joga érdekel!


Feladva: 2016-05-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: síremlékgyártásiakárpraktikusműanyagbólvázatermékekKönnyűnagyonurnáknévtáblaakiketműanyagfényezhetőSíremlékekállvárjukellátottszerintLászló

Forrás: pepitahirdeto.multiapro.com

Kampány, hirdetés, figyelem felhívás egy helyen, saját beállítási panellel! Legyen jelen több, mint 3550 különböző weboldalon egyszerre! Érjen el több tízezer értékelhető megjelenést alkalmanként! Már 2.000 Ft-tal is létrehozhatja első kampányát...


Feladva: 2016-03-17    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: eszközökkelpanellel000PepitaLegyentalHirdetőjelenlétrehozhatjaKampány3400kampányáthirdetéskülönbözőfigyelemweboldalonfelhívástöbbegytízezer

Forrás: pepitahirdeto.multiapro.com

Ha Ön és cége, vállalkozása > termékeinek, valamint szolgáltatásainak új piacot keres > szabad kapacitását szeretné lekötni > szellemi termékeit szeretné értékesíteni > Telephelyét, ingatlanát óhajtja eladni > együttműködésre törekszik külföldi cégekkel > képviseletet óhajt külföldön > reklámra, vagy telemarketingre van szüksége, akkor cégünkben megbízható partnerre talál!


Feladva: 2016-02-13    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: szeretnéképviseletettermékeitmegbízhatócégecégekkelszellemicégünkbenPartnerkülföldilekötniakkorBusinesstörekszikkapacitásátszükségeEuroszabadvan

Forrás: pepitahirdeto.multiapro.com

Csatlakozzon a legjobb feltételekkel a mi rendszerünkhöz! Belépési díj akár 0 Ft! Havi szolgáltatási alapdíj akár 0 Ft! A hirdetési költségek nagy részét átvállaljuk partnereinktől! Vállalkozásunk 1996 óta foglalkozik ingatlanközvetítéssel és a hozzá kapcsolódó, ezt elősegítő kiegészítő tevékenységekkel. Sikerünk alapja a költségtakarékos működés és a saját fejlesztésű know-how. Ezt a tudást és tapasztalatot adjuk át jövőbeni partnereinknek. Minden megyéből várjuk a jelentkezőket!


Feladva: 2015-12-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: MakkosknowfranchiseCentrumIngatlanlehetőségetátadásdinamikusanaztcéljábólterületenakikkörűfejlesztéseezenvállalkozóknakTeljeskiépítéseindítani

Forrás: pepitahirdeto.multiapro.com

Könyvelés és bérszámfejtés kedvező áron Angyalföldön a Full Active Bt. könyvelőirodában. Egyéni vállalkozások és társas vállalkozások könyvelése kedvező áron. SZJA bevallás magánszemélyeknek kedvező áron. Könyvelését bízza hozzáértőkre! Visszamenőleges könyvelést is vállalunk. Ha bármilyen kérdése lenne könyvelés ügyben, keressen minket bizalommal. Tel: 412-08-06, Fax: 412-08-07


Feladva: 2015-01-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: áronkedvezőkönyvelésActiveFullAngyalföldönbérszámfejtés412vállalkozásokhozzáértőkreEgyéniminketbízzakönyvelőirodábankeressenKönyvelésétügybenlenne

Forrás: pepitahirdeto.multiapro.com

Mind az 50 államban tudunk céget alapítani. Először kérjen időpontot egy ingyenes konzultációra amikor igényeihez mérve segítünk kiválasztani a legmegfelelőbb államot, hogy igazán sikeres legyen a nemzetközi vizeken. Budapesti irodánk hétfőtől péntekig várja meglévő és leendő ügyfeleinket a személyes találkozótól kezdve, az amerikai kontinensen található képviselők több nyelvű ügyintézéséig, a hét minden napján.


Feladva: 2014-08-16    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: amerikaiBudapestimérvekezdvetudunkvizekennapjánigényeiheztalálkozótólállambannemzetközimindenamikorszemélyesMindlegyenhétkonzultációraBUDAPEST

Forrás: pepitahirdeto.multiapro.com

Ön kötött biztosítást a lakására, az autójára? Bizonyára igen a válasza. És arra, aki mindezt létrehozta, egy élet munkájával előteremtette, vagyis önmagára kötött-e biztosítást? Ne késlekedjen! Az UNIQA Puzzle balesetbiztosításával korszerű, sokoldalú és magas összegű szolgáltatásokat fizető biztosítással vértezheti fel magát, illetve családját. Tájékozódjon: nézzen bele a www.privatbiztositasok.nanoweb.hu< /a> honlapba, s keresse a Rizikókat.


Feladva: 2013-09-04    [
Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: igenegybiztosítástkötöttprivatbiztositasokválaszaszolgáltatásokatönmagárabeleösszegűvagyisBizonyáranézzenmagaselőteremtetteautójáraTájékozódjonélet

Forrás: pepitahirdeto.multiapro.com

Eladó 2013 óta működő gyerekjatekbirodalom.hu webshop profilváltás miatt. Egyedi fejlesztésű jól felépített, bővíthető admin felülettel és arculattal, tárhellyel és kulcsszavas domain névvel. Sok kulcsszóra TOP5-ben szerepel. Profi Seo-s és Adwords kampány menedzser elérhetőségével. Beszerzési forrásokat megadom. 21 500 egyedi szövegezésű termék van feltöltve. Bőven vannak még általunk ki nem használt marketing lehetőségek a vevőszerzésre. CMS tartalomkezelő rendszer tulajdonságai: Termék ... további részletek >>

eladási statisztikák Fogyasztói statisztikák Fogyasztói címlista kezelés Magyar vagy Angol nyelvű felület Korlátlan menürendszer Korlátlan cikk kezelés Szövegszerkesztés Tartalmak címkézése Letöltések alkalmazása SEO elemek használata Tartalomcímkézés Többszintű felhasználó kezelés jogosultsági szintekkel Biztonsági időzár Multimédiás tartalom beillesztése Képméretek egyedi alakíthatósága (bannerek, termékképek, bélyegképek, stb.) Tartalmak kategorizálhatósága, szűrése Webshop funkciók: Egyszerű termékfeltölthetőség, paraméterezés Termékkereső Inteligens checkout Inteligens, módosítható kosár Legnépszerűbb termékek Automatikus vevőértesítés E-mail- ben Alap hírlevél küldő rendszer Kapcsolat, elérhetőség és Google map Egyedi felhasználói regisztráció Párhuzamos kategorizálás Többszintű kategorizálás Raktárkészlet kezelő modul Rendelés nyomon követés Ingyenes kiszállítás lehetősége Termékajánló ÁFA kezelő alrendszer Google eszköz integráció Vásárlói csoportok létrehozása Dinamikus bannerváltó Megrendelési státuszok megadása Kapcsolati modul Szabadszavas kereső Termékrendezés Egyéb kommunikációs elemek Árkedvezmény vásárlói csoportoknak Hűségpontrendszer Kuponrendszer Excel export import egyedi excel tábla + termékáttöltés Egyedi adminszűrő (változott árú terméket, új terméket jelzi) Seo generáló A termékeket nem szükséges egyesével az adminisztrációs felületen keresztül feltölteni, hanem az adatokat egy átlátható Excel táblázat segítésével is be lehet importálni a webáruház adatbázisába. Így a napi használat nagy mértékben egyszerűsödik azáltal, hogy elég egyetlen táblázatot kezelni, majd néhány kattintással beimportálni a webáruházba. Ár: megegyezés szerint Ár: Nincs megadva Weboldal: http://gyerekjatekbirodalom.hu Domain: gyerekjatekbirodalom.hu


Feladva: 2017-09-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: egyedikezelésExcelgyerekjatekbirodalomSEOterméketFogyasztóistatisztikákkategorizálásnemKorlátlanTermékdomainkezelőTöbbszintűInteligensmodulWebshop

Forrás: pepitahirdeto.multiapro.com

Társkereső weboldal baráti áron eladó. 3 in 1 megoldás. (Titkos, alkalmi, komoly). 1000-nél is több regisztrált felhasználó! .com-os, .hu-s domain nevekkel. Remek befektetés, ha komolyan gondolod. Alapozzad meg a jövődet! A részletekért hívj bátran!


Feladva: 2017-09-15    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: eladóweboldalTárskeresőhívjcomáronrészletekértfelhasználóbarátijövődetregisztráltmegtöbbAlapozzadnélBudapestgondolod1000Andraskomolyankomoly

Forrás: pepitahirdeto.multiapro.com

Mindenki számára egyszerűen és gyorsan kezelhető, folyamatosan a hatályos jogszabályok szerint fejlesztett számlázó program, készletnyilvántartó program és házipénztár szoftver. A programok DEMO változata díjmentesen kipróbálható! Futáros belföldi szállítás akár másnapra, letöltés esetén munkaidőben akár 1 órán belüli használatba vétel. CD-s változatban is igényelhető, több ezer referenciával, 21 ezer felhasználóval, szakmai ügyfélszolgálattal. www.naturasoft.hu/szamlazo_program .php


Feladva: 2017-09-01    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: programakárezeregyszerűenszámlázónaturasoftszakmaifolyamatosanDEMOfelhasználóvalkezelhetőmunkaidőbenprogramokgyorsaneseténszoftverreferenciávaltöbb

Forrás: pepitahirdeto.multiapro.com

Meglévő hiteleinek törlesztő részletét, akár havi 50%-ra is, tudjuk csökkenteni. Hitelkártyák, személyi hitelek, folyószámla hitelkeret összevonásával. Hitelt szeretne? Regisztráljon! Hitelét jutalékmentesen intézzük! Szűcsné B. Erzsi: 30/841-0329, Szűcs Sándor: 30/841-0330. Mielőtt lépne, feltétlenül keressen bennünket! i nfo.szbe@gmail.com, h itelciti@gmail.com


Feladva: 2017-08-28    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: hitelekSzűcsné841comszbe@gmailhiteleinek0329folyószámlainfoMeglévőErzsibennünketXXIszemélyikeressenBudapestintézzükHitelkártyákfeltétlenüllépne

Forrás: pepitahirdeto.multiapro.com

Hitelek Fix és kiszámítható 5,4 %-os kamatra a futamidő végéig,ingatlanfedezettel. Vásárlásra,felújításra,hitelkiváltá sra vagy amire Ön szeretné vagy akár végrehajtás alatt lévő ingatlan kiváltása,megvásárlása!!! Hívjon most! Mob: 06 70 54 66 966


Feladva: 2017-08-28    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: vagymostamireBudapestHívjonhitelkiváltásraAttilamegvásárlásafelújításraHorváthkiváltásaVásárlásramindenkinekingatlaningatlanfedezettelHitelmegoldás

Forrás: pepitahirdeto.multiapro.com

Hitelek Fix és kiszámítható 5,4 %-os kamatra a futamidő végéig,ingatlanfedezettel. Vásárlásra,felújításra,hitelkiváltá sra vagy amire Ön szeretné vagy akár végrehajtás alatt lévő ingatlan kiváltása,megvásárlása!!! Hívjon most! Mob: 06 70 54 66 966


Feladva: 2017-08-28    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: vagymostamireBudapestHívjonhitelkiváltásraAttilamegvásárlásafelújításraHorváthkiváltásaVásárlásramindenkinekingatlaningatlanfedezettelHitelmegoldás

Forrás: pepitahirdeto.multiapro.com

Hitelek Fix és kiszámítható 5,4 %-os kamatra a futamidő végéig,ingatlanfedezettel. Vásárlásra,felújításra,hitelkiváltá sra vagy amire Ön szeretné vagy akár végrehajtás alatt lévő ingatlan kiváltása,megvásárlása!!! Hívjon most! Mob: 06 70 54 66 966


Feladva: 2017-08-28    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: vagymostamireBudapestHívjonhitelkiváltásraAttilamegvásárlásafelújításraHorváthkiváltásaVásárlásramindenkinekingatlaningatlanfedezettelHitelmegoldás

Forrás: pepitahirdeto.multiapro.com

Hitelek Fix és kiszámítható 5,4 %-os kamatra a futamidő végéig,ingatlanfedezettel. Vásárlásra,felújításra,hitelkiváltá sra vagy amire Ön szeretné vagy akár végrehajtás alatt lévő ingatlan kiváltása,megvásárlása!!! Hívjon most! Mob: 06 70 54 66 966


Feladva: 2017-08-28    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: vagymostamireBudapestHívjonhitelkiváltásraAttilamegvásárlásafelújításraHorváthkiváltásaVásárlásramindenkinekingatlaningatlanfedezettelHitelmegoldás

Forrás: pepitahirdeto.multiapro.com

Hitelek Fix és kiszámítható 5,4 %-os kamatra a futamidő végéig,ingatlanfedezettel. Vásárlásra,felújításra,hitelkiváltá sra vagy amire Ön szeretné vagy akár végrehajtás alatt lévő ingatlan kiváltása,megvásárlása!!! Hívjon most! Mob: 06 70 54 66 966


Feladva: 2017-08-28    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: vagymostamireBudapestHívjonhitelkiváltásraAttilamegvásárlásafelújításraHorváthkiváltásaVásárlásramindenkinekingatlaningatlanfedezettelHitelmegoldás

Forrás: pepitahirdeto.multiapro.com

Szabaduljon meg adóssággal terhelt cégétől, akár több milliós tartozás esetén is. Eladósodott veszteséges, banki vagy köztartozással terhelt,tagi hitel és házipénztár gondokkal küzdő, csődközeli cégek ÁTVÉTELE, kiközvetítése belföldi partnerek részére. Hivatalos, gyors ügyintézés, jogi garanciával. (Végrehajtás, végelszámolás NEM AKADÁLY) Problémás cégek adás vétele, ügyvezető kölcsönzés, cégalapítás.


Feladva: 2017-07-17    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: cégekterheltházipénztárvételemilliósgyorsadósságrendezésselhiteladástöbbHivataloscégeladástagiakárrészéreCégátvételProblémáscégétőlpartnerekNEM

Forrás: pepitahirdeto.multiapro.com

Szabaduljon meg adóssággal terhelt cégétől, akár több milliós tartozás esetén is. Eladósodott veszteséges, banki vagy köztartozással terhelt,tagi hitel és házipénztár gondokkal küzdő, csődközeli cégek ÁTVÉTELE, kiközvetítése belföldi partnerek részére. Hivatalos, gyors ügyintézés, jogi garanciával. (Végrehajtás, végelszámolás NEM AKADÁLY) 15 MFt feletti adósság esetén is! Problémás cégek adás vétele, ügyvezető kölcsönzés, cégalapítás.


Feladva: 2017-07-17    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: cégekeseténterheltÁTVÉTELEvételeveszteségesVégrehajtásMagyarcsődközeliadásEladósodottgaranciávalfelettküzdőtartozásjogimilliógondokkalProblémás

Forrás: pepitahirdeto.multiapro.com

Meglévő hiteleinek törlesztő részletét, akár havi 50%-ra is, tudjuk csökkenteni. Hitelkártyák, személyi hitelek, folyószámla hitelkeret összevonásával. Hitelt szeretne? Regisztráljon! Hitelét jutalékmentesen intézzük! Szűcsné B. Erzsi: 30/841-0329, Szűcs Sándor: 30/841-0330. Mielőtt lépne, feltétlenül keressen bennünket! i nfo.szbe@gmail.com, h itelciti@gmail.com


Feladva: 2017-07-05    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: 841comhitelekSzűcsnéintézzükHitelkártyákfeltétlenülErzsébetjutalékmentesencsökkentenilépneCSOKHiteléttudjukMielőttKölcsönökRegisztráljonhavi0330

Forrás: pepitahirdeto.multiapro.com

Meglévő hiteleinek törlesztő részletét, akár havi 50%-ra is, tudjuk csökkenteni. Hitelkártyák, személyi hitelek, folyószámla hitelkeret összevonásával. Hitelt szeretne? Regisztráljon! Hitelét jutalékmentesen intézzük! Szűcsné B. Erzsi: 30/841-0329, Szűcs Sándor: 30/841-0330. Mielőtt lépne, feltétlenül keressen bennünket! i nfo.szbe@gmail.com, h itelciti@gmail.com


Feladva: 2017-06-03    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: 841comhitelekSzűcsnéHitelkiváltásHiteltrészletétSándorösszevonásávaltörlesztőhitelciti@gmailSzűcshitelkerethiteleinekszbe@gmail0329folyószámlainfo

Forrás: pepitahirdeto.multiapro.com

KIS és NAGY BEFEKTETŐK FIGYELEM! Most olyan innovatív cégbe fektethet be- ahol nemcsak egy vonalon kalkulálható a fejlődés projekten belül. Nem MLM rendszer, nem szükséges hálózatot építeni. Ma a legtámogatottabb projektek a környezet megóvásával, az újrahasznosítással kapcsolatos témájú projektek, pályázatok. Fektessen utódai jövőjébe, és legyen résztulajdonosa egy olyan Cégnek, amely ebben a témában élen jár! A célprojekt megvalósítása elkezdődött. A jövő már elkezdődött, tartson lépést ... további részletek >>

vele és profitáljon belőle!


Feladva: 2017-05-18    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: nemprojektekelkezdődöttolyanegymegóvásávaljövőfejlődésNAGYrésztulajdonosakörnyezetmegvalósításakalkulálhatóKISlegyenlegtámogatottabbcélprojektIlona

Forrás: pepitahirdeto.multiapro.com

Egy olyan rendkívüli fizetési mód kezdett elterjedni Magyarországról kiindulva a világon, amely a következő években, évtizedekben, teljesen átalakítja a fizetési szokásokat! Már elindult, legyen Ön is az elsők között. Minden embernek gyökeresen megváltoztathatja az életét, de az első pár millió embernek soha nem látott vagyont is jelenthet. Az eddig ismert összes fizetési mód együttesen nem tud annyi előnyt biztosítani, mint a cégünk által az egész világon levédett, egyedüli és rendkívül ... további részletek >>

egyszerű fizetési rendszerünk. Képzeljen el egy olyan fizetési módot, ahol Önnek szó szerint semmilyen fizetőeszközre nincs szüksége. Érdekesnek találja? Képzeljen el egy fizetési módot, melynek köszönhetően nemzetközi szinten is sok millió ember mindennapos vásárlása után, minden egyes másodpercben jövedelme keletkezik. Garantálom, hogy nem kell befektetnie, vagy befizetnie felesleges csomagokra, nem kell semmit sem eladnia MLM rendszerben, nincsenek kötelezettségei, és garantáltan több pénze lehet, kevesebb nem! Kizárólag a mindennapi megszokott vásárlásokból! Kérje e-mailen mindenre kiterjedő információs levelem. Email: rozsabusiness@gmail.com


Feladva: 2017-05-03    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: fizetésinemegymindenmódotKépzeljenolyanmillióembernekmódkellvilágonmindenreegészévekbentöbbismerthallottfeleslegesszógyökeresenmailenután

Forrás: pepitahirdeto.multiapro.com

Meglévő hiteleinek törlesztő részletét, akár havi 50%-ra is, tudjuk csökkenteni. Hitelkártyák, személyi hitelek, folyószámla hitelkeret összevonásával. Hitelt szeretne? Regisztráljon! Hitelét jutalékmentesen intézzük! Szűcsné B. Erzsi: 30/841-0329, Szűcs Sándor: 30/841-0330. Mielőtt lépne, feltétlenül keressen bennünket! i nfo.szbe@gmail.com, h itelciti@gmail.com


Feladva: 2017-05-02    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: hitelekSzűcsné841comfolyószámlainfoMeglévőErzsibennünketXXIszemélyikeressenBudapestintézzükHitelkártyákfeltétlenülErzsébetjutalékmentesenlépne

Forrás: pepitahirdeto.multiapro.com

Meglévő hiteleinek törlesztő részletét, akár havi 50%-ra is, tudjuk csökkenteni. Hitelkártyák, személyi hitelek, folyószámla hitelkeret összevonásával. Hitelt szeretne? Regisztráljon! Hitelét jutalékmentesen intézzük! Szűcsné B. Erzsi: 30/841-0329, Szűcs Sándor: 30/841-0330. Mielőtt lépne, feltétlenül keressen bennünket! i nfo.szbe@gmail.com, h itelciti@gmail.com


Feladva: 2017-04-02    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: 841comhitelekSzűcsnészeretneakárHitelkiváltásHiteltrészletétSándorösszevonásávaltörlesztőhitelciti@gmailSzűcshitelkerethiteleinekszbe@gmail0329

Forrás: pepitahirdeto.multiapro.com

Akciós áron pecsenyesütő eladó. kb. 18m2 nagyságú, könnyen mozgatható, fa burkolattal, kiépített elszívóval, elektromos vezetékekkel, vízvezetékkel és sütőberendezéssel együt. Előzetes megtekintés megbeszélés alapján Varga Ferenc 06309442233


Feladva: 2017-03-29    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: pecsenyesütőáronAkciósFerencVargaeladóvízvezetékkelvezetékekkel06309442233elektromoselszívóvalkiépítettalapjánburkolattalmegbeszélésmozgathatókönnyen

Forrás: pepitahirdeto.multiapro.com

Nagykovácsiban 21.427 m2-es telken 5.696 m2 összes beépítettségű 8 szobás étterem/panzió és egyéb épületek eladók. Az ingatlanon egy étterem/panzió épület és két részben lebontott csarnoképület található. Az egyik csarnok műhelyként, míg a másik filmstúdióként üzemelt korábban. Az ingatlan övezeti besorolása a Nagykovácsi Önkormányzatának honlapjáról letöltött helyi építési szabályzata szerint: Vt-11. Telekméret: 21.427 m2 Épületek méretei: 812 m2 étterem/panzió, 2.428 m2 részben lebontott ... további részletek >>

műhelyépület, 2.456 m2 részben lebontott korábbi filmstúdió. Övezeti besorolás: Vt-11 Legnagyobb beépítési százalék: 22,5% Legkisebb kialakítható terület: 10.000 m2 Szintterületi mutató: 0,8 m2/m2 Legkisebb zöldfelület: 50% Legnagyobb építménymagasság: 7,5 m Kiemelt befektetési érvek: Ideális fejlesztési terület több, mint 2 ha földterülettel, étterem és panzió 8 szobával, közel Budapest nívós lakóterületéhez, flexibilis, nagyméretű raktárral. Ár: 330 millió Ft + ÁFA


Feladva: 2017-02-18    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: panzióétteremlebontottrészbenÉpületekÖvezeti427LegnagyobbNagykovácsibanLegkisebbterületszobávalméreteiösszesKiemeltNagykovácsiÁFAbesorolás696

Forrás: pepitahirdeto.multiapro.com

Nagykovácsiban 21.427 m2-es telken 5.696 m2 összes beépítettségű 8 szobás étterem/panzió és egyéb épületek eladók. Az ingatlanon egy étterem/panzió épület és két részben lebontott csarnoképület található. Az egyik csarnok műhelyként, míg a másik filmstúdióként üzemelt korábban. Az ingatlan övezeti besorolása a Nagykovácsi Önkormányzatának honlapjáról letöltött helyi építési szabályzata szerint: Vt-11. Telekméret: 21.427 m2 Épületek méretei: 812 m2 étterem/panzió, 2.428 m2 részben lebontott ... további részletek >>

műhelyépület, 2.456 m2 részben lebontott korábbi filmstúdió. Övezeti besorolás: Vt-11 Legnagyobb beépítési százalék: 22,5% Legkisebb kialakítható terület: 10.000 m2 Szintterületi mutató: 0,8 m2/m2 Legkisebb zöldfelület: 50% Legnagyobb építménymagasság: 7,5 m Kiemelt befektetési érvek: Ideális fejlesztési terület több, mint 2 ha földterülettel, étterem és panzió 8 szobával, közel Budapest nívós lakóterületéhez, flexibilis, nagyméretű raktárral. Ár: 330 millió Ft + ÁFA


Feladva: 2017-02-17    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: panzióétteremlebontottrészbenÉpületekÖvezeti427LegnagyobbNagykovácsibanLegkisebbterületszobávalméreteiösszesKiemeltNagykovácsiÁFAbesorolás696

Forrás: pepitahirdeto.multiapro.com

Tisza parti üdülőfaluban, különleges adottságokkal és széles vendégkörrel rendelkező 40 fő befogadására alkalmas étterem 30 fős terasszal, teljes berendezéssel, gépekkel családi okok miatt eladó. Az étterem 2015-ben épült, tetőtérben lakás, vagy vendégszobák kialakítására van lehetőség. Füvesített, gyümölcsfákkal, locsolórendszerrel ellátott, valamint belső parkolónak kialakított 1300 nm-es telken az épület 138 nm + terasz + tetőtér beépítési lehetőség. Az ingatlan Szegedtől 25 km-re, ... további részletek >>

Mártélyon, a természet közvetlen közelében, pusztai kilátással, ugyanakkor főút mellett helyezkedik el. Kiváló vendéglátás-turisztikai célra, vagy akár egy komplex családi birtok berendezésére. Az ingatlan csatornázott, központi fűtéses. Az étterem gépesített konyhával, pizza kemencékkel, raktárakkal, előkészítőkkel ellátott, igényesen berendezett és felszerelt. Az állandó vendégkör gyors megtérülést eredményez, ezáltal befektetésnek is kiváló lehetőség!


Feladva: 2017-02-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: étteremlehetőségeladócsaládiberendezésselteljesvagykiválóellátottingatlanbefektetésnekhelyezkedik2015előkészítőkkelbeépítésirendelkezőberendezésére

Forrás: pepitahirdeto.multiapro.com

Adóbevallás, könyvelés, gazdasági szakmai szakértés, adóoptimalizálás, költséggazdálkodás, pályázatírás, üzletviteli tanácsadás, komplex irodai szolgáltatás távmunkában is. Nagyobb volumenű, vagy speciális megrendelések esetén jutalékot fizetek!


Feladva: 2017-02-06    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: könyvelésAdóbevallásadóoptimalizálásvolumenűszakértésNagyobbszakmaitávmunkábangazdaságiszolgáltatásirodaifizetekkomplexDebrecenjutalékottanácsadás

Forrás: pepitahirdeto.multiapro.com

Hitelkártyák, személyi hitelek, egyesítése egy hitelbe! Jelenlegi hiteleinek havi törlesztését, akár 50-40%-ra is le tudjuk csökkenteni. Még mielőtt fizetésképtelenné válik, jelentkezzen! Az ügyintézésért jutalékot nem kérünk, bankokkal vagyunk szerződve! Szűcsné B. Erzsi Személyi kölcsön értékesítő vezető 1214 Budapest Csepeli út 83. Telefon: 06-30-841-0329 E-mail: i nfo.szbe@gmail.com hitel-city.hu hitelügyintézés.com


Feladva: 2017-01-13    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzemélyiegyesítésehitelekcomBudapestválikmailhitelbeErzsifizetésképtelenné0329egySzűcsnémielőtt841szerződveMégTelefonvagyunkcsökkentenitudjuk

Forrás: pepitahirdeto.multiapro.com

Szabaduljon meg adóssággal terhelt cégétől, akár több milliós tartozás esetén is. Eladósodott veszteséges, banki vagy köztartozással terhelt,tagi hitel és házipénztár gondokkal küzdő, csődközeli cégek ÁTVÉTELE, kiközvetítése belföldi partnerek részére. Hivatalos, gyors ügyintézés, jogi garanciával. (Végrehajtás, végelszámolás NEM AKADÁLY) Problémás cégek adás vétele, ügyvezető kölcsönzés, cégalapítás.


Feladva: 2016-09-26    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: cégekterheltházipénztármilliósvételeadósságrendezésselgyorshiteltöbbadáscégeladásHivatalostagiakárCégátvételrészérecégétőlProblémáspartnerekmeg

Forrás: pepitahirdeto.multiapro.com

VÁRPALOTÁN 24.690 m2-es teleken 1.243 m2 összes beépítettségű raktárcsarnok, telephely eladó. A bruttó 1.400 m2-es raktárcsarnok épületen belül van 213 m2 iroda. 8 szintbeli ipari kapu biztosítja az árumozgatást. A területen gépjármű parkolás lehetséges. Parkolóhelyek száma 40 db. Kiemelt befektetési érvek: - Kiváló lokáció, közel a 8-as főúthoz - Tehergépkocsival megközelíthető - További fejlesztési lehetőségek a telek méretéből adódóan Ár: 100,- millió Ft+Áfa


Feladva: 2016-08-22    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: raktárcsarnokVÁRPALOTÁNeladólehetőségektelephelyKiemeltszintbelifejlesztésibeépítettségűszámairodaTovábbiösszesParkolóhelyek213megközelíthető243van

Forrás: pepitahirdeto.multiapro.com

HITEL! Ne Tedd! Változtass az életeden! Változtass a szokásaidon! Megtudod tenni!!! A hitelt minimum duplán kell visszafizetned. Ismerd meg és kezeld pénzügyeid ennek a szoftvernek a segítségével. Tedd el előre azt amit kifizetnél a hitelre. Ha már van hiteled, segít könnyebben rendezni azt. Töltsd Le Ingyen, tanulmányozd, használd. Megváltozik az életed! http://www.cashflow-mernok.hu/inde x.php?option=com_content&view=artic le&id=423&Itemid=478&cashflowp=2659


Feladva: 2016-08-21    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: HITELaztTeddVáltoztasscomIsmerdtanulmányozdkifizetnéloptionvisszafizetnedIngyenMáriaamitphpkellTöltsdCsúcs2659előreindexduplánmellett478

Forrás: pepitahirdeto.multiapro.com

A Világ egyetlen olyan marketing stratégiája, ahol egyszerre működik az üzleted sikerre vitele, és profit termelése. Egy online marketing rendszer, melyben gigantikus méretű, és egyre több és több jövedelmed keletkezik. Ez az, nézd csak: http://prim-333.site-mlm.com


Feladva: 2016-08-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: marketingtöbbsitegigantikusműködik333melybenegyszerreprimrendszeraholhttpstratégiájacsakonlineolyannézdEgyegyetlenkeletkeziktermeléseVilág

Forrás: pepitahirdeto.multiapro.com

Kategóriák: •   Állás - Munka - Távmunka   •   Autó - Motor - Jármű   •   Hobbi - Gyűjtemény - Modell   •   Állat - Növény - Tápszer   •   Vegyes hirdetések   •   Háztartás - Kert - Vegyiáru   •   Gép - Szerszám - Műszer   •   Egészség - Szépség - Gondozás   •   Iparcikk - Készülék - Konzol   •   Irodaszer - Dísztárgy - Ajándék   •   Baba - Gyerek - Játék   •   Bútor - Lakberendezés - Textil   •   Ház - Lakás - Ingatlan   •   Lakossági szolgáltatás   •   Biztonság - Őrzés - Védelem   •   Internet - Weboldalak   •   Könyv - Fotó - Film - Videó   •   Mobiltelefon - Tablet   •   Oktatás - Tanfolyam   •   Óra - Ékszer - Nemesfém   •   Régiség - Művészet   •   Ruha - Cipő - Divat   •   Sport - Sportfelszerelés   •   Számítástechnika - Irodatechnika   •   Szórakozás - Vendéglátás   •   Társkereső - Ismerkedés   •   Utazás - Üdülés - Szállás   •   Üzlet - Befektetés - Pénzügyek   •   Zene - Hangszer   •   Építés - Építőanyag - Szerelvény   •   Háztartási gép - Klíma   •   TV - Hifi - Házimozi   •   Élelmiszer - Hús - Étolaj   •   Irodabútor - Üzletberendezés   •   Közlemények - Felhívás - Adomány   •   Szállítás - Szállítmányozás   •   Fordítás - Tolmácsolás   •   Fényképezőgép - Kamera - Optika   •   Internetes pénzkeresés - MLM   •   Kegyelet - Ezotéria  


tegnap, 2 napja, 3 napja, 4 napja, 5 napja, 6 napja