0.24 hirdetések - ingyen apróhirdetés egyszerűen

Nincs találat .... Nézze meg kiemelt hirdétéseinket.

VW - Audi BONTOTT ALKATRÉSZ SZAKÜZLET! Bontott, gyári új és után gyártott, ALKATRÉSZEK, KAROSSZÉRIA ELEMEK nagy választékban! Már 18. éve vagyunk jelen az alkatrész piacon, több ezer bevizsgált alkatrész közül választhat! Futárszolgálattal 1 nap alatt az ország bármely területére eljuttatjuk a megrendelt alkatrészt! GYÁRI ÚJ alkatrészek 30-40%-al OLCSÓBBAN a márkakereskedésekhez képest! Kérjen tőlünk árajánlatot! Keressen minket elérhetőségeinken!! Tartott Típusok: VW: Amarok (2H) ... további részletek >>

, New Beetle (1C , 5C) , Caddy (9K , 2K) II-III , Crafter (2E) , Eos (1Q) , Golf IV,V,VI,VII (1J , 1K , 5K , 5Q) , Bora (1J) , Jetta (1K , 5C), Golf Plus (5M) , Scirocco (1K8) , Passat B3, B4, B5, B6, B7 (3A , 3B , 3C) , Polo III, PIV, (6N, 6N2), Polo V, VI, (9N, 9N2) , Polo VII (6R) , Polo Classic (6K) , Sharan I-II-III (7M , 7N) Tiquan (5N) , Touran (1T) II-III, IV, Touareg (7L) , Transporter T4- T5 (70 , 7H , 7J) , LT (2D) , UP (1S) Audi: A3 (8L , 8P) , A4 (8D , 8E , 8K) , A4 Allroad (8K) , A5 (8T) , A6 (4B , 4F , 4G), A6 Allroad (4B , 4F) A8 (4D , 4E) , Q3 (8U) , Q5 (8R) , Q7 (4L) Skoda: Octavia (1U , 1Z) , Fabia (6Y , 5J) , SuperB (3U , 3T) , Roomster (5J) , Yeti (5L), Rapid (5J) Seat: Alhambra (7M , 7N) , Altea (5P), Arosa (6H), Cordoba (6K , 6L) , EXEO (3R) , Ibiza (6K , 6L , 6J) Leon (1M , 1P), Toledo (1M , 5P) -VW- VOLKSWAGEN-AUDI Seat, Skoda ABS egység akkumulátor bölcső csonkállvány dugattyú EGR szelep elektromos szervó első - hátsó lökhárító, felnik féltengely fényszóró futómű függönylégzsák generátor hajtókar hengerfej homlokfal hűtőmaszk kárpit tartozékok kettős tömegű lendkerék kilincs klímahűtő klímakompresszor klíma ventillátor kormánymű kormányzsák kuplung lámpák légzsákok lendkerék lengőkar lökhárító rács motoralkatrész motorháztető műszerfal párna nagynyomású szivattyú negyedek oldal üveg önindító övfeszítő PD elem sárvédő szélvédő szervó szivattyú tandempumpa tetősín tükör üzemanyag szivattyú váltó vezérműtengely vízhűtő xenon fényszórók záralkatrész Csak olyan alkatrészt adunk el Önöknek, amit mi is szívesen látnánk az autónkban! Bontott alkatrészek vásárlása esetén választhat ajándékaink közül: elakadásjelző háromszög, kerékkulcs, téli ablakmosó folyadék! MINDEN KEDVES MEGLÉVŐ ÉS LEENDŐ ÜGYFELÜNK FIGYELMÉBE AJÁNLANÁM KÖVETKEZŐ AKCIÓNKAT! HA ELJÖSSZ HOZZÁNK ÉS FELRAGASZTHATUNK NEKED EGY MATRICÁT A HÁTSÓ SZÉLVÉDŐDRE AMIVEL NEMCSAK CÉGÜNKET REKLÁMOZOD HANEM JÓL IS MUTAT, 2000 Ft-os KEDVEZMÉNYT KAPSZ A VÁSÁRLÁSOD VÉGÖSSZEGÉBŐL, VAGY IGÉNY SZERINT AJÁNDÉKUTALVÁNY FORMÁJÁBAN!!!! Továbbá fagyálló és ablakmosó folyadékméréssel állunk rendelkezésére és hibakód olvasással is várjuk önöket!


Feladva: 2017-03-27    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BontottPoloIIIAUDIalkatrészekszivattyúSkodaalkatrészSeatszervóVIIAllroadlökhárítóközülHÁTSÓablakmosólendkerékválaszthatalkatrésztGYÁRIGolf

Forrás: pepitahirdeto.multiapro.com

Könyv kínálatunkban leginkább gyerek és ifjúsági könyvek szerepelnek, de a felnőttek számára is vannak ajánlataink. Nagy figyelmet fektetünk a tanulást segítő könyvek terjesztésére is, ezért azokat egy külön kategóriába gyűjtöttük össze. A gyermekek számára foglalkoztató könyvek és füzetek is nagy választékban elérhetőek. Minden könyv 20 % kedvezménnyel kapható! A könyveken túl plüssök, fiús és lányos játékok, gyermekruhák, gyermekágyneműk, párnák és sok más ajándékötlet szerepel a ... további részletek >>

palettánkon. Mi abban szeretnénk segítséget nyújtani mindenkinek, hogy a szívéhez közelálló ajándékot megtalálja. Ha ajándékot adsz másnak - azzal magadat is megajándékozod mert, bármi válhat ajándékká - egy ölelés, egy boldog mosoly… Nézz be webáruházunkba és szerezz örömöt szeretteidnek a honlapunk kínálatából!


Feladva: 2016-10-19    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: egykönyveknagyajándékotszámárakönyvazzalválasztékbanszeretnénkazokatmosolylányosifjúságimásnakabbanezértboldogfiúsgyerekadszfüzetekplüssök

Forrás: pepitahirdeto.multiapro.com

Születésnap? Évforduló? Esküvő? Sütiben, tortában a Várfok Cuki a nyerő! Sütemények, torták, sós és édes finomságok, fagylaltok, jégkása, üdítő, tea és kávé különlegességek! Előrendelést telefonon is felveszünk!


Feladva: 2017-07-11    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: VárfokjégkásaSütibenfagylaltokEsküvőfinomságokÉvfordulóédesSzületésnapfelveszünksósBudapesttelefonontortákajánlóElőrendeléstSüteményekHirdetőkávé

Forrás: pepitahirdeto.multiapro.com

Problémás a matek? Tanulj a ”Rendhagyó matek” sorozat könyveiből! Szeretsz gondolkodni, logikai feladatokat megoldani? Rengeteg feladatot találsz megoldásokkal a ”Gondolkodj!” című könyvben. Esetleg a természetbe vágysz? Szívesen olvasnál túraleírást, érdekel a Kéktúra? Akkor olvasd el a ”69 nap alatt Magyarország körül” című kiadványt. A megadott honlapon valamennyi könyvbe bele is olvashatsz.


Feladva: 2015-10-21    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: 8221matekcíműEsetlegbeleSzeretsznapkönyvbenkönyvbekönyveibőlolvasdGondolkodjvalamennyisorozatAkkormegoldásokkalhonlaponKéktúratalálszmegadott

Forrás: pepitahirdeto.multiapro.com

Minden gépjárműre személyautóra,kisteherautóra,kamionra traktorra,buszra,készítünk méret pontos üléshuzatot. Legalább 100 fajta anyag minta közül választhat. Uv álló anyagok, gyári kárpit anyagok, utángyártott anyagok, elasztikus anyagok, szövetek, között válogathat.A különböző színű, mintájú,vagy minőségű anyagok össze variálásának,csak az ön fantáziája szabhat határt. Vásárolhat nálunk trikó üléshuzatokat, valamint univerzális üléshuzatokat is.Várjuk szeretettel. Tekintse meg web ... további részletek >>

oldalunkat:huzatkiraly.hu Bán&Vincze BT Kecskemét Jókai utca 41 Telefon:0630/911-1277 0630/4853749


Feladva: 2016-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: anyagokVinczeBán0630üléshuzatokatKecskemétkárpitvalamintpontosminőségűüléshuzatgyáritrikóméretvagyMéretpontoshuzatkiralyállónálunkkészítünk

Forrás: pepitahirdeto.multiapro.com

Szellőző utólagos beépítése fa ablakba, műanyag ablakba, fém ablakba! Szellőző utólagos beépítése 1 munkanapon belül! Szellőző beépítése az Ön otthonában percek alatt!


Feladva: 2015-12-25    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: szellozobeépítéseutólagosablakdokiotthonábanbelülmunkanaponbeepitesutóladoscomhttpalattpercek

Forrás: pepitahirdeto.multiapro.com

Ha van egy vállalkozási ötlete, de nincs (elég) pénze a megvalósítására hívjon, írjon, segítünk. Keresünk Önnek egy olyan befektetőt, aki addig finanszírozza vállalkozását, amíg az szükséges. Szolgáltatásunk sikerdíjas! Részletek a honlapunkon: www.civishitel.hu/vallalkozoi-hite lek


Feladva: 2016-07-23    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: pénzenincsötleteegyvansegítünkHitelirodaamígírjonCívishitelvállalkozásáthívjonfinanszírozzamegvalósításáraaddigakielégbefektetőthonlapunkon

Forrás: pepitahirdeto.multiapro.com

Próbálja ki a mobil számítógép szerviz előnyeit. A javítást intézze kényelmesen, otthonából! Házhoz megyünk és megoldjuk számítógépes problémáit, legyen szó asztali számítógépről, vagy laptopról. 1 órán belüli munkavégzés esetén, csak kiszállási díjat kell fizetni! Készséggel segítünk mindenben, kérje tanácsunkat! Tel: 0620-4-117-117 www.pcjavitas.net


Feladva: 2016-04-18    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: szerviznetpcjavitas117számítógépszámítógépestanácsunkatmobilmunkavégzésmegoldjukkérjePróbáljabelülimegyünkmindenbenBudapestenóránHázhozsegítünk

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Szekrénysor LED világítással. A szettbe beletartozik két álló vitrin, egy tv állvány, és egy lebegő polc. Rendelhető több színben: www.brwbutorhaz.hu/modern-szekreny sor-3112


Feladva: 2017-09-22    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: szekrenysoregymodernwwwbeletartozikszínbenszettbetöbbvilágítássalRendelhetőLEDpolcajánlólebegőHirdetőPepita3112állványvitrinállóbrwbutorhaz

Forrás: pepitahirdeto.multiapro.com

”B” kategóriás jogosítvánnyal vezethető kisteherautók bérbeadása Budapesten és környékén rövid távra, vagy hosszú távra is tartós bérlettel, akár külföldre is. www.teherautorent.hu +3630/298-4353


Feladva: 2017-04-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: távra8221rövidbérlés3630környékénTeherautóteherautorentBudapestenwwwbérbeadásakülföldrekisteherautókakárvezethetőbérletteljogosítvánnyaltartós298

Forrás: pepitahirdeto.multiapro.com

Interaktív eszperantó tanfolyam, nulláról az eszperantó nyelvvizsgáig – hanganyaggal, gyakorlatokkal, házi feladatokkal. NEM zsákbamacska, próbáld ki az első leckét! . Budapesti Eszperantó Központ, www.eszperanto-online.hu/elso-leck e.htm


Feladva: 2017-03-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: EszperantótanfolyamwwwgyakorlatokkalKözponthanganyaggal8211BudapestinyelvvizsgáigleckétnullárólelsőpróbáldInteraktívzsákbamacskaLászlóNEMSzilvási

Forrás: pepitahirdeto.multiapro.com

Bellelli B-One Clamp gyerekülés, hátsó, csomagtartóra szerelhető Hátsó gyermekülés. Szerszám nélkül a csomagtartóra rögzíthető. Használata 7 éves korig javasolt. Maximum teherbírás 22 kg. Egy kézzel ki/be csatolható biztonsági öv. Szürke vagy kék színben. www.bicyclewebshop.com/?1260,belle lli-b-one-clamp-gyerekules-hatso-cs omagtartora-szerelhetö=2591


Feladva: 2017-09-18    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: gyerekülésclampcsomagtartóraonebellelliHátsószerelhetőwwwjavasoltszínbenkorigajánlókékévesHirdetővagyHasználataPepitaSzürkerögzíthetőKerékpár

Forrás: pepitahirdeto.multiapro.com

Olcsó, kiadó, azonnal beköltözhető albérletetet keresünk sürgősen!!! 2 felnőtt és 1 gyermek részére lenne... Kaució max. 1 hónap legyen! Lakáspályázat is érdekel! Tel.: 30/883-5695 E-mail: voti 75@citromail.


Feladva: 2017-08-18    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: OlcsókeresünkbeköltözhetőhónapazonnalmaxkiadóKaucióvoti75@citromaillenneBudapestmailrészéreAndrás5695gyermekalbérletet883felnőttTelsürgősen

Forrás: pepitahirdeto.multiapro.com

Új tervezésű 2016.évi benzinmotoros fűnyírók a GÜDE től. 1, Az alap: Fűnyíró ECO WHEELER 461 P 95322 2, A TOP: Fűnyíró BIG WHEELER 461 4in1 95333 3, A RITKASÁG: Fűnyíró BIG WHEELER Trike 515 D 95375 4, A LUXUS : Fűnyíró BIG WHEELER 565 BS Önindítós: 95363 www.fjs.hu/benzinmotoros-gepek-k54 072


Feladva: 2016-04-01    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 251WHEELERnyíróBIGbenzinmotorosGÜDEfűnyírók46195322gepekSzolgECOKerLUXUSalapfjsminőség95375tőlwwwnémet515httpakciósTrike95363évi

Forrás: pepitahirdeto.multiapro.com

Nyíregyházán két utcával határolt 4615 m2 telephely, építési telkeknek is, az Ukrán, Román, Szlovák határokhoz vezető 41-es főút 6-os km-nél eladó. A városközpont 4 km, az M3-as autópálya 1 km, a határok 50-100 km távolságra vannak. Sok célra alkalmasan, lekövezve, bekerítve, közművesítve, tetszés szerint oszthatóan. 63 méter széles. Itt megvalósíthat bármit sikeresen. Jól megközelíthető, forgalmas, látványos hely, jó kiindulópont.


Feladva: 2017-09-18    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladókiindulópontSzlovákNyíregyházamétertávolságrahelyRománJánososzthatóan100látványosUkránNemesszerinthatároktelkeknekforgalmasterülettetszés

Forrás: pepitahirdeto.multiapro.com

HA ÖNNEK VAN ELADÓ MÁRKÁS KARÓRÁJA, AKKOR ÉRDEKLŐDJÖN A 06 30 350 319-ES TELEFONSZÁMON, VAGY AZ ALÁBBI E-MAIL CÍMEN: E-mail: aranybazarkft@gmail.com Óra, karóra felvásárlás Ha szeretné eladni márkás karóráját, mi magas áron megvásároljuk boltjaink egyikében, azonnali készpénzfizetéssel. Amennyiben van lehetősége fotókat küldeni a megadott E-mail címre, kérjük tüntesse fel mennyit szeretne érte kapni. Rövid időn belül válaszolunk. Amiket vásárolunk: Patek Philippe, Jager-LeCoultre, ... további részletek >>

Vacheron Constantin, Breguet, Audemars Piguet, Breitling, Panarei, IWC Schaffhausen, Omega, Rolex, ARANY ÓRÁKAT. Amiket nem vásárolunk; Aranyozott órákat, Japán-Kinai kvarcórákat, replika órákat, divat órákat nem vásárolunk. Debrecen, Csapó utca 52 sz. alatti ékszerbolt


Feladva: 2017-02-19    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: órákatmailvásárolunkAmiketDebrecenmárkásszeretnevannemfelvásárláskaróraÓracímreELADÓkvarcórákatboltjainkBreitlingaranybazarkft@gmailékszerbolt

Forrás: pepitahirdeto.multiapro.com

Használtruha Nagykereskedésünk, az originál bálás használt ruha, valamint a minőségi válogatott használt ruha kollekciójával várja kedves vásárlóit. Nyári bálás ruha kínálatunk: vegyes ruha bála, felnőttruha bála, gyerek ruhabála, szabadidős jogging bála, Holland lakástextil és ágynemű bála, valamint Német munkásruha bála. Válogatott Angol ruházat 1.osztály, Extra és Krém minőségben a legjobb áron! Termékeink tartalma: szezonális, divatos és márkás ruha, garantált minőségben! Visszavásárlási ... további részletek >>

garancia! Hívjon minket bizalommal! Látogasson el weboldalunkra! Ingyenes házhoz szállítás a hét minden napján! Viber/Tel: 06306995904 Web: www.europanagyker.hupont.hu


Feladva: 2017-05-17    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: bálaruhahasználtruhaVálogatottbálásvalamintNagykerminőségbenAngoldivatoshttpgyerekLátogassonszezonálisminőségiWebfelnőttruhabizalommaltartalma

Forrás: pepitahirdeto.multiapro.com

Használjon kerámia, vagy indukciós Midea főzőlapot és felejtse el a hosszas és fárasztó tisztogatást! A szennyeződések könnyen eltávolíthatók, a kifolyt anyag nem tud odaégni és így főzés után a készülék letisztítása sokkal kevesebb fáradtsággal jár mint a hagyományos gáz főzőlapok esetében. www.midea.bolt.hu/midea-midea-mchf 645-főzőlap-p-61.html


Feladva: 2017-09-18    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: mideafőzőlapindukcióskerámiahtmlfőzőlapotjárnemfáradtsággalanyagmchf645vagykevesebbkifolytsokkaleltávolíthatókHasználjonboltletisztításakönnyen

Forrás: pepitahirdeto.multiapro.com

Akarod-e a lakáshiteled futamidejét megfelezni? Vagy lakásvásárlás, felújítás előtt állsz, de nem akarod magad hosszú évtizedekre elkötelezni? Sokallod a kamatköltséget, amit a lakáshiteled után kell fizetned? Bármelyik dolog is aggaszt, van megoldás! Megmutatom, hogyan tudod a futamidőt megfelezni, vagy akár harmadolni, illetve 0% kamatra kihozni a lakáshiteledet. Hogy mi a titok? Jelentkezz privát üzenetben, vagy ezen a telefonszámon: 70/417-7129, és beszéljük meg.


Feladva: 2017-10-26    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: vagyakarodmegfeleznilakáshiteledfutamidejétdologmagadezenharmadolniBármelyikhosszúakárfizetnedüzenetbenkellnemprivátfutamidőtutánállsztudod

Forrás: pepitahirdeto.multiapro.com

ANTENNA SZERVÍz 06 30 222 2912 Parabola antenna szerelés, közösségi antennák, karbantartás és átalakítás, MinDig tv DVB-T Földi digitális antenna, Upc Direct , forgatható parabola antennák szerelése, Kábel tv lakáson belüli javítása, elosztása, és a jelszint szakszerű erősítése, Elöregedett vagy tönkrement, nem használt régi tetőantennák, árbócok lebontása. Meglévő antenna házhálózatok javítása, fejlesztése.


Feladva: 2017-10-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: antennaparabolaszerelésantennákjavításaUpcnemjavításszerelésefejlesztésekarbantartástönkrementközösségivagyházhálózatokElöregedettforgatható2912

Forrás: pepitahirdeto.multiapro.com

Friss, folyamatosan megújuló állás ajánlatok! Magyarországi és külföldi munkalehetőségek pontos hely és feladat meghatározással.


Feladva: 2017-10-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: ÁllásokállásmegújulófolyamatosanmeghatározássalFrissfeladatajánláshelyHirdetőpontosPepitamunkalehetőségekkülföldönkülföldiMagyarországonMagyarországi

Forrás: pepitahirdeto.multiapro.com

A Négy Évszak Magánóvoda szeretetteljes környezetet biztosít a bölcsőde és az általános iskola kapuja közötti úton. Szeretettel várjuk gyermekét a belváros szívében, a bankok és minisztériumok negyedében. Csoportjainkba az év közben is folyamatos a 2,5 és 7 év közötti korú gyermekek felvétele, amíg a szabad férőhelyek megengedik. Óvodánk három csoporttal működik, államilag regisztrált, OM azonosítóval rendelkezik: OM 202810. Jöjjön el, ismerjen meg minket...


Feladva: 2016-09-11    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: MagánóvodaközöttiközbenmegkapujaÓvodánkBudapestCsoportjainkbaismerjeniskolamegengedikPicurkanegyedébenJöjjönáltalánosférőhelyekBelvárosban202810

Forrás: pepitahirdeto.multiapro.com

Személyi adó-vevő -8 km hatótáv környezettől és tereptől függően -304 csatorna-kombináció (8 fő és 38 alcsatorna) -További 83 DCS kód -Kivilágított kijelző -Állítható hangerő -15 választható hívásjelző hang -VOX -Elemkimerülés-jelző -Automatikus zajszűrő Roger Beep ON/OFF Microfon/fülhallgató/töltés csatlakozó Billentyűzár www.stacioshop.hu/?id=7d1819e0538f 4eddb4d675498f5da787&p=termeklap&tk od=8566


Feladva: 2017-10-15    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: vevőadókijelző7d1819e0538f4eddb4d675498f5da787környezettőlzajszűrőSMRKivilágítottstacioshophatótávAutomatikusSencorkódwwwjelzőDCSBillentyűzárVOX

Forrás: pepitahirdeto.multiapro.com

Masszázs tanfolyam svéd, talp, cellulit, olajos lazító testmasszázs alaptanfolyam (munkavállaláshoz alkalmas igazolással), arcreflexológia és kínai arcdiagnosztika, arcmasszázs (nem pénztárgép köteles vállalkozás!) és egyéb továbbképző tanfolyamok online!! Irodai menedzser masszázs: kiváló munkalehetőség cégeknél! Pénzt és időt takarítasz meg, nem kell utazni, csoportra várni. Az elméleti anyag és a gyakorlati videó is saját számítógépedre tölthető, akárhányszor visszanézhető. Számos ... további részletek >>

külföldön élő és dolgozó masszőr ajánlásával és 25 év oktatói tapasztalatával garanciát vállalok tudásodért!


Feladva: 2016-11-30    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: masszázsnemtanfolyamonlinecégeknéldolgozóvállalkozásanyagtestmasszázsPénztélőköteleselméletilazítómunkalehetőségkülföldönpénztárgépvárniolajos

Forrás: pepitahirdeto.multiapro.com

Az Alize Cotton Gold batik fonalcsaládból készült pulcsik, blúzok, ruhák, polók, szoknyák, kardigánok, stb. nagyon kellemes, könnyed viselet 55 % pamuttartalmának köszönhetően! Óriási színválasztékkal rendelkezik, ezért mindenki megtalálja a magának megfelelő egyszínű vagy színátmenetes fonalakat! Kötéshez 3,5-5 mm-es kötőtűt, horgoláshoz 2-4 mm-es horgolótűt ajánlunk. www.kezimunkakellek.hu/termekek.ph p?fcs=1&termek=6348


Feladva: 2017-04-12    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: batikGoldCottonszínválasztékkal6348polókfonalakatHirdetőÓriásifcsruhákszínátmenetesPepitaköszönhetőenphpblúzokvagykötőfonalpamuttartalmánakwww

Forrás: pepitahirdeto.multiapro.com

A DXN-nél semmi... Átáll a cég egy másik, mobil barát kinézetre. Hát abba már nem fér bele az a fajta blogolás, amit néhányan annak tartottak. Feltételezhető azonban, hogy van rengeteg normális DXN üzletépítő, akik azért még folytatnák... Nekik fenntartunk egy lehetőséget, amivel a saját DXN oldalukra tudnak látogatókat szerezni. Titok nincs, kereshetőnek kell lenni! (Persze csak annak, aki kereshető akar lenni...) ... további részletek >>


Feladva: 2017-08-16    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: DXNlenniannakblogolásegyhogyajánlófenntartunkwwwazonbanabbaTitokHirdetőNekikFeltételezhetőHátszerezniPepitahtmlfolytatnákakartartottakmég

Forrás: pepitahirdeto.multiapro.com

Professzionális, személyre szabott doboktatás, egyéni időbeosztásban! Kezdőknek, haladóknak, korosztálytól függetlenül, minden zenei stílusban! Földesi Dobiskola!


Feladva: 2016-01-26    [Zene - Hangszer]

Címkék, kulcsszavak: egyéniDobiskoladoboktatásFöldesiidőbeosztásbanszabottstílusbanszemélyrezeneiProfesszionálismindenfüggetlenülkorosztálytólhaladóknakKezdőknek

Forrás: pepitahirdeto.multiapro.com

Szeretettel várom minden lazítani vágyó vendégemet egy kellemes kikapcsolódásra Gyenesdiáson, a Balaton északi partján. Nálam hangulatos szobában, egyedi 1 órás teljes testes, meleg olajos lágy relax masszázsra van lehetőség. Amit lágy keleti zene kíséretében kényelmes matracon végzek el minden hozzám betérő személyen. Engedje meg magának ezt a lehetőséget, mert egy kis kényeztetés mindenkinek jár! Elérhető vagyok a hét minden napján reggel 8:00-22:00 0620/978/9568 Alex


Feladva: 2017-07-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: mindenlágyAlexrelaxegyGyenesdiásonElérhetőegyediEngedjevágyóAmitjárszobábanszemélyenlazítanilehetőségmindenkinekhangulatosbetérővárom9568

Forrás: pepitahirdeto.multiapro.com

Akrobatikus tűzzsonglőr és tűztánc show, színpadi pirotechnika, tűzijáték, UV & LED show, gólyalábasok, rendezvényszervezés. Acrobatic firejuggler and firedance show, stage pyrotechnics, fireworks, UV & LED show, stilts, event organizing.


Feladva: 2016-05-08    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: showtűzzsonglőrLEDfiredanceAkrobatikusandBudapestfirejugglerBeátaorganizingAcrobaticILLÉSeventrendezvényszervezéscsapatstiltsgólyalábasokprodukció

Forrás: pepitahirdeto.multiapro.com

ORVOSI FORDÍTÁS, SZAKFORDÍTÁS! Orvosi, egészségügyi, gyógyszerészeti fordítások magyarra, angolra és németre. Akár teljesen online ügyintézés! EU Fordítóközpont – Fordítóiroda (EU Translations) Orvosi fordítás, szakfordítás valamint hiteles fordítás.


Feladva: 2015-05-08    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: OrvosifordításszakfordításeuforditasFordítóirodawwwFordítóközpontphpegészségügyiTelszakforditasÚjlipótvárosügyintézéskerhitelesonlineXIIIvalamint

Forrás: pepitahirdeto.multiapro.com

Küldje el digitális fotóját kedvencéről, családtagjáról, barátjáról s mi visszaküldjük 3 dimenziós formában, üvegkockába gravírozva! • A kép legalább 3 megapixeles és a file 800 KB vagy több legyen • Ha régi fényképet szeretne beszkennelni, akkor minimum 300 dpi-ben és .jpg file-ként mentse el! www.gravirexpressz.hu/2d-fotobol-3d-uveghasab-75×9×13-cm Üzleteink: Gravír Expressz Westend 1062 Budapest, Váci út 1-3. Középső szint, főbejárat - a Niagara vízesésnél jobbra a ... további részletek >>

Starbucks kávézóval szemben! Mobil: 06-20/922-2384 Tel./Fax: 06-1/238-7125 Gravír Expressz Mammut 1024 Budapest, Lövőház u. 2-6. Mammut I. 2. emeleti mozgólépcső Mobil: 06-20/922-2356 Tel./Fax: 06-1/345-8165 Gravír Expressz Pólus 1152 Budapest, Szentmihályi út 131. Mobil: +36-20/454-9634 Tel./Fax: +36-1/410-5080 Gravír Expressz Árkád Pécs 7622 Pécs, Bajcsy-Zsilinszky u. 11. A földszinten, az Intersparral szemben Mobil: 06-20/264-1170


Feladva: 2016-09-28    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ExpresszGravírMobilBudapestFaxTelfile8226szemben922PécsMammutSzentmihályimentseajánlóLövőházfényképetÁrkádszintüvegkockábakéntHirdető1170

Forrás: pepitahirdeto.multiapro.com

Takarítás és kapcsolódó feladatok... A környéken élő, gyakorlott, sok szabadidővel rendelkező, megbízható, leinformálható, takarító hölgyet keresünk! Lakások takarításához hosszú távra, folyamatos munkalehetőséggel, változó időpontokban való (hétvégén, reggel, vagy este is) munkavégzésre és lakáskiadáshoz kapcsolódó feladatok elvégzésére. Angol/német nyelvtudás előny. Tel.: 0630 452 9013


Feladva: 2017-09-20    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: Takarításkapcsolódófolyamatos9013szabadidővellakáskiadáshoztávra452sokmunkavégzésrehosszú0630gyakorlottestetakarításáhozTelélővagylakásokelőny

Forrás: pepitahirdeto.multiapro.com

Velence-korzón Novotny Hajgyógyászat és Biofodrászat szépség szalon! Nemzetközi diplomával rendelkező hajgyógyászunk várja szeretettel. 20 éves tapasztalattal személyre szabottan analizáljuk és megoldjuk problémáját: - hajhullás - roncsolt haj Kezelés színenergiával és biológiailag aktív hatóanyagokkal. Tudományos, orvos-technikai módszerek, mikro-kamerás haj- és fejbőr vizsgálat. Vegyszermentes hajfestés, dauerolás. Kérjen időpontot!


Feladva: 2016-11-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: NovotnyhajVelenceHajgyógyászatbiológiailagévesfejbőrszínenergiávalszeretettelkorzónKezelésvárjakamerásroncsolthajgyógyászunkmikroGabriellahajhullás

Forrás: pepitahirdeto.multiapro.com

Hölgytársaim! Tudjuk, hogy a férfiak a teremtés koronái. Jól is van ez így! De azért szerencsére ma már mi nők is meg tudjuk valósítani a céljainkat, anyagilag függetlenné tudunk válni megfelelő profi eszközökkel. Hogyan tudod megvalósítani Te is a céljaidat akár több gyermek mellett is? Itt a megoldás: www.nyolcpontnyolc.hu/310012767/da ta


Feladva: 2017-08-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: tudjukmegfelelőszerencséremellettanyukáknakválniazértgyermekGyermekestudunkígytöbbfüggetlennévanakáranyagilagJólcéljaidatcéljainkatdatatudod

Forrás: pepitahirdeto.multiapro.com

Cégünk kárpitozott bútorok gyártásával foglalkozik. Nyitható, forgatható, ágyazható sarokgarnitúrák, 3-2-1 ülőgarnitúrák, kanapék, heverők, franciaágyak szivacsos, rugós kivitelben. Több száz fajta szövetből, bőrből, textilbőrből válogathat. Bútorainkat egyedi méretben is elkészítjük, vagy hozott kép alapján is megtervezzük az Ön igényeinek megfelelően!


Feladva: 2016-09-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: textilbőrbőlkanapékmegtervezzükkerbőrbőlülőgarnitúrákalapjánBudapestszövetbőlsarokgarnitúrákképKftfajtaágyazhatóhozottBútorszázforgathatóvagy

Forrás: pepitahirdeto.multiapro.com

Alan speciális mentőként dolgozik, amíg egy nap egy bányaszerencsétlenségnél elveszti a látását. Úgy érzi, kicsúszik lába alól a talaj. Már-már teljesen belesüllyed az önsajnálatba, amikor összeismerkedik egy fiatal tanárnővel, aki képes őt pocsék állapotából kirángatni. A nőnek sem könnyű, hiszen ő meg egy autóbalesetben sérült meg. Kapcsolatuk hát nem mindennapi, de újabb fordulat történik: találnak egy donort, így a férfi visszanyeri látását. Vajon kapcsolatuk az újabb fordulat ellenére ... további részletek >>

megmarad olyannak, mint a kezdetekkor? http://adamobooks.com/termek-Vakon-szeretni-87.html


Feladva: 2016-09-30    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: egykapcsolatukmárcomadamobookslátásátmegszeretnifordulatVakonújabbamígmindennapitermekállapotábóldolgoziknempocsékVajontalajmentőkénthát

Forrás: pepitahirdeto.multiapro.com

Fűtsön hagyományosan fával, szénnel vagy vegyesen. Elégetheti a papír hulladékot, reklámújságokat és a kartondobozokat is. Magyarországon az egyik legolcsóbb áron. Hagyományos fűtéshez és gázhoz kályhacső, füstcső és kiegészítők. Webáruházunkból országosan kiszállítunk!


Feladva: 2015-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: fustcsokályhacsőkiegészítőkpapírKergázhozElégethetifűtéshezvegyesengazhozHagyományosvagyaluminiumboláronszénnellegolcsóbbfávalkinalategyikfjs

Forrás: pepitahirdeto.multiapro.com

Anyaga: rozsdamentes acél, talpa 11 rétegű Tartalma: sütőkosár nyéllel, bakelit alátét, vákuum gomb Szín: piros Nyél: biztonságos, nem forrósodik Súly: 5000 gr Használható: gáz, kerámialapos, halogén, indukciós és elektromos tűzhelyen is Szószos edény mérete: 16 x 8 cm Lábas: 20 x 10 cm Lábas: 24 x 14 cm


Feladva: 2017-07-21    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: LábasSúlynyélleledényEDÉNYKÉSZLETforrósodiksütőkosárSzószosRÉSZESnemTartalmatűzhelyenbiztonságosrétegűelektromosNyéltalpaindukcióspirosacél

Forrás: pepitahirdeto.multiapro.com

Személyre szabott gyógynövény teák tanácsadással. Minőségi szálas teák, gyógynövényes teakeverékek, tearendelés a termelőtől! Rigó teák Vegyszermentes kistermelés, gyűjtés, gondos válogatás. Íz-illat-harmónia.


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teákgyógynövényszálasMinőségiVegyszermentesszabottSzemélyreRigóteakeverékektanulóillatgyógynövényesIstvánválogatásgondosgyűjtéstanácsadássalEger

Forrás: pepitahirdeto.multiapro.com

VÁRPALOTÁN 24.690 m2-es teleken 1.243 m2 összes beépítettségű raktárcsarnok, telephely eladó. A bruttó 1.400 m2-es raktárcsarnok épületen belül van 213 m2 iroda. 8 szintbeli ipari kapu biztosítja az árumozgatást. A területen gépjármű parkolás lehetséges. Parkolóhelyek száma 40 db. Kiemelt befektetési érvek: - Kiváló lokáció, közel a 8-as főúthoz - Tehergépkocsival megközelíthető - További fejlesztési lehetőségek a telek méretéből adódóan Ár: 100,- millió Ft+Áfa


Feladva: 2017-01-07    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: raktárcsarnokVÁRPALOTÁNeladógépjárműmillióépületenközelterületen100lokációVárpalotaárumozgatástadódóan400KiválóFerencbiztosítjaméretébőlbruttó

Forrás: pepitahirdeto.multiapro.com

Magyarország legnagyobb óriáscsúszdás oldala! Szabadtéri és fedett élményfürdők, ahova rossz idő esetén is érdemes menni...


Feladva: 2016-11-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: óriáscsúszdásStrandokoldalalegnagyobbMagyarországMagyarországonFürdők

Forrás: pepitahirdeto.multiapro.com

Bízza profikra a munkát! Hivatalos okiratok, szerződések cégpapírok hitelesített fordítása. Jogi fordítás · Keresztnyelves fordítás · Szakfordítás · Fordítás Kérjen árajánlatot!


Feladva: 2017-07-13    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: Fordítás183szerződésekárajánlatotokiratokKérjenHivatalosmunkátprofikraSzakfordításBízzaKeresztnyelvesajánlóJogiHirdetőfordításaPepitahitelesített

Forrás: pepitahirdeto.multiapro.com

Az alacsony vérnyomás tünetei leginkább közérzetünket rontják. Aki gyakran fáradt és nem talál erre magyarázatot, sokszor szenved fejfájástól, hányingertől és gyengének érzi magát, érdemes megmérnie a vérnyomását. Ha az értékek a kelleténél alacsonyabbak, több módon is tehetünk azért, hogy a vérnyomást egészséges szintre állítsuk be. Alacsony vérnyomás és magas pulzus ellen a legjobb, ha mozogni kezdünk. Ilyenkor a vérnyomás megemelkedik, a pulzusszám pedig csökkenni fog. Ha rendszeresen fennáll ... további részletek >>

ez a helyzet, mindenképpen kivizsgálás javasolt, mivel emögött pajzsmirigy túlműködés, vashiányos vérszegénység is meghúzódhat.


Feladva: 2016-11-07    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vérnyomásAlacsonykezdünknemhogyhelyzetmagátmozognifáradtmeghúzódhatazértfennállérzilegjobbgyakranvérszegénységtehetünkrendszeresengyengénekAki

Forrás: pepitahirdeto.multiapro.com

Minden típusú zárszerkezet, nyitását vállalom, kulcselvesztés, vagy a zár-betét elromlása esetén. Nem fúrunk, törünk, rongálunk, NYITUNK. Hatósági ajtónyitás. Kinyitott ajtókon azonnali zárcsere kívánság szerint. Szakszerű munkavégzés, reális árakon. Szolgáltatásom: ajtónyitás, zárnyitás, hevederzár nyitás, páncélajtó nyitás, ajtómentés, betörés utáni helyreállítás. Biztonságtechnikában és ajtónyitásban komoly tapasztalat. Speciális amerikai és német szerszámok segítik a munkámat.


Feladva: 2015-10-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: ajtónyitászárnyitásajtómentésnyitászárcsereSpeciáliselromlásahevederzárPéterazonnalitapasztalatbetétKnappajtókonkomolyzárzárszerelésKinyitottvagy

Forrás: pepitahirdeto.multiapro.com

Eladom bélyeggyűjteményemet egyben vagy darabonként. Érdeklődni lehet: Bodor Csaba: 06-20/556 9841 bodormotor@gmail.com


Feladva: 2017-05-27    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: CsabaBodorÉrdeklődnidarabonkéntvagyegybencombélyeggyűjteményemetbodormotor@gmailEladom9841Tahitótfalu556eladóBélyeglehet

Forrás: pepitahirdeto.multiapro.com

AZOKNAK AKIK NEM AKARNAK ELŐRE BEFEKTETNI!!!! Csatlakozz hozzánk. Teendőd ingyenesen beregisztrálni és saját linkeden ingyenes tagokat gyűjteni. Miből lesz a pénzed?? Ha ügyesen dolgozol, gyűjtöd az ingyenes tagjaid, valaki a felső vonalból be fogja aktiválni az irodád, magyarul elindítja a te üzleti vállalkozásod. Ahogy érkezik irodádba a jutalékod, eldöntheted, fejleszted tovább, vagy megelégszel azzal a plusz jövedelemmel amit így fogsz elérni. A felső vonal nem csak téged fog ... további részletek >>

aktiválni, hanem azokat az ingyenes tagjaid is, akik szintén gyűjtik saját tagjaikat. Itt nem kell kattintgatni, videót nézni!! Semmi más dolgod nincs, mint ingyenes tagokat csatlakoztass. A regisztrációhoz szükséges adatokat emailben küldjed meg nekem! Teljes név, az üzletben használni kívánt felhasználó név, email cím, jelszó, Facebookos elérhetőséged.


Feladva: 2017-09-29    [Pénzkeresés - MLM]

Címkék, kulcsszavak: ingyenesnemaktiválnitagokatüzletinévsajátFelsőakiktagjaidkattintgatniérkezikKálváriaFacebookoshanemdolgozolRegisztráciohózjövedelemmelCsatlakozz

Forrás: pepitahirdeto.multiapro.com

A torokgyulladás a torok égő, kaparó érzésével, nyelési nehézséggel jelentkezik. Ezt gyakran kíséri köhögési inger, hőemelkedés, de kisgyermekeknél akár láz is kialakulhat mellette. A torokgyulladás többnyire vírusos eredetű, a kórokozó kimutatása gyorsteszttel és tenyésztéssel is történhet. A mandulagyulladás és a torokgyulladás kezelése heveny esetekben megkívánja az antibiotikumok szedését. Ez a terápia teljes gyógyulást hoz, de mellette érdemes olyan étrendet is folytatni, ami kíméli a torok ... további részletek >>

nyálkahártyáját. Torokgyulladás és mandulagyulladás kezelése weboldalunkon!


Feladva: 2017-02-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: TorokgyulladásmandulagyulladásmellettetorokkezelésekaparótenyésztésselhőemelkedéshozégőgyorsteszttelingergyógyulástKittikimutatásanyálkahártyájátami

Forrás: pepitahirdeto.multiapro.com

Sziasztok vonósok! BEIRATKOZÁS MOST!!! Egyéni módszeremmel, könnyedén, jó hangulatú hegedű órákkal várom a tanulni vágyókat Budapesten!!! Nálam nincs botkezű, botfülű ember, csak hegedülni szerető és tanulni vágyó emberkék vannak, akik szeretnek nálam tanulni és örömmel vesznek részt az órákon!!! Nincs korhatár, lehetsz 5, vagy 60 éves, egy a fő! Akarj és szeress hegedülni tanulni, mert az csodálatos! MINDEN HEGEDÜLNI VÁGYÓT SZERETETTEL VÁROK!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: tanulniHEGEDÜLNINincsnálamBudapestvagyvannakórákkalVÁGYÓTOroszlánlehetszemberkékhegedűÁRONkorhatárvágyóhangulatúMINDENAKCIÓSszeretőkönnyedén

Forrás: pepitahirdeto.multiapro.com

Szeged, Baktói, a városhoz közel fekvő részen található 1981 évben épült, 189 m2-es, 2 szintes, 2 generáció számára alkalmas, külön bejáratú, hőszigetelt sarokház tulajdonosoktól eladó. Földszint: 89 m2 (előtér, mosóhelyiség, WC, étkező, konyha, kamra, nappali, hálószoba, külön tusoló, fürdőszoba káddal). A 100 m2 alapterületű emeleti szint, a földszinti nappaliból nyíló teraszról közelíthető meg. Emelet: előtérként funkcionáló üvegezett erkély, nappali, 2 fél szoba, konyha, kamra, 2 ... további részletek >>

gardrób. A hőszigetelt padlástérben található egy 35 m2-es szoba. A tető 1 éve lett ellátva minőségi cseréppel. A kémény bélelt, zártrendszerű, a fűtés alapvetően központi gázkazánnal megoldott, valamint a földszint a radiátorok mellett kandallóval és elektromos padlófűtéssel és mind a két lakás hűtő-fűtő klímával is rendelkezik. A házhoz tartozik még egy 27 m2-es garázs, két műhely, egy fedett kocsi beálló, egy pince, egy kemence és egy fúrt kút is. Irányár: 39 900 000 Ft Érdeklődni a 06/30-270-77-52-es telefonszámon, vagy emailben: icag@freemail.hu


Feladva: 2017-09-05    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egySzegednappalieladókétszobatalálhatóméghőszigeteltalkalmasvároshozszámáraBaktóikülönkamragenerációföldszintkonyhafűtőfél189270megoldott

Forrás: pepitahirdeto.multiapro.com

Sok menyasszony nem tudja, hogy egy parfümvásárlás sokkal összetettebb annál, minthogy a drogéria polcáról leemeljük a pénztárcánkhoz illő, külsőre a leglátványosabbnak bizonyuló kis üvegcsét. Egy illatnak lelke, ereje, és története van. Minden esszencia megkomponálása során szakértő parfümőrök együttes erővel dolgoznak azon, hogy minőséget, harmóniát és szépséget zárjanak egy-egy fiolába. Ilyen illatmágusok készítik a világ luxusmárkáinak, a nagy divatcégeknek illatait, és (bármilyen lelombozó) ... további részletek >>

a sztárok nevével fémjelzett parfümöket is... Itt többet is olvashatsz: www.eskuvoclassic.hu/menyasszony-parfum-kisokos-talald-meg-illat-ami-az-oltarhoz-kiser


Feladva: 2017-10-03    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: egyhogyillatmenyasszonyzárjanakösszetettebbeskuvoclassicsoránillataitbizonyulószépségetsokkalwwwmegkomponálásadivatcégeknekleglátványosabbnakkiser

Forrás: pepitahirdeto.multiapro.com

A GÁL-60® típusú kopasztógéppel óránként hatvan csirkét lehet megtisztítani. A gép egyéb baromfiakhoz (liba, kacsa, gyöngytyúk, fácán stb.) is használható. Kétféle méretben készül. Pulykák pucolásához célszerű a pulykapucoló változatot megrendelni. Egy perc alatt egyszerre egy csirkét lehet megpucolni, melyet közben fogni kell. A tokokat és az erős tollakat is kiszedi, ezért kézi utópucolásra nincs szükség. A géphez számos kiegészítő berendezés tartozik (pl.: kábító, vágó, forrázó, ... további részletek >>

bontó, csöpögtető, stb.), melyek alkalmazásával biztosítható az optimális kiszolgálás, csökkenthető a pucolási idő, növelhető a feldolgozott darabszám. (Kérjen árajánlatot a kiegészítőkről!) www.csibekopaszto.hu/magyar/index.html


Feladva: 2017-07-24    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 174stbGÁLlehetgépcsirkétegyhatvanwwwtollakategyszerreoptimálisKétféleberendezésóránkéntkiegészítőkrőlerősalattbiztosíthatóhasználhatótokokat

Forrás: pepitahirdeto.multiapro.com

Bádogosbolt! A következő termékeket lehet kapni: Csatorna és hozzátartózó termékek. Alumínium, színesalu, horganyzott, horgany, vörösréz egyedi termékek. Kéményszegély, szegélylemezek, csúcsdíszek, hófogók, szerszámok, szegecsek. Nyitva: H-P. 7:30-17 h-ig, Szomb. 8-13 h-ig (Páros héten)


Feladva: 2016-10-16    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: termékekPomáz2013SzinesaluKftszerszámokAluminiumkerhofogokhozzátartózóTomcsúcsdiszekCsatornaNovaszegélylemezekkapniu23KéményszegélylehetOrgona

Forrás: pepitahirdeto.multiapro.com

Sárosd centrumában eladó egy 72 m2-es családi ház garázzsal, melléképületekkel, hozzá tartozó rendezett, két utcára nyíló 1200 m2-es jó fekvésű, körbe kerített telekkel (telek megosztható). Közművek: víz, villany, telefonvonal bevezetve,, gáz, csatorna telekhatáron ráköthető.


Feladva: 2017-11-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: SárosdvillanyutcáracentrumábanvízkétKözművekrendezettZsuzsannamegoszthatótartozóPálkovácstelekhozzáutcaráköthetőtelekkelmelléképületekkelJókai

Forrás: pepitahirdeto.multiapro.com

Magyarország első találka alapú (pay per date) és fokozottan biztonságos társkereső szolgáltatása! Csak akkor kell fizetni, ha összejön a randi, de lehet akár teljesen ingyen is! Nálunk nincsenek kamu profilok! Nincsenek zaklató levelek! Ne ülj otthon a képernyő előtt! Próbálj ki valami újat! www.beengedlek.hu


Feladva: 2016-11-06    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: levelekzaklatóNincsenekbeengedlekprofilokkamuotthonlehetdateüljrandiperösszejönpayfizetnialapúkelltalálkaakkorújatelsőCsakvalamiNálunk

Forrás: pepitahirdeto.multiapro.com

10 éve működő tánc tanfolyam várja új kis tanítványait! 4-14 éveseknek. Helyszínek: XVI. kerület (Erzsébetligeti Színház, és Mltc Sportklub. XIV. kerületi Németh I. Ált.Isk. Korosztály szerint több csoportban: balett alapok, táncelőkészítő gimnasztika, videoklip táncok,divattáncok, színpadi show táncok, musicalek ... Fellépések, nyári napközis tánctábor. 5200 Ft/hó.


Feladva: 2017-02-17    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: kistánctáncokXVIvideoklipNémeth5200tanítványaitgimnasztikakerületitánctábortáncelőkészítőXIVnapközisvárjaalapokSportklubnyáritanfolyambalett

Forrás: pepitahirdeto.multiapro.com

Bruce Willis egyike a legsikeresebb és legkedveltebb világhírességeknek. Számtalan arcát ismerjük, egyszerre változékony és hiteles. A világsztár az LR-rel közösen fejlesztette ki első saját illatát, amely kifejezi személyiségét, és összeköti karakterét egy illattal. Már kapható a második Bruce Willis-illat: a Bruce Willis Personal Edition.


Feladva: 2016-03-26    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: WillisBruceillatmásodikkaphatóelsővilághírességeknekMárfejlesztettelegkedveltebbillattalközösenlegsikeresebbegyrelegyikekarakterétvilágsztárPécs

Forrás: pepitahirdeto.multiapro.com

Egy olyan rendkívüli fizetési mód kezdett elterjedni Magyarországról kiindulva a világon, amely a következő években, évtizedekben, teljesen átalakítja a fizetési szokásokat! Már elindult, legyen Ön is az elsők között. Minden embernek gyökeresen megváltoztathatja az életét, de az első pár millió embernek soha nem látott vagyont is jelenthet. Az eddig ismert összes fizetési mód együttesen nem tud annyi előnyt biztosítani, mint a cégünk által az egész világon levédett, egyedüli és rendkívül ... további részletek >>

egyszerű fizetési rendszerünk. Képzeljen el egy olyan fizetési módot, ahol Önnek szó szerint semmilyen fizetőeszközre nincs szüksége. Érdekesnek találja? Képzeljen el egy fizetési módot, melynek köszönhetően nemzetközi szinten is sok millió ember mindennapos vásárlása után, minden egyes másodpercben jövedelme keletkezik. Garantálom, hogy nem kell befektetnie, vagy befizetnie felesleges csomagokra, nem kell semmit sem eladnia MLM rendszerben, nincsenek kötelezettségei, és garantáltan több pénze lehet, kevesebb nem! Kizárólag a mindennapi megszokott vásárlásokból! Kérje e-mailen mindenre kiterjedő információs levelem. Email: rozsabusiness@gmail.com


Feladva: 2017-04-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemfizetésiegyKépzeljenolyanmillióembernekmódkellvilágonmindenmódotvagyontErrőlnincsenekbefektetnielegyenemberbiztosítaniMagyarországrólhogy

Forrás: pepitahirdeto.multiapro.com

Munkatársakat keresek vásárlói közösségbe, azonnali kezdéssel interneten vagy katalógusból ajánlással történő munkára! Nincs kötelező havi vásárlási kényszer. Fő és mellékállásban is végezhető, rugalmas időbeosztásban! Csak egy számítógép vagy okostelefon kell hozzá! A bevételed a befektetett munkával arányosan növekszik! Sokan el sem tudják képzelni, hogy átlag fizetésnél többet vigyenek haza, pedig ez lehetséges csak jó helyen kell dolgozni. Ha valós internetes munkát keresel és ... további részletek >>

tényleg szeretnél dolgozni, keress bátran! Írj a üzenetet, vagy regisztrálj a megadott oldalon.


Feladva: 2017-09-14    [Pénzkeresés - MLM]

Címkék, kulcsszavak: vagykellcsakdolgozniregisztráljmunkávalkényszerkereselazonnalitöbbetbefektetettvásárlásimunkátközösségbefizetésnélcímrebevételedhaviinternetes

Forrás: pepitahirdeto.multiapro.com

Olcsó, gyors személyszállítást végzünk Ausztriába, Németországba


Feladva: 2017-03-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: NémetországbavégzünkszemélyszállítástgyorsOlcsóBudapestEutaxiKisbusszalAusztriába

Forrás: pepitahirdeto.multiapro.com

Ha igen, akkor a lehető legjobb helyen jársz! Az UtazzFillerekért.hu segít benne, hogy a lehető legolcsóbban és legmegbízhatóbb módon foglalhasd le álmaid nyaralását, belföldi utazását, párnapos városlátogatását vagy esetleg a számodra legkedvezőbb repülőjegyet. Egyszerűen fogalmazva: levadásszuk Neked a legjobb ajánlatokat! Kell ennél több? Csapatunk tapasztalt, profi utazókból áll, akik az elmúlt évtizedben bejárták a világ összes kontinensét és rengeteg tapasztalatot halmoztak fel, ... további részletek >>

megismerkedtek a legnépszerűbb helyekkel és minden fontos infót gondosan feljegyeztek az adott desztinációról. Küldetésünk és célunk nem más, mint hogy a naponta frissülő utazási ajánlatok közül a legjobbakat és a legkedvezőbbeket kiválogatni utazni vágyó közönségünk számára. A wellness hotel, last minute utak és olcsó repülőjegy ajánlatok szövevényes világában ez nem olyan egyszerű feladat, mint aminek hangzik. Az UtazzFillerekért.hu oldalon nem csak a legolcsóbb repülőjegy kínálat, utazási opciók, szállás ajánlatok, vagy akár ingyenes nyaralás lehetőségek érhetők el, de könnyen inspirációt meríthetsz következő utazásodhoz, pihenésedhez is. Exkluzív választékkal jelentkezünk továbbá mind a belföldi nyaralás, mind pedig a külföldi utazás ajánlatok terén. Oldalunkon egyszerűen hozzáférhetsz autóbérlés keresőnkhöz, választhatsz magadnak útikönyvet és köthetsz utasbiztosítást – egyszóval mindent megtalálsz, ami a tökéletes utazás előkészítéséhez szükséges lehet! Belföldi és külföldi utazás ajánlatok egy helyen Ahhoz, hogy naprakész lehess és azonnal kihasználhasd a legkedvezőbb, legizgalmasabb utazási ajánlatokat és belföldi pihenés lehetőségeket, egyszerűen iratkozz fel hírlevelünkre e-mail címed megadásával oldalunk bal felső részén és lájkold Facebook oldalunkat! Amennyiben ajánlataink között nem találsz megfelelőt, szívesen segítünk megtalálni a számodra legjobb repülőjegy és szállás opciót. Írj nekünk bátran!


Feladva: 2016-10-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: ajánlatoklegjobbbelföldinemutazásUtazzFillerekértegyszerűenhogyajánlatokatutazásirepülőjegyvagymintszálláshelyenszámodralehetőlegkedvezőbbmind

Forrás: pepitahirdeto.multiapro.com

Szeretne gyorsan weblapot? Kínálatunkban előzetesen megtekinthető, kattintható kész weblapok közül válogathat. Jelenleg 50 különböző kész weblap közül tud választani. De van itt még valami ... Bevezető akciónk keretében most reklám és látogató növelő szolgáltatást is biztosítunk minden olyan weblap megrendelőnknek, aki lakosságnak szolgáltat, vagy értékesít és a rendelésével eléri a 20.000 Ft-ot akár egy összegben, akár a második negyedéves díj befizetése után.


Feladva: 2017-10-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: mégakárweboldalaweblapnincsÖnnekközülkészakiSzeretnekeretébenkülönbözőmegrendelőnknekakciónkösszegbenJelenlegBevezetőegyválogathatolyanvalami

Forrás: pepitahirdeto.multiapro.com

A Penda 1997. februárjában a Betéti Társaság-ból Kft.-vé alakult, mely a mai napig is 100%-ban magyar tulajdonban van. A vállalat immár 20 éve a termelőeszköz forgalmazók és felhasználók igényeinek kielégítésére törekszik. Húzó termékeink: rendsodrók, szárzúzók, ekék, traktorok, rendkezelők, kaszák, bálázók, pótkocsik, permetező gépek, vetőgépek. Négy telephelyen, Békéscsabán, Kecskeméten, Kiskunmajsán és Nagykőrösön szerződéses partnereink raktározzák és adják ki áruinkat.


Feladva: 2017-08-31    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: PendaKftekékszárzúzókrendsodrókáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetétitörekszik

Forrás: pepitahirdeto.multiapro.com

Típus: Kompakt Érzékelő: 20 Mp CMOS LCD: 3.2”, 1.620.000 pont, Fix, érintőképernyő Videó: 1920×1080 (60p kép/mp) Áramforrás: Li akku + töltő (Alaptartozék) Memória: SD-XC, SD-HC, SD Optikai zoom: 25× (24 - 600 mm) optikai stab. Magyar menü, CMOS érzékelő, LCD touch, Wifi Megtekinthető: www.digifenykep.hu/canon/kompakt-p owershot-sorozat


Feladva: 2017-05-22    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: LCDérzékelőezustCMOSg9xpowershotcanonoptikaiPepitaMegtekinthetőzoomérintőképernyőWifiMemóriaFixtouchAlaptartozékponttöltő000akku6208221

Forrás: pepitahirdeto.multiapro.com

4 izgalmas minta a gyerekszobába, kicsiknek és nagyoknak! Az új Star Wars & Velux Galactic Night Collection tetőtéri ablakokra szerelhető fényzáró rolóit Jedi lovagoknak és a galaktikus kalandoroknak terveztük, mindenki megtalálja köztük a kedvencét. A Star Wars & Velux Galactic Night Collection a tetőtéri ablakok üvegfelületét egy űrbéli kaland hátterévé varázsolja, így a kis hősök éjjel-nappal kedvenceikkel lehetnek. A Star Wars & Velux Galactic Night Collection segít abban, hogy a ... további részletek >>

gyerekszoba kis Jedi lovagja gyorsan álomba szenderüljön és utazását messzi-messzi galaxisokban folytassa. Kérjen árajánlatot online: www.farmtuzep.hu/star-wars-velux-galactic-night-collection


Feladva: 2017-09-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: veluxwarsstarnightgalacticcollectionmesszifényzárótetőtériJedikishogymintakalandgalaxisokbankalandoroknakabbanizgalmasűrbéligalaktikussegít

Forrás: pepitahirdeto.multiapro.com

Igényesen dolgozó asztalos vállal konyhabútor készítést Budapesten és Pest megyében. Fő profilom konyhabútor, konyhaszekrény, gardrób és beépített szekrény készítése és beépítése egyedi elképzelései alapján. Modern konyhabútor olcsón, elemes konyhaszekrény akció. Ezen kívül még vállalok más asztalos munkákat is, kérem, hívjon bizalommal: Fogas Zoltán 06 70 636 8214.


Feladva: 2016-05-28    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: konyhabútorasztalosBudapestenZoltánFogaskonyhaszekrényprofilommunkákatmegyébenModernPestmásalapjánvállalokelképzelései8214készítéstmégegyedi636

Forrás: pepitahirdeto.multiapro.com

MI AZ AGYKONTROLL? A Stanford-i egyetem kutatói szerint elménk adta képességeinknek csupán mintegy 2%-át használjuk ki. A Silva-féle agykontroll egy tudományosan megalapozott, egyszerű, praktikus, könnyen elsajátítható önfejlesztő módszer, ami lehetővé teszi, hogy ennél lényegesen nagyobb mértékben használjuk ki istenadta lehetőségeinket, s így sikeresebben oldjunk meg mindenfajta problémát. Egyik fontos eszköze a relaxáció avagy lazítás, ami egyúttal a bizonyítottan megbetegítő hatású ... további részletek >>

stresszt is levezeti. Az agykontroll nem vallás. Ateista ember ugyanúgy megtanulhatja elméje hatékonyabb használatát, mint az istenhívő, ahogy világnézetétől függetlenül mindenki megtanulhat például úszni is. Az agykontroll nem mágia, hanem elménk sokak által ma még kevéssé ismert, s emiatt kevéssé kiaknázott képességeinek okos – tehát nem kishitű és nem is fanatikus – használata, ami kiegészíti a cél elérése érdekében tett cselekedeteinket! Jelszavunk: egyensúly. MIRE JÓ AZ AGYKONTROLL? – A stressz levezetésére, – alvászavar megszüntetésére, – ébresztőóra nélküli, időzített ébredésre, – élénkítőszer nélküli felfrissülésre (például autóvezetéskor), – a fejfások 90%-ának és a migrénnek gyógyszer nélküli elmulasztására, – a minket foglalkoztató kérdések – bölcsebb tudatalattink és az „összemberi tudás”* bevonásával történő – megválaszolására, – a memória fejlesztésére, – gyorsabb és hatékonyabb tanulásra, – a jó döntéshozatal megkönnyítésére, – céljaink elérésére (magunk és szeretteink gyógyulását is beleértve), – a fájdalom és a vérzés gyors uralására, – szokásaink (pl. dohányzás, alkoholizálás, túlzott evés, lustaság, rendetlenség) akaraterő és kínlódás nélküli megváltoztatására, – gyerekeink és felnőtt szeretteink szavak nélküli megsegítésére, – a misztikusnak hitt, ám valójában természetes és hasznos intuíció avagy megérzőképesség rendkívüli fokozására. Tudományosan is bizonyított tény, hogy az emberi elmék között láthatatlan szálakkal kapcsolat van. Az egyes emberek tudása így bizonyos értelemben „összemberi tudássá” válik. Többnyire ez magyarázza, hogy felfedezők, feltalálók sokszor egyszerre álltak és állnak elő azonos ötletekkel. Nem véletlenül mondja hát a módszerről a világhírű amerikai orvos, dr. Clancy D. McKenzie: „Ha valaki megtapasztalja az eredményeket, amiket ezen a tudatszinten el lehet érni, akkor a későbbiekben már meg se kísérel ennek használata nélkül fontos döntéseket hozni vagy problémákat megoldani.”


Feladva: 2016-10-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 8211AGYKONTROLLnemnélküli8222amiméghogy8221kevésséhasználjukhatékonyabbfontoshasználatapéldáulMIREtudományosanszeretteinkelménkígyavagyának

Forrás: pepitahirdeto.multiapro.com

Béreljen riasztó rendszert és 3 év után az öné! Vagy válasszon akciós csomagjaink közül! Telepítéseinket az egész ország területén végezzük!


Feladva: 2016-10-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: riasztóSzolnokközülFerenccsomagjainkSzekeresakciósbefektetésselválasszonkisVagyrendszerönéutánrendszert5322126Béreljenriasztotgyorsan

Forrás: pepitahirdeto.multiapro.com

Kovacsics Öcsi könyve: Omega-Universal zenekartól az együttesig. 50 év zenetörténelem, ahogy megélte 4 zenekarban. Megvásárolható az alábbi boltokban: 3490 Ft, az alapár. Libri, Rockdiszkont, Bookline, Lira, Ujkönyvek.hu, Könyvtenger, mai könyv.hu, Rockmúzeum, Könyv szállító, Könyvesboltom, numero7 könyvesbolt, Könyvtündér, Emag, eKönyv. www.kovacsics.hu/konyv.html


Feladva: 2017-07-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: kovacsicskonyvÖcsiBudapestKönyvtengerzenekarbanhttpAndrásUjkönyvekmegélteeKönyvOmegárólLiraahogyEmagkezdetiBooklinezenetörténelemKönyvtündérmai

Forrás: pepitahirdeto.multiapro.com

Munkatársakat keresek ingatlan ajánlói, és értékesítési területre. Ha még nem dolgoztál ilyen munkakörbe mi betanítunk, ha már dolgoztál az előnyt jelent.Ha foglalkoztál esetleg hitelezéssel vagy LTP-vel akkor is írj a számodra is van munka. Jelentkezni lehet a munka.ingatlan.srl@gmail.co m email címen. Kérlek, írj telefonszámot is hogy fel tudjam venni veled a kapcsolatot.


Feladva: 2017-08-29    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: ingatlanmunkakeresekdolgoztálírjMunkatársakatvelmunkakörbeemailLTPkapcsolatotilyencomvagyvelednemsrl@gmailhitelezésselvennimégesetlegtudjam

Forrás: pepitahirdeto.multiapro.com

Kedves Régi és Új Vendégeim! Következő szolgáltatásokkal várlak Benneteket: * Műköröm építés, manikűr * Géllakk kézen, lábon * Alkalmi make up * Fülbelövés, orrbelövés, köldök-piercing behelyezés Bővebb infó a honlapomon. Várlak szeretettel!


Feladva: 2017-06-28    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: makeupmukoromGéllakksminkVárlakkézenorrbelovesNailscsoportomhozfulbelovesSzigretcsépenCsatlakozzmanikűrkezapolasbehelyezésépítéspiercingBenneteket

Forrás: pepitahirdeto.multiapro.com

A Kingtel egy eddig még sohasem látott távlatot kíván megismertetni önökkel a Mobiltelefonok rohamosan fejlődő világában. Főbb szolgáltatásaink: Mobiltelefon Táblagép Telefonok a Boltunkban Gyári Tartozékok Kiegészítők iPhone Szerviz Android Szerviz Kijelző Felújítás Minden használt Mobiltelefont és Táblagépet készpénzért azonnal megvásárolunk vagy beszámolunk a legmagasabb piaci áron!


Feladva: 2017-09-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: MobiltelefonTáblagépKingtelSzervizszolgáltatásainkMindenlátottáronTelefonokhasználttávlatotBoltunkbanMobiltelefontkívánGyáriTáblagépetmegismertetni

Forrás: pepitahirdeto.multiapro.com

Hajsütővas, gőzállomás, waffelsütő, gofrisütő, melegszendvicssütő, porszívó, páraelszívó, fagyasztó, hűtő, szárítógép, mosógép, hősugárzó, olajradiátor, olajsütő, kenyérpirító. A tökéletes nászajándékok, karácsonyi ajándékok széles választéka! Személyes átvétel Budapesten. Link: www.stacioshop.hu Facebook: www.facebook.com/stacioshop Tel: 36704551969 E-mail: in fo@stacioshop.hu


Feladva: 2017-05-16    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: stacioshopfacebookwwwátvételhősugárzóinfo@stacioshopHajsütővasSzemélyesmosógépmailajánlóválasztékaszárítógép36704551969HirdetőszéleshűtőTelPepita

Forrás: pepitahirdeto.multiapro.com

A fényképész legjobb barátja az állvány. Az állvány a fényképezőgép, az objektív és a fény után a legfontosabb hozzávalója a fotónak. Hidd el, neked is...


Feladva: 2017-09-29    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: állványHiddfényképészfotónakajánláshozzávalójaHirdetőlegfontosabbPepitautánbemutatókfényTesztekobjektívhírekfényképezőgépFotósMLZphotobarátja

Forrás: pepitahirdeto.multiapro.com

A sárga barack mag B17 vitaminban, azaz amigdalinban gazdag. Sokak számára ellenmondásos ez az összetevő, mivel toxikus anyagot is tartalmaz. Ez igaz, ám ennek a toxikus anyagnak a kötése olyan típusú, ami ártalmatlanná teszi azt az emberi szervezetre nézve. A sárga barack mag kifejezetten egészséges étrendkiegészítő, mely természetes formában tartalmaz számos értékes összetevőt. Ilyenek a vitaminok, antioxidánsok, ásványi anyagok, rostok és egészséges zsírsavak. Ezek pozitívan hatnak az ... további részletek >>

immunrendszerre, a keringésre, az emésztésre és a közérzetet is javítják. Miért tartsunk sárgabarackmag kúrát évente többször? Tudjon meg még többet itt: www.sarga.barackmag.com/sargabarackmag


Feladva: 2017-09-18    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: baracksárgakúráttoxikustartalmazegészségesBarackmagmégmagimmunrendszerreolyanIlyenekSokaktöbbszörhatnakkötéseösszetevőtgazdagéventepozitívan

Forrás: pepitahirdeto.multiapro.com

Zenerajongó vagy? A SoundCloud, a hang YouTube-ja. Adj hangot magadnak! Akár zenész vagy, akár amatőr rajongó, tudunk Neked segíteni. Válassz SoundCloud csomagjaink közül, akár zenehallgatást, akár követői csomagot, mind a kettőt olcsó árakon megteheted. www.likebolt.com/?product=1000-sou ndcloud-lejatszas


Feladva: 2016-07-09    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: akárSoundCloudhangvagyYouTubesegítenikettőtNekedZenerajongómindtudunkIldikocsomagotrajongókövetőiamatőrcomzenehallgatástzenészlikeboltközül

Forrás: pepitahirdeto.multiapro.com

A Fordított Ozmózis víztisztító berendezés a mosogató alá szerelhető, kis helyigényű. Közvetlen a hideg víz csapjához csatlakoztatjuk a többlépcsős szűrőberendezést. A beszerelése különös szakmai tudást nem igényel, a használati utasításokon leírtak alapján egyszerűen elvégezhető. A víztisztító berendezés csak a szabvány ivóvíz, a vízművek által kibocsájtott víz tisztítására alkalmas. A nem a vízhálózaton keresztül folyó szennyezett származású víz tisztítása nem végezhető el!


Feladva: 2015-06-25    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: víztisztítónemvízszakmaifolyókisberendezésszűrőrendszerkülönöskeresztülszerelhetőbeszerelésevízhálózatonaláelvégezhetőkszűrőberendezéstalkalmasBéla

Forrás: pepitahirdeto.multiapro.com

Tavasszal és nyáron szeretnénk a kertet is élettelivé varázsolni, melyhez jól jön néhány virágos növény! A gyönyörű kékeslilás színben tündöklő törpe levendula sokak kedvence, hiszen kis méretével és illatos virágzatával a kis kertekben is mutatós! A 15-20 cm-re növő példányt nemcsak szabadföldbe, hanem akár cserépbe teraszra vagy erkélyre is ültethetjük, ezzel a panellakás is szebb lesz! Megrendelhető az Üdekert Cserje Webáruházban! www.udekert.hu/product_info.php/pr oducts_id/11914


Feladva: 2016-04-28    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: levendulatörpevagykisCserjeÜdekerthanemWebáruházhiszenlesznéhányszabadföldbekertbenkedvenceszebbjönnemcsakkintsokakpanellakásjólpéldányt

Forrás: pepitahirdeto.multiapro.com

Horvát Tengerpart Zadar! Kiadó Tengerparti Apartmanok! Kedvezményes apartman kínálatok! Már most foglalja le Álmai apartmanját Nyári Tengerparti nyaralásához! Akciók már 39 Euro/4 fő/apartman/nap! Felejtse el a Booking.com-ot! Nálunk minősegi garancia van és olcsóbbak vagyunk min. 30%-al mint a Booking. Személyesen adunk át minden apartmant a vendégeinknek és bármikor ott a magyar kolléga Zadarban, ha segítség, vagy információ kell. Alkudni lehet! Ne felejtse el, spórolhat ... további részletek >>

idejekorán megkötött előfoglalásával és a legjobb tengerparti apartmanjaink közül választhat! Közvetlen információs profilunk ajánlatokkal: www.facebook.com/zadarkiadoapartmanokraczattila Ha szeretné hogy a barátai is lássák a hirdetést, ossza meg az idővonalán is. Kiadó Tengerparti Apartmanok Már 10 Euró/fő-től! Nyaralást, vagy örök tengeri hajóvezetői jogosítványt szeretnének? Akár Egy nap alatt? Esetleg Tengerparti Ingatlant Vásárolnának Magyar zadari ügyintézéssel? Keressen! Ha tetszik a Horvát Tengerpart, Hirekért, kedvezményes Szállás ajánlatokért, ingatlanvásárlásért-tanácsadásért jelöljön ismerősnek bennünket, vagy a honlapon az információs profilunk linkje: www.facebook.com/zadarkiadoapartmanokraczattila Honlapunk: www.horvatapartman.eu Ha szeretné hogy a barátai is lássák a hirdetést, lájkolja és ossza meg az idővonalán is!


Feladva: 2016-10-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: TengerparticomvagywwwApartmanokKiadófelejtseosszaMagyarfacebookhirdetéstlássákprofilunkkedvezményesbarátaiZadarbookinghogyTengerpartszeretné

Forrás: pepitahirdeto.multiapro.com

A Centrál Autószerviz márkától függetlenül vállalja gépjárműve karbantartását, javítását. Törekszünk arra, hogy ügyfeleinkkel közvetlen kapcsolatot alakítsunk ki és elnyerjük bizalmukat minőségi, gyors munkánkkal. Nagy figyelmet fordítunk ügyfeleink által észlelt hibák kielemzésére. Autószerelő műhely - Sopron.


Feladva: 2016-08-10    [Autó - Motor - Jármű]

Címkék, kulcsszavak: AutószervizCentrálSopronTörekszünkműhelygyorsjavításátAutószerelőminőségikarbantartásátkielemzésérebizalmukatgépjárművehibákelnyerjükvállaljaészlelt

Forrás: pepitahirdeto.multiapro.com

Döbbenetes sportkocsit és elektromos kamiont mutatott be a Tesla! Elon Musk péntek hajnalban áll a nagyközönség elé, és nem egy, hanem rögtön két vadonatúj Tesla járművet mutatott be az egybegyűlteknek, és persze az egész világnak. A sajtótájékoztató egyik legfontosabb része, hogy a személygépkocsik után a Tesla belép a fuvarozás területére is... Keresőnkben ez a cikk is megtalálható: www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60546


Feladva: 2017-11-17    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: TeslamutatottHirdetőegybegyűlteknekcomállutánPepitamultiaprohajnalbanszemélygépkocsikkeresikjárművetpepitahirdetopéntekhogySokanvadonatújwwwkét

Forrás: pepitahirdeto.multiapro.com

Akuna Alveo gyógynövények kombinációja, mely több évtizedes kutatómunka eredményeként született meg. Összetett hatásaival bárki egészségi állapotán képes javítani, hiszen kizárólag értékes hatóanyagok találhatók benne. A méregtelenítő Alveo ital fokozza a kiválasztószervek működését, így segíti a szervezet megtisztulását. Hatására a bevitt tápanyagok jobban felszívódnak és intenzívebben érvényesíthetik előnyeiket. Mivel a benne lévő növényi összetevők fokozatosan és kíméletesen hatnak, ... további részletek >>

fogyasztása nem okoz kellemetlen mellékhatásokat a méregtelenítés során. Méregtelenítés Akuna Alveo itallal - rendelés webshopunkban! www.gyogynovenyek.megoldascsomagok.com/akuna-alveo-szolos-950ml


Feladva: 2017-02-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: AlveoAkunaitalméregtelenítőMéregtelenítésbennewebshopunkbanműködésétképesfogyasztásatöbbintenzívebbenrendeléskiválasztószervekállapotánhatnakmely

Forrás: pepitahirdeto.multiapro.com

Tudtad, hogy 2016-tól a Gördeszka Olimpiai sportág? Végre :) Most meg tudod mutatni, ki vagy. Tanulj a Legmagasabb szintű módszerrel. Kerüld az ”utcán haveroktól v. önállóan megtanulom” elvet. Hacsak nem akarod, hogy 30 éves korodra széthulljanak az ízületeid, ínszalagjaid, csontjaid. A sikered 100%-ig attól függ: - ki az oktatód - milyen a technikai-módszer Őrizd meg az egészséged. Legyél Pro deszkás. Tanulj a Legjobb módszerrel. Juss ki akár a 2020-as Olimpiára. ... további részletek >>

Teljesen kezdő vagy? Rémület fog el, ha az esésekre gondolsz? 1) 90 perc alatt 2) Teljesen a Nulláról 3) Alap szinten 4) Stabilan 5) Baleset nélkül, esés-mentesen megtanítunk gördeszkázni.


Feladva: 2017-07-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: 8221meg2020TeljesenakárJussGördeszkamódszerrelhogyTanuljvagyLegyéltudodsikeredPepitaszintenkezdőelvetegészségedMostcsontjaidOlimpiaAlap

Forrás: pepitahirdeto.multiapro.com

PC játékok óriási választéka a Konzolvilágban, pénztárcabarát árak és speciális kiadások. Kiemelkedő kiszolgálás, gyors és megbízható futárszolgálat.


Feladva: 2017-09-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: játékokpénztárcabarátKonzolvilágbanválasztékafutárszolgálatóriásimegbízhatógyorsajánlókiszolgálásHirdetőKiemelkedőPepitakiadásokKonzolvilágspeciális

Forrás: pepitahirdeto.multiapro.com

Prezídium az igényes, és biztonságos hevederzár. Minden ajtóra felszerelhető, Rotó, Abus, vagy Mauer betéttel szereljük, árusítjuk. Egyedi méretben is kapható. A cilinderbetétet speciális felfogatása miatt törés és maghúzás ellen is védett. A zár a rudazatot mind a két irányban 110mm hosszon kitolja. Gordiusz pajzzsal dupla védelem /www.gordiuszpajzs.hu/.


Feladva: 2015-10-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: hevederzárGordiuszbiztonságospajzzsalellenszereljükigényesmaghúzásbetéttelPrezídiumkitoljatörésMauerhosszonBudapestmiattvagy110mmPéterAbuskét

Forrás: pepitahirdeto.multiapro.com

Szeretne könnyedén bevételre szert tenni Facebook oldala, vagy weboldala segítségével? ITT A MEGOLDÁS!!! Legyen üzleti partnerünk! Ne hagyja ki! www.multiapro.com/online-penzkeres et.php?ref=PA211


Feladva: 2016-09-30    [Pénzkeresés - MLM]

Címkék, kulcsszavak: partnerünküzletiLegyenkönnyedénFacebookpénztnagyjatenniKeressenszertbevételrePA211refMEGOLDÁSSzeretnephpITTOrszágosanpenzkeresetsegítségével

Forrás: pepitahirdeto.multiapro.com

Hó végére Neked is mindig elfogy a pénzed? Én is így voltam ezzel, de egy különleges, sokaknak bevált módszer nekem is segített. Azelőtt nem bíztam az ilyenekben, de ennek utána jártam és mindent rendben találtam. Ha érdekel, hogy hogyan tudnál otthonról plusz pénzt keresni, anélkül, hogy bármit is el kellene adnod: akkor írj nekem üzenetet. Miután megkaptam az üzenetet tőled küldöm a tájékoztatót a munkáról. Erre az e-mail címre hiresemberek@gmail.com


Feladva: 2017-09-22    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyüzenetetnekemErreAzelőttadnodelfogyérdekelmunkárólsegítettkellenemindigtaláltamtájékoztatótmódszerbármitNekedrendbenküldömbeváltvégére

Forrás: pepitahirdeto.multiapro.com

Dolgozzon Amerikában! Házvezetőnői, szállodai munkák (szobák takarítására, párok jelentkezését is várjuk). Nyári tábori munkák. Jelentkezés e -mailben, vagy telefonon itt: www.amerikabandolgozni.hu Telefon:70 401 0882 Víberen is


Feladva: 2017-02-03    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: AmerikábandolgoznimunkákVíberen0882táboriBudapest401NyáriTelefonvárjukamerikabandolgoznijelentkezéséthttppárokitttakarításáratelefononszobák

Forrás: pepitahirdeto.multiapro.com

Eladó gondola és végzáró. Gondola: 32.000.-/fm (nettó) oldalanként 4 sor polccal Végzáró: 23.000.-/fm (nettó) 4 sor polccal Könnyen szerelhető, tisztítható. További információ: www.polcozzunk.eu


Feladva: 2016-10-10    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: VégzáróGondola000polcozzunkpolccalsornettówwwoldalankéntinformációTovábbiEladótisztíthatóSzigetszentmiklósszerelhetőpolcrendszerKönnyenfém

Forrás: pepitahirdeto.multiapro.com

Festmény a léleknek, a lélek festőjétől. A festmény címe: Átjáró (Tisza-Kalmár György) Méret: 50x50 cm Anyag: olaj rétegelt falemezen A gyönyörű meleg barna színek kavalkádja és az arany lemez tompa csillogása átjárót nyit egy másik világba. Megnyitva az elmét a szellem szabad szárnyalását segíti elő. A fénykép nem tudja visszaadni azt a finom felületi gazdaságot, az árnyalatok sokszínűségét, ahogy egymást fedik a lazúr színek. A festmény érdekessége a kézzel festett fakeret, amely ... további részletek >>

önmagában is egy művészi alkotás, tovább emelve a festmény értékét. www.tisza-kalmar.hu/index.php/galeria/26-absztrakt-festmenyek/27-gallery-3 A festményt személyesen át lehet venni Egyházashetyén (Vas megye, Sárvár közelében), vagy futárszolgálat kézbesíti a megadott címre.


Feladva: 2016-09-14    [Régiség - Művészet]

Címkék, kulcsszavak: KalmárfestményeolajfestőKortársfestőjétőllélekléleknekFestményEgyházashetyeGyörgy

Forrás: pepitahirdeto.multiapro.com

Ha egy teljesen legálisan működő, most induló osztrák céggel szívesen dolgoznál együtt - ahol az összes tulajdonost más üzletekből régebb óta személyesen ismerünk -, akkor nincs mire várnod, itt a hét minden egyes napja pénzgyártásról szól!


Feladva: 2017-09-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: együttRomanoczkiakkordolgoználszólFerencismerünkszívesenpénzgyártásrólPénzgyártásszemélyesencéggelnapjaótaosztrákegyesrégebbindulómindenmost

Forrás: pepitahirdeto.multiapro.com

FÜSTÖLT KOLBÁSZ AKCIÓ! Házi lángolt kolbász ár: 1kg 990 Ft Csongrádi kolbász ár: 1kg 1190 Ft Békési házi szalámi ár: 1kg 3190 Ft Hartai paprikás szalámi ár: 1kg 2590 Ft Rákóczi szalámi akciós ár: 1kg 3590 Ft Hartai házi kolbász ár: 1kg 2790 Ft Békési házi kolbász ár: 1kg 2490 Ft Pick eredeti téliszalámi ár: 1kg 4390 Ft Pick paprikás szalámi ár: 1db 990 Ft


Feladva: 2016-09-28    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: 1kgkolbászháziszalámi990BékésiFÜSTÖLTpaprikásHartaiPickakciós1190Csongrádilángolt1dbAKCIÓ2790ker3590Budapest4390MintaboltRákócziHús

Forrás: pepitahirdeto.multiapro.com

Ruhajavító üzletbe képzett varrónőt keresünk, felsőruházat és általános varrási munkák elvégzésére. Érdeklődni a 06 30 222 2912 vagy a 06 30 222 2912 -es telefonon lehet Munkaidő: Kedd - Péntek -ig Web: www.altalanosruhaszerviz.freewb.hu


Feladva: 2017-10-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkvarrónőt2912222üzletbeRuhajavítótelefononképzettfreewbvagyaltalanosruhaszervizÉrdeklődniLaszlohttpelvégzéséreBerkesWebmunkáksürgősen

Forrás: pepitahirdeto.multiapro.com

Dormán László mosógépszerelõ vállalja Whirpool, Ignis, Polar, Energomat, Minimat, Midimat, Energolux, LG, Zanussi, NDK-s WA tipusú, stb. automata mosógépek javítását. MOSÓGÉPSZERVIZ KISPESTEN a kerületben lakóknak, mosógépszerelés munkanapokon, akár 4 órán belül is lehetséges. Mosógépszerelés: Erzsébet, Kõbánya, Pestlõrinc, Pestimre, Csepel, Soroksár, Ferencváros, Józsefváros, Kispest és a XVII. ker.-ben. www.mosogepszereles-javitas.hu


Feladva: 2016-03-14    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 245MosógépszerelésDormánkerLászlówwwZanussirinclakóknakhttpEnergoluxXIXkerületbenbenMidimatPestlBudapestKISPESTENMinimatbányaMOSÓGÉPJAVÍTÁS

Forrás: pepitahirdeto.multiapro.com

Cégünk, a SkandiVisual egy építészeti és látványtervezési kreatív stúdió. 3D Illusztrációinkkal mindig az egyediségre, és különlegességre törekszünk, mert hiszünk abban, hogy egy jó ötlet megérdemli a megfelelő előadásmódot. Különböző módokon segíthetjük a projektek marketingjét: fotórealisztikus építészeti látványtervek, belsőépítészeti látványtervek, körpanoráma készítés, fotómontázs, 3D illusztráció alaprajzokhoz, 3D modellezés 2D rajzok alapján, családi ház léptékű építészeti tervezés és ... további részletek >>

tanácsadás. Keressen fel minket, és mi megelevenítjük az elképzeléseit! www.skandivisual.hu


Feladva: 2016-11-30    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: építészetiskandivisualtanácsadástervezéslátványtervekegyKülönbözőkülönlegességrefotómontázselőadásmódotegyediségrekészítésmegfelelőmindigkörpanorámaház

Forrás: pepitahirdeto.multiapro.com

Bioptron lámpa kölcsönzés, bérlés. Tel.: 06 70 4298212. A Bioptron fényterápia egy olyan lenyűgöző és innovatív technológia, amely költséghatékony megoldást kínál számos orvosi eset kezelésére és otthona kényelmében használható. Polarizált fénye fokozza a szövetek anyagcseréjét és a behatoló fény által stimulált sejtek újból elég oxigént, szállítanak. Gyógyító hatása bizonyított a kozmetika területén, sportsérülések, bőrbetegségek, fekélyek, sebek kezelése esetén. A modern gyógyítás számos ... további részletek >>

területén alkalmazható. 4 típusban bérelhető. Tájékoztatom a Bioptron lámpa kezeléséről, használatáról, a gyógyítás mikéntjéről. Budapesten és 120 km-es körzetében díjmentes házhoz szállítás, ettől távolabb is nagyon kedvező. Kérem, telefonon rendelje meg a készüléket. Bővebben: www.zepter.hu/MainMenu/Products/Medical/Bioptron/ProductRange.aspx


Feladva: 2017-05-20    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BioptronlámpakölcsönzésterületénszámosgyógyításbérléskezelésérőlfényekezeléseamelyettőlelégBudapestPolarizáltsebektechnológiaszállításújbólmeg

Forrás: pepitahirdeto.multiapro.com

Havi egy főzéssel a hónap minden napján meleg ételt varázsolni az asztalra, anélkül, hogy hosszú órákat töltenél minden nap a konyhában? Igen, lehetséges! Válaszokat, segítséget az oldalon találsz!


Feladva: 2017-01-20    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: HaviegyfőzésmindenoldalonhogysegítségetanélkülVálaszokatasztalralehetségesvarázsolniIgenételtkonyhábanmelegnapnapjánhónaptöltenélfőzéssel

Forrás: pepitahirdeto.multiapro.com

Hordozható cserépkályha 160.000 Ft-tól 320.000 Ft-ig. Akciós és egyedi kézzel készült csempéből! Hagyományosan járatokkal ellátva, hőtárolós kivitelben. Rendkívül gazdaságosak! A fűtési módok közül a leghatékonyabb. Kiváló ár-érték arány jellemzi a saját magunk készített cserépkályhákat. Minden darab egyedi! Építünk, cserépkályhákat, kandalló típusú cserépkályhákat, tartályos cserépkályha-kandallókat. Web: www.cserepkalyhak-mobilcserepkalyhak.hu Email: pollakferi@icloud.com Tel.: ... további részletek >>

06-20-397-91-02


Feladva: 2016-12-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: cserépkályhacserépkályhákat000HordozhatóegyediAkcióskandallókatmagunkRendkívül320sajátkivitelbentartályostóljellemzi397hőtárolós140arányTel

Forrás: pepitahirdeto.multiapro.com

A vesekő diéta segítségével megelőzhető a kövek kialakulása. Egy kis odafigyeléssel könnyen kivitelezhető, hogy kevesebb sót fogyasszunk, együnk több zöldséget, gyümölcsöt, csökkentsük a kávéfogyasztást. Ha már kialakult, a vesekő eltávolítása lehetséges akár otthoni módszerekkel is. Ehhez használhatunk vízhajtó teákat vagy speciálisan összeállított teakeveréket. A népi orvoslásnak az egyik leghatékonyabb gyógynövénye a vesekő tünetei ellen a nyírfalevél, melynek teája megakadályozza a kő ... további részletek >>

kialakulását, de a meglévő követ is képes elmorzsolni. Gyors és biztonságos beavatkozás az endoszkópos kőeltávolítás, mely után a beteg gyorsan felépül.


Feladva: 2017-03-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vesekőeltávolításakövetgyümölcsötleghatékonyabbkisbetegEhhezmeglévőzöldségetegyikEgyutánmódszerekkelkialakulásáttöbborvoslásnakkialakulásamely

Forrás: pepitahirdeto.multiapro.com

Eladó a képen látható ETZ250. 1987es évjáratú 61000 km. Korának megfelelő állapotú. Új gumikkal felújított váltóval. Elöl sport sárvédő, adom hozzá az eredetit is. Műszaki 2018.09 hó-ig.


Feladva: 2017-08-20    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 09hógumikkalTompa2018állapotúJácintMűszakimegfelelőSzűcseredetitKorának250hozzá61000kmETZadomévjáratúsárvédő1987essportETZ250Elöllátható

Forrás: pepitahirdeto.multiapro.com

Megújult műsorral, új felállásban vállalunk fellépéseket: - falunapokon - céges rendezvényeken, bálokon. Hívjanak bizalommal. Élőzenés előadás, nem playback! Elérhetőségek és ízelítő a műsorokból a honlapon hallgatható formában. CD rendelést felveszünk Ének: Lehoczky Judit - retró - örökzöldek (angol, német, olasz nyelven) - magyar nóta - csárdások - cigány dalok - mulatós - operett német nyelven - német slágerek (német nyelven)


Feladva: 2017-04-04    [Zene - Hangszer]

Címkék, kulcsszavak: németnyelvenhonlaponJuditLehoczkyÉneklehoczkyjuditBennünketolaszkezdjükhttpBizalommalangolfelállásbanhallgathatóhívjanakörökzöldekműsorralbálokon

Forrás: pepitahirdeto.multiapro.com

Megrendelésre gyártunk automata drótfonógépet! Profi kivitelben, nem barkács gép! PLC vezérlés, könnyű kezelhetőség! Garantált a gazdaságos termelés! Gépünk cégét versenyképesé teszi! Érdeklődni: 0670 770 3460 Ár: 4.350.000,- Ft + ÁFA


Feladva: 2016-12-13    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: automataGépünkkivitelbenáfatermelésProfi000gazdaságosdrótfonógépet350Garantált3460kezelhetőséggyártunk770könnyűMegrendelésre0670vezérlésPLC

Forrás: pepitahirdeto.multiapro.com

Vákuumformázó kisipari műanyag feldolgozó üzem kompletten eladó. 600x600 mm-es vákuumgép, 2 db vízhűtéses vákuumszivattyú, kompresszor, szabászgép szerszámokkal együtt 3 000 000 Ft. Ajándékba adok hozzá egy 500 W-os nagyfrekvenciás PVC hegesztőgépet az árnyékoló ketrecével, tartalék üzembiztos OT-400-as csövekkel együtt. Alapanyag beszerzésében is tanáccsal segítek. Az ár a vevő telephelyén a beüzemelés segítését, a próbaüzemet, és a kezelő beatanitását is tartalmazza!


Feladva: 2015-09-08    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: üzem000eladókisipariVákuumformázósegítekKálmánegykezelőkompresszortanáccsalKóczyhozzápróbaüzemetvákuumszivattyúbeszerzésébenadoksegitéséttartalék

Forrás: pepitahirdeto.multiapro.com

Ha túl nagy a lakása, ha inkább a gyermekével foglalkozna, vagy egyszerûen csak nem tudja hogyan fogjon hozzá, de tiszta lakást, átlátható ablakot szeretne, hívjon bizalommal! Kirakatok, ablakok, tükrök, üvegfalak, üvegportálok tisztítása. Üzletek, irodák, csarnokok, lakások, magánházak takarítása. Gyors, tiszta munkavégzés, korrekt árak. Megelégedettségi garancia! Huszka Antal 70/6163797 www.ablaktisztitas.5mp.eu


Feladva: 2017-06-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: AntalHuszkagaranciaMegelégedettségitisztatükrökablaktisztitashogyanGyorsnagyablakokwwwtudjatakarításatúlKirakatok6163797nemmagánházakBudapest

Forrás: pepitahirdeto.multiapro.com

Original Hobbit Hole Egyedi játszóházak a gyártótól! 200 x 270 cm alapterületű platform. Belmagassága 150 cm, nyitható ajtóval és ablakkal. Natúr kivitelben: 190.000 Ft Zsindely fedés: 40.000 Ft Csúszda indító platform, feljárattal: 30.000 Ft 3 m-es csúszda: 25.000 Ft A szállítás, szerelés, rögzítés, festés plusz költség!


Feladva: 2016-12-20    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: 000platformHobbitcsúszdaalapterületűköltségajánlófedés270pluszHirdetőZsindely200festésPepita190gyártótólrögzítésjátékkivitelbenjátszóházak

Forrás: pepitahirdeto.multiapro.com

Válogasson a Galaxy Játékáruház távirányítós játékai közül! A gyerekek életkorának megfelelő játékok különböző árkategóriákban. www.galaxyjatekaruhaz.hu/59-tavira nyitos-jarmuvek


Feladva: 2017-07-01    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: carrerahelikopterhelicoptermicrotávirányítóstaviranyitosgalaxyjatekaruhazméregzsákcsöppségetcsomagbólwwwindítsdjátszaniajánlottigazitávirányítóbahtml

Forrás: pepitahirdeto.multiapro.com

A rosacea megszüntetése még a leghatékonyabb kezelési módszer mellett is hónapokig eltarthat. A terápiának részét képezi a táplálkozási szokások megváltoztatása is, mivel vizsgálatok szerint a rosaceás bőr megszüntetése hatékonyabb, ha az emésztés megfelelően működik. Ehhez ajánlott frissen préselt zöldségleveket, sok rostot és teljes kiőrlésű gabonát fogyasztani, kerülni a fűszeres ételeket, koffeines, alkoholos italokat. Akár étrendkiegészítőkkel is pótolhatjuk a szükséges mennyiségű ... további részletek >>

B-vitamint, valamint az emésztést könnyítő probiotikumokat. A rosacea krém és diéta együttes alkalmazása gyorsabb és tartósabb eredményt hoz.


Feladva: 2016-09-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: rosaceamegszüntetésediétakrémrészétAkárrostotterápiánakitalokatsokprobiotikumokatbőreltarthatalkoholoszöldségleveketkönnyítőrosaceáshónapokighoz

Forrás: pepitahirdeto.multiapro.com

Klasszikus, fa, olasz étkezőasztal, kicsinyíthető, nagyítható eladó, méretek átmérő: 120 cm. bővített állapotban: 160X120 cm. magasság: 80 cm. Szétszerelhető! Pécs, szállítás megoldható. Irányár: 120.000 Ft. Önnek mennyit érne? Az új ára: 280.000 Ft volt.


Feladva: 2017-03-27    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 120állapotban000bővítettátmérőméretekeladónagyíthatókicsinyíthetőPécsétkezőasztalolaszKlasszikus160X120voltMikolics280áramegoldhatószállítás

Forrás: pepitahirdeto.multiapro.com

CNC állásuk van Németországban! Szerződött német partnerünk (NEM Zeitfirma) részére Mannheim közelében keresünk CNC-st aki CNC Abkanter (élhajlítógép) gépen szakrajzról tud nagyon precízen dolgozni. A feladat a CNC élhajlítógép (Trumpf) beállítása és kezelése. A munkához legalább A2-B1 némettudás szükséges. Hosszú távú munkalehetőség! (A család pár hónap utáni kiköltözését a munkáltató segíti és támogatja.) Próbamunka ideje alatt a szállás ingyen van. Sikeres próbamunka után szerződés a ... további részletek >>

céggel, szállás megoldott, kb. 300€/hó. Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1.) E-mailben: info@nemetmunka.hu 2.) Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3.) Telefonon munkaidőben a magyar 06 1 920 3433, ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9.00-17.00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-10-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: CNCnémetvagyszállásTeamMunkamailbenpróbamunkanemetmunkavanwwwélhajlítógépTelefononmegoldottdolgozni000támogatjarészéreújbólikövetkezőPersonal

Forrás: pepitahirdeto.multiapro.com

Minőségi Ablakcsere akció ELŐLEG NÉLKÜL is! Műanyag nyílászárók 6-7 és 8 légkamrás kivitelben kiváló gyári minőségű alapanyagból, garanciával! Ezen túlmenően kínálunk még szintén gyári minőségben redőnyt, rovarhálót és reluxát is bontással-beszereléssel és az esetleges javítási munkálatokkal együtt.


Feladva: 2016-09-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: gyárinyílászárókNÉLKÜLELŐLEGminőségűBudaörsredőnytkiválóZoltánminőségbenkivitelbenMártonlégkamrásegyüttáronszinténmunkálatokkalkedvezőmégEzen

Forrás: pepitahirdeto.multiapro.com

100%-os hidegen sajtolt mákolaj eladó a préselőtől: - 1 liter 4.900 Ft. - 0,5 liter 2.500 Ft. - 0,2 liter 1.250 Ft. Bővebb információ honlapunkon...


Feladva: 2016-12-25    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: litereladómákolaj100BővebbPéter250Balogh500900préselőtőlsajtolthonlapunkonhidegeninformáció

Forrás: pepitahirdeto.multiapro.com

Bútorrestaurálás, asztalos és kárpitos munkák, galéria, egyedi bútorok és kópiák készítése. Bútorfényezés politúrral és lakkokkal, viaszokkal. Antik bútorok restaurálása, bútorjavítás és bútor készítés hagyományos és új módszerekkel. Bútorfényezés sellakpolitúrral, különböző viaszokkal és lakkokkal, intarzia, fafaragás készítés és javítás. Kárpitos bútorok restaurálása szerkezeti javítással, rugózat újra építésével, afrik és vattatöméssel, újabb garnitúrák, ágyak, heverők székek áthúzása.


Feladva: 2016-02-03    [Régiség - Művészet]

Címkék, kulcsszavak: bútorokKárpitosBútorfényezésasztaloskészítéslakkokkalviaszokkalrestaurálásaágyakmunkákmódszerekkelgarnitúrákhagyományosújabbBútorrestaurálásjavítás

Forrás: pepitahirdeto.multiapro.com

Olyan vendéglátóipari szakképesítést szeretnél, amivel könnyedén nyithatsz egy Street Food éttermet? Mindig is imádtad a gasztronómiai különlegességeket? Szívesen készítenél diétás, gluténmentes vagy laktózmentes ételeket? Jelentkezz Budapesten induló Szakács OKJ-s tanfolyamunkra! A tanfolyamra való jelentkezéshez csak alapfokú iskolai végzettség szükséges, így szakmai előképzettség nélkül jelentkezhetsz. 9 hónap, kitartó tanulás, sikeres vizsgák és már a kezedben is van az OKJ-s bizonyítvány. ... további részletek >>

Ha szeretnél kiemelkedő gasztronómiai tudást szerezni, akkor a Szakács szakma Neked való. Nincs más dolgod, csak kattints a honlapunkra és jelentkezz a tanfolyamra: www.tanfolyamokj.hu/szakacs-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: okjbudapestenSzakácsjelentkezzcsakgasztronómiaitanfolyamszeretnélvalótanfolyamokjtanfolyamravégzettségakkorkészítenélsikeresamivelhonlapunkratudást

Forrás: pepitahirdeto.multiapro.com

Alig használt sodastream gép eladó


Feladva: 2017-11-10    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: gépeladósodastreamhasználtAligZamárdiPéterBuzásEndrédi

Forrás: pepitahirdeto.multiapro.com

Eladó Suzuki Baleno, Swift I, Swift II (2005-töl), Ignis, Wagon R+, Splash felújított váltók. 3 hónap garancia! Cseredarab szükséges. Szállítás az ország egész területén. Ár: 40.000 Ft + szállítási díj - Budapest területén: 3.000 Ft - Pest megye: 4.000 Ft - a többi megye: 6.000 Ft Beszerelést vállalunk: 15.000 Ft


Feladva: 2015-10-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: SuzukiváltókfelújítottmegyeSwiftterületén15000ftdíjvállalunkszállításiSplashbeszerelést40000ftWagon6000ftegészIgnisországtöltöbbiszállítás

Forrás: pepitahirdeto.multiapro.com

Bútorok kárpitozását vállaljuk! Kiemelkedő minőségben, rövid határidővel. Az egész ország területén! Elérhetőség: www.karpitos.org 06 70 771 3888


Feladva: 2016-07-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: orgvállaljukkarpitoskárpitozásátwwwBútorokElérhetőségAlbertirsaterületénKftországSzervízegészKárpithatáridővelkárpitozásrövidBútor3888771

Forrás: pepitahirdeto.multiapro.com

2000-es évjáratú Twingo eladó. Műszaki érvényessége: 2019. 06.19. Elektromos ablak, tükör beállítás, légzsák, szervókormány HIBÁI: sajnos a jobboldali ablak elektromossága hibás, nehéz felhúzni, a fényszórók rossz bekötés miatt nem megfelelően működnek. Mivel már nem fiatal, természetesen van rajta mit csinálni, igény szerint... Ára: 170.000,- Ft Alkuképes!


Feladva: 2017-10-05    [Autó - Motor - Jármű]

Címkék, kulcsszavak: ablakeladóTwingonemMivelszerintMűszakiműködnekjobboldaliigénymegfelelőensajnoscsinálnimiattHIBÁImitévjáratúbekötésszervókormányrajta2000van

Forrás: pepitahirdeto.multiapro.com

Számlaképes cégünk vállalja lakások, házak, irodák, komplett költöztetését, lomtalanítását, épületen belüli átrendezését. Igény szerint csomagolunk vagy csomagolóanyagot kiszállítunk, rakodási, szerelési feladatokat is végzünk. Minőségi, gyors munka több éves tapasztalattal, referenciával, hétvégén is hétköznapi árakon! Akár lakáscsere lebonyolítását is vállaljuk. T: +36 (70)23 53 403, +36 (1) 787 0230


Feladva: 2017-05-22    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: csomagolunkvállaljuklakásokmunkaszerintlebonyolításátvállaljagyorsIgénylakáscserecégünkMinőségiátrendezésétAkárSzámlaképesvégzünkbelüliárakon0230

Forrás: pepitahirdeto.multiapro.com

Közösségi napelempark tulajdon részeinek MLM-ben való értékesítésére üzletkötőket keresek. Egyedi. Hosszútávú. 25 évig fizet! Euró alapú jutalékos kifizetés! Internetes munka kifejlesztve.


Feladva: 2017-07-01    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kereseküzletkötőketEurórészeinekfizettulajdonévignapelemparkHosszútávúKözösségiEgyediBudapestkifejlesztveajánlómunkaHirdetőInternetesértékesítésére

Forrás: pepitahirdeto.multiapro.com

Jégkása készítés, jégkásagép bérlés, rendelhető rendezvényre. Amikor szükség van a Gulliver élménypark egy jó választás velünk népszerűsítse rendezvényét, családi napra, céges rendezvényre lehető legjobb minőségi szolgáltatást nyújtunk.


Feladva: 2016-10-05    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: bérlésjégkásagéprendezvényrekészítésJégkásalegjobbélményparklehetőGullivervancégesszükségnapraAmikorcsaládirendelhetőrendezvényétnépszerűsítseegy

Forrás: pepitahirdeto.multiapro.com

A szálláshely szobái légkondicionáltak (csak a tetőtéri szobák) , TV-vel, hűtővel felszereltek. Minden szobához zuhanyfülkés fürdőszoba tartozik. Lehetőség van számítógépes csatlakozásra, internet használatra. Vendégeink még teljesebb kikapcsolódását medencével és hozzá kapcsolódó szaunával szolgáljuk.


Feladva: 2017-03-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: medencéveltartoziklégkondicionáltakkikapcsolódásátfürdőszobaszobáiteljesebbzuhanyfülkésszálláshelymégszobáhozSzékesfehérvárVendégeinkMindenIgnácPap

Forrás: pepitahirdeto.multiapro.com

Keresünk ausztriai munkavégzésre zsaluépítőket! Jelentkezési feltételek: német nyelvű fényképes önéletrajz, végzettséget igazoló dokumentáció, munkatapasztalat, német nyelvtudás Telefonos érdeklődés: H-P 9-16.00


Feladva: 2015-11-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németausztriaifényképesKezeknyelvűSzorgos0669305842feltételekzsaluépítőknekElérhetőségeinkJelentkezésimunkanyelvtudászsaluépítőketmunkavégzésreKeresünk

Forrás: pepitahirdeto.multiapro.com

Szálláshelyek és szállásfoglalás Erdélyben. Foglalja le már most erdélyi szálláshelyét, nyaralásához. Erdelybe.hu és szallas-erdely.hu oldalainkon válogatott erdélyi szálláshelyeket találhat. Szálláshelyeinknen már többezer elégedett vendégünk megfordult. Az erdélyi szálláshelyek közül csak a legjobbakat válogattuk ki Önnek, hogy egyszerű legyen a választás.


Feladva: 2017-02-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekerdélyimárErdélybentöbbezerszálláshelyétÖnnekmostválogattukSzálláshelyeinknenFoglaljalegjobbakattalálhatcsakszálláshelyeketszállásfoglalás

Forrás: pepitahirdeto.multiapro.com

Pályázatírás másképpen Biztosan sok helyen olvashatja, hogy ingyenes pályázatírás, ingyenes tanácsadás stb. …. de elege van, hogy a végén MINDIG MINDENT ÖNNEK KELL KITALÁLNIA???? Ráadásul a számla kiállítása után a lehető leghamarabb el is feledkeznek Önről? Ha szeretné, hogy…. - 15 perc „ingyenes tanácsadás” helyett tényleg EGYÜTT GONDOLKOZZANAK ÖNNEL - egyetlen gépbeszerzés helyett KOMPLETTEN, egyben vizsgálnák cégének valódi szükségeit - valóban ... további részletek >>

TEHERMENTESÍTSÉK az összes pályázatírással kapcsolatos papírmunkától - VÉGIGKÍSÉRJÉK az egész pályázati folyamatot az előlegtől a záró-ellenőrzésig - KAPCSOLATI TŐKÉT is kapjon pályázatához, ne csak egy számlát a pályázat megnyerésekor Akkor kérjen időpontot a +36 30 928 3621 telefonszámon (vagy montaltechkft@gmail.com e-mail-en) Zakor Beátától és várjuk Önt budaörsi irodánkban.


Feladva: 2016-09-29    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ingyeneshogytanácsadáshelyettpályázatírás8230zárószeretnéZakorvalóbanÖNNEKmegnyerésekorGONDOLKOZZANAKBiztosanelőlegtőlÖnrőlmailszükségeitMINDENT

Forrás: pepitahirdeto.multiapro.com

Saeco, Jura, Solis használt automata kávégépek forgalmazása, javítása. Minden kávéfőzőre 6 hónap garancia. Országos házhoz szállítás. Ár: 35.000 HUF.-tól. Házhoz szállítás 2.000 HUF. www.caffeshop.hu/index.php/caffesh op


Feladva: 2015-04-27    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: HUFautomataJuraSaecocaffeshopMindenNagywwwjavításakávéfőzőkforgalmazása2000kávégépekszállításHázhozhasználttólSolis35000garanciahónapSásd

Forrás: pepitahirdeto.multiapro.com

Zamárdii kiadó szálláshelyek fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Sok fényképpel a szálláshelyekről és a városról! - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Egész évben nyitva tartó szálláshelyek Zamárdiiban - Weblap: www.zimmerinfo.hu/zamardi/hu.htm


Feladva: 2017-11-16    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfokiadóEgészZAMÁRDIáronhtmapartmanokszállásoklegolcsóbbzamardinyaralóházakelfogadónélkülvillákPihenőkártyadíjwwwvendégházak

Forrás: pepitahirdeto.multiapro.com

Bútort, elektronikai terméket, építőanyagot vásárolt, szeretné minél hamarabb használni, de sokára szállítanák ki? Új lakásba vagy irodába költözne? Ne keressen tovább! Bízza rám a szállítást! Cégek, magánszemélyek részére: korrekt szállítási díjakkal, pontosan, gyorsan, megbízhatóan nyújtom szolgáltatásaimat belföldön és külföldön egyaránt. Raktér méret: 4,1x2,1x2,25 m. Raksúly: 1,5 tonna. Raktározási lehetőség Budapest területén, 1 - 500 m2-ig (kamion beállás megoldott). Kapcsolat: Tel.: ... további részletek >>

20/539-6001 E-mail: info@lajostrans.hu Weboldal: www.lajostrans.hu


Feladva: 2016-10-26    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 1x2Lajos6001rámRaktározásihamarabbkedvezőmegbízhatóan539BízzaRaksúlyminéláruterítésgyorsanTeltovább25mszeretnéfuvarozáspontosanKapcsolatami

Forrás: pepitahirdeto.multiapro.com

Fix 10 000 Ft/nap áron kölcsönözhető platós, ponyvás teherautók Budapesten. 3,5 tonnás B-s jogosítvánnyal vezethető. KAUCIÓ VAN!


Feladva: 2017-03-30    [Autó - Motor - Jármű]

Címkék, kulcsszavak: áronfixbérlésteherautókTeherautóponyvásPlatóskölcsönözhetőVANnapKAUKCIÓ000vezethetőjogosítvánnyalBudapesttonnásChriscarBudapesten

Forrás: pepitahirdeto.multiapro.com

Készülj fel a nyelvvizsgára otthon kényelmesen, a saját időbeosztásoddal. Heti egy alkalommal kérhetsz tanári segítséget is személyesen vagy skype-on. www.eszperanto-tanfolyamok.hu


Feladva: 2017-03-22    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: segítségetfeltanáriKészüljkérhetszFerencalkalommalHarnyosegytanfolyamHetieszperantótanfolyamokidőbeosztásoddalInterneteseszperantosajátskypevagy

Forrás: pepitahirdeto.multiapro.com

Autómentés a nap 24 órájában az év minden napján belföldön minden gépjármű-kategóriában. • Rendelkezésre állás: 0-24 óráig! • Autómentő kiállási ideje Budapesten: 30-40 perc • Autómentő kiállási ideje vidékre/külföldre: azonnali indulással, a lehető legrövidebb időn belül!


Feladva: 2016-01-23    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 8226Autómentés6499188TelIstvánMészárosmindenidejekiállásiAutómentőnapbelülidőnpercDunakeszilegrövidebbBudapestenautószállításlehetőóráigNon

Forrás: pepitahirdeto.multiapro.com

A vakbél gyulladása gyakori probléma, főként férfiaknál és fiatalabb korban jelentkezik. Tünete lehet a puffadás, étvágytalanság, rossz közérzet, a köldök és gyomortáji fájdalom, előrehaladott állapotban láz is jellemzi. A vakbél gyulladás kezelése kizárólag műtéttel történhet. Miután a betegséget diagnosztizálták, az orvos a lehető leghamarabb sort kerít a gyulladt szövetek eltávolítására a szövődmények - vakbél perforálódása - elkerülése érdekében. A vakbélgyulladás elleni terápiák a műtét ... további részletek >>

után magukban foglalják antibiotikum szedését a fertőzés megelőzéséhez, valamint az első néhány napban pépes ételek fogyasztását.


Feladva: 2016-10-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vakbélgyulladáskezelésenéhánykizárólagterápiákrosszkerítgyakorielsőelleniétvágytalanságsortKittivalamintvakbélgyulladáspuffadásleghamarabbKellér

Forrás: pepitahirdeto.multiapro.com

Ha üzletet nyit, kérjen ajánlatot a Váróczi Üzletberendezéstől! Váróczi minőség · Kiemelt garanciák * Tanácsadás * Üzletberendezés gyártás * Helyszíni beszerelés * Üzletberendezés tervezés


Feladva: 2017-09-21    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: ÜzletberendezésVáróczitervezésgyártásTanácsadás183minőségÜzletberendezéstőlajánlatotbeszereléskérjenHelyszíninyitüzletetajánlógaranciákHirdető

Forrás: pepitahirdeto.multiapro.com

Angol nyelvtanítás, korrepetálás, felkészítés nyelvvizsgára, állásinterjúra, közép és emelt szintű érettségire Szolnok belvárosában diplomás nyelvtanárral.


Feladva: 2017-09-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nyelvtanításAngolSzolnokbelvárosábanbarnaérettségireszintűemeltközépállásinterjúranyelvvizsgárafelkészítésnyelvtanárralkorrepetálásdiplomás

Forrás: pepitahirdeto.multiapro.com

Nem online! Személyes segítség! Azonnali társtalálás megbízhatóan általam. Diplomások, Vállalkozók, jó társaság! Azonnali Társközvetítés · 23-96 év közöttieknek Férjet? Feleséget keres? · Hívjon már ma!


Feladva: 2017-07-15    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: Azonnali183FérjetSzemélyesközöttieknekonlineTársközvetítésNemajánlótársaságHirdetőVállalkozókPepitamárDiplomásokIrodájaHívjonáltalamTárskereső

Forrás: pepitahirdeto.multiapro.com

Nyíregyházán két utcával határolt 4650 m2 telephely, építési teleknek is, az ukrán, román, szlovák határokhoz vezető 41-es főút 6-os km-nél eladó. A városközpont 4 km, az M3-as autópálya 1 km, a határok 50-100 km távolságra vannak. Sok célra alkalmasan, lekövezve, bekerítve, közművesítve, tetszés szerint oszthatóan. 63 m széles. A telek előtt 23 ezer gépjármű megy el naponta.


Feladva: 2017-05-03    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 245251bekerítvenélgépjármutcávallekövezvevezetezerkétalkalmasanhatárokhozNyíregyházáncélraszlováktelekNyíregyházaSokrománszélesJános100

Forrás: pepitahirdeto.multiapro.com

Ápolás, kezelés nélkül hajunk nem csak lassabb ütemben nő, de a hajszálak fakók, töredezettek is lesznek. A hosszú fekete haj nagyon igéző, azonban sokan nem is sejtik, mennyi törődést igényel egy igazán szép, egészségtől ragyogó frizura. A hosszú haj számára fontos a különböző tápanyagok külső és belső pótlása is. A vitaminok, ásványi anyagok, nyomelemek hozzájárulnak a hajszálak egészséges fejlődéséhez, míg a rendszeresen használt balzsamok, pakolások kívülről pótolják a szükséges ... további részletek >>

tápanyagokat. A haj növekedését a fejbőr masszírozása is elősegíti. Hosszú frizura tudnivalók weboldalunkon!


Feladva: 2017-09-22    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hajHosszúhajszálaknemfrizuratitkafejbőrigényelmígtöredezettekkülsőKellérnövekedéséttörődéstfejlődéséhezfakóktápanyagokmennyiegészségesütemben

Forrás: pepitahirdeto.multiapro.com

0-24 darázsirtó gyorsszolgálat vállalja Budapesten és országos kiszállással darazsak, lódarazsak azonnali eltávolítását porozásos, permetezéses eljárással. Oldalunkon hasznos darázsirtási tanácsokat olvashat a házilagos darázsirtással kapcsolatban.


Feladva: 2015-07-30    [Lakossági szolgáltatás]

Címkék, kulcsszavak: porozásosBudapestpermetezésesdarázsirtókapcsolatbaneltávolításátZoltándarázsirtássalazonnaliGoldnerházilagoslódarazsakdarázsirtásolvashatdarazsak

Forrás: pepitahirdeto.multiapro.com

Kameradepó az IP kamerák, IP kamerarendszerek, éjjel látó színes IP infrakamerák webáruháza! Ön kényelmesen megrendeli az íróasztala mellől, mi rövid határidővel kiszállítjuk! Prémium kategóriájú Full HD IP kamerarendszerek a legjobb áron! Magánszemélyeket, cégeket és kivitelezőket is kiszolgálunk! Nézze meg a weboldalunkat: www.kameradepo.hu/ip-kamerarendsze r.html Kérje kollégánk segítségét: 06-20-5698848 Kameradepó webáruház a gyors, biztonságos megoldás!


Feladva: 2014-02-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: KameradepókamerarendszerekhttpolcsónFullinfrakamerákgyorsweboldalunkatKamerarendszertkategóriájúszíneswebáruházmegPrémiumlátóNézzekiszállítjukéjjel

Forrás: pepitahirdeto.multiapro.com

Adatrögzítést, gépelést vállalok. Jegyzőkönyv készítését értekezletről, közgyűlésről, konferenciáról, gyorsírással, hanganyag készítésével. Gépelést, szövegszerkesztést, hanganyagok leírását, adatfeldolgozást, adatbázis feltöltést. Szakdolgozatok, fordítások, könyvek, használati útmutatók, diplomamunkák, kéziratok, életrajzok, önéletrajzok leírását. Interjúk, cikkek, háttéranyagok leírását diktálással is. www.kattyca.mindenkilapja.hu/html/ 22219339/render/bemutatkozas


Feladva: 2015-07-17    [Vegyes hirdetések]

Címkék, kulcsszavak: leírásátkattycakészítésétJegyzőkönyvGépeléstmindenkilapjaértekezletrőlInterjúkadatbázisönéletrajzokadatfeldolgozástwwwéletrajzokhanganyagokcomvállalok

Forrás: pepitahirdeto.multiapro.com

Badacsony és vonzáskörzetében lévő kiadó szálláshelyek fényképes gyűjtőoldala. (~ 120 szállás) Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Több mint 1000 fényképpel a szálláshelyekről és a településekről! - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Egész évben nyitvatartó szálláshelyek Badacsonyban - Weboldal: ... további részletek >>


Feladva: 2017-04-26    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: badacsonyszálláshelyekszállás120zimmerinfokiadóSzéchenyilévőnélkülhttpnyaralóházakkártyavonzáskörzetébendíjWeboldalvillákSZÉPközvetítésipanziók

Forrás: pepitahirdeto.multiapro.com

Kárpitozás. Teljes vagy részleges kárpitozás autó utasterében. Bőr, műbőrbevonatokkal történő javítási munkák, ill. teljes belsőtér kárpitozás. Kormánybőrözés, műszerfalbőrözés, ajtókárpitbőrözés, tetőkárpitozás,ülés javítás, utastér kárpitbőrözés és műbőrkárpitozás. Lakóbusz kárpitozás. Lakóautó - lakókocsi kárpitozás, műbőrkárpitozás, bőrkárpitozás, kárpitjavítás. Helyszíni ki és visszaszereléssel is. Kéz és lábáploló szalonok pedikűrszékeinek újra kárpitozása. Kozmetikai, tetoválószék ... további részletek >>

kárpitozás. Fogászati székek újra kárpitozása. Konditermek kondigépeinek újrakárpitozása, továbbá pubok, éttermek boxainak újra kárpitozása, szivacsolása. Masszázságy, ill. sportklubok gyúrópadjainak újrakárpitozása. E mail: carleathering@gmail.com Tel.: +36209313164


Feladva: 2017-02-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: kárpitozáskárpitozásaújraújrakárpitozásaillbőrkárpitozásműbőrkárpitozásteljespedikűrszékeinekKárpitoscarleathering@gmailLakóbuszéttermekmunkákszalonok

Forrás: pepitahirdeto.multiapro.com

Számtalan pénzkeresési lehetőség van arra, hogy otthonról dolgozva jövedelmed legyen. A weboldalon megosztok veled néhány ötletet, lehetőséget ebben a témában. Bővebb információ a weboldalon: http://allasokotthon.uw.hu/


Feladva: 2016-07-18    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: weboldalonotthonrólvanötletetlehetőségnéhánypénzkeresésiveledSzámtalanallasokotthonmegosztokálláshttplegyenmunkaajánlatokjövedelmedvégezhetőBővebb

Forrás: pepitahirdeto.multiapro.com

A bevásárlóközpontok, plázák, mallok világszerte méltán népszerűek... Olyan igényt elégítenek ki, amivel mindenki nyer! Magyarországon is jelentősen növekedik az e-kereskedelem. Számtalan webáruházat találhatunk, jót is és kevésbé jót is... Azoknak a kereskedőknek figyelmére mindenképpen számítunk, akik már megtapasztalták a saját webhelyeiken nem csak az éppen hatályos jogszabályoknak kell megfelelni, hanem folyamatosan karban kell tartani a webhelyet, annak az elérhetőségét, különben a ... további részletek >>

látogatottság, vele együtt az üzleti eredmény is elmarad. Azok figyelmére is számítunk, akik (esetleg földrajzi adottságaik miatt?) fejlődésre csak az interneten keresztül számíthatnak. Internetes kereskedelemről van szó, pláza szerű webes környezetben! Nem feltétlenül mindenki alkalmas azonnal árusítani termékét, interneten forgalmazható szolgáltatását. Ismerjük meg egymást! Ön tudni szeretné, hogy miképp lehet kereskedő webplázánkban, mi pedig azt, hogy Ön milyen gyakorlattal (ismeretekkel) rendelkezik már az internetes kereskedelemben, milyen árucikkeket, termékcsoportokat forgalmazna. Ezen a helyen biztonságosan üzenetet küldhet, egy rövid bemutatkozást, cégismertetőt kérünk! Ha van webhelye, kérjük írja meg webcímét is! Minden olvasónak köszönet az érdeklődésért, az üzenetekre a legrövidebb időn belül válaszolunk!


Feladva: 2017-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: márNemhogyjótvaninternetenakikesetlegmilyenplázaszámítunkfigyelméreinternetesmegkellMagyarországonmindenkicsakkérjükegymástüzletinyeridőn

Forrás: pepitahirdeto.multiapro.com

Akác kerítéslécek közvetlenül a gyártótól. Többféle minta és méret.Akár egyedi igények készítését is vállaljuk. Szeletelt akác. Kerítések kivitelezése. Kérje ingyenes árajánlatunkat email-ben.


Feladva: 2017-05-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: gyártótólakáckerítésingyenesméretKerítéslécKérjemintakivitelezéseTöbbféleKerítésekközvetlenülSzeleteltkerítéslécekvállaljukÉrdkészítésétAttilaben

Forrás: pepitahirdeto.multiapro.com

Bakonyban 16 hektáros terület egy 200 négyzetméteres lakóházzal, két gazdasági épülettel (70 +180 nm), egy 50 négyzetméteres pincével, valamint hat halastóval eladó 600.000 EURO-ért vagy csak 6.5 hektárral 480.000 EURO. Kód: 864 Közvetlen link: www.immobalaton.com/ingatlan/elado /864 Az összes jelentős bank kínálatából legalkalmasabbat megkeresve 150 millió Ft-ig teljes körű hitel ügyintézést vállalunk!


Feladva: 2017-07-13    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: jelentősEURO000864négyzetméteresegybank200KódvállalunkhatterületügyintézéstvalamintösszeshektároshitelpincévelBakonyban480körűeladoajánló

Forrás: pepitahirdeto.multiapro.com

Ha nem megy zökkenőmentesen az életed, de nem tudod hova kapj, mi legyen az első amit megoldasz.  Ha egyszerűen csak kicsúszott a kezedből az irányítás, és kellene egy külső nézőpont. Ha kiborít a családod, és úgy érzed tehetetlen vagy. Kérd az ingyenes konzultációt! Rédai Anikó Családpedagógiai mentor E-mail: eletvitel@redani.hu Tel.: +36 30/418-6926 A konzultáció alatt elmondhatod mi a problémád. Felteszek pár kérdést. Majd kapsz egy kedvezményes ajánlatot, és ... további részletek >>

segítséget ahhoz, hogy rendezd a helyzeted.


Feladva: 2017-02-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: AnikóRédaikonzultációingyenesegynemhelyzetedúgymegoldaszpárBudapestmentorrendezdcsaládodamitFelteszekÉletviteliCsaládpedagógiaihogykiborít418

Forrás: pepitahirdeto.multiapro.com

Fogyni szeretnél? Hogyan tudnál a leghatékonyabban lefogyni úgy, hogy a kilók ne kússzanak vissza? A weboldalon megismerheted azokat a technikákat, amelyek segítenek a fogyást akadályozó lelki okok megszüntetésre. Bízom abban, hogy Te is könnyen megtalálhatod azt, ami segíthet végre beindítani a fogyást. A lelki okok megszüntetésére és a stressz oldására nagyon egyszerű módszereket találsz. www.blog.topponleszel.com/fogyokur a-2


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: okoklelkifogyásthogyakadályozóamitechnikákatnagyonHogyanaztazokatoldásáraszeretnélmegtalálhatodmegismerhetedstresszFogynikönnyenfogyokuraTréner

Forrás: pepitahirdeto.multiapro.com

Bogács üdülőövezetében a Termálfürdőtől, horgásztótól öt perc sétára önálló vendégház kiadó. Pihenjen családjával, barátaival úgy, hogy csak ismerősök vegyék körül! Itt nem kell idegenekhez vagy a tulajdonoshoz alkalmazkodnia. 2014 óta változatlan árakkal várjuk vendégeinket.


Feladva: 2017-01-24    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kiadóvendégházBogácscsaládjávalNórakellPihenjenvendégeinketKozmánénemvárjukBogácsonIttárakkalkörülönállóváltozatlanvegyéksétáraótaismerősök

Forrás: pepitahirdeto.multiapro.com

Fűkaszálást, fűnyírást, kis kertek ápolását, gyümölcsösök rendbehozatalát, permetezést vállalok kedvező áron. Tel: 0630-747-5888


Feladva: 2017-06-28    [Lakossági szolgáltatás]

Címkék, kulcsszavak: fűnyírástFűkaszálástvállalokTeláronkedvezőGáborNagypermetezésthozatalátrendbegyümölcsösök5888ápolását747kertek0630kis

Forrás: pepitahirdeto.multiapro.com

Új lakásba, házba költözni nagy öröm, még akkor is, ha csak nekünk új az ingatlan... Díszítse, dekorálja egyéni módon lakását vagy házát! Ha nincs ötlet, elképzelés, mi segítünk! Esetleg a hálószobában egy közös emlékeket idéző falmatrica. Vagy egy gravírozott kávéscsésze vagy müzlis tál, esetleg két - vagy több - névvel ellátott borospohár. Keressen minket és mi megoldjuk!


Feladva: 2016-11-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: vagyesetlegegyidéződekortöbbemlékeketlakasközöshttpkéthálószobábanZamárdisegítünkPétertálajándékozzmegoldjukBuzásmüzlismitminketötleted

Forrás: pepitahirdeto.multiapro.com

Becsületes, nemzetközi üzlet a legnagyobb, piacvezető céggel, a DXN-nel A legjobb minőségű kávé 100% tiszta Ganoderma kivonattal Profi weboldal 16 nyelven a regisztrációval: -minden szükséges tréninganyaggal és -üzletépítéshez szükséges eszközzel Páratlan marketing terv: -folyamatos bónusz felhalmozás, -nincs havonkénti nullázódás! Csatlakozz most: www.kavekiraly.hu/uzleti_lehetoseg


Feladva: 2016-03-03    [Pénzkeresés - MLM]

Címkék, kulcsszavak: Ganodermaüzletnemzetköziszükséges100kávéDXNlehetosegfolyamatosweboldalcéggeluzletitervProfipiacvezetőkavekiralymarketingkivonattallegnagyobbnel

Forrás: pepitahirdeto.multiapro.com

Régi és új üzemanyag tankok teljes körű javítása, homok szórás, rozsda mentesítés, vágás, hegesztés, belső üzemanyag álló bevonat készítése, külső festés, fényezés, feliratok, csíkok készítése, bicikli fényezés. Motor, autó, kamion, hajó vagy más üzemanyag tank, hozza el megjavítjuk. Felnik fényezését is vállaljuk. Látogasson el honlapunkra!


Feladva: 2017-02-27    [Autó - Motor - Jármű]

Címkék, kulcsszavak: üzemanyagfényezéskészítésetankfestésjavításavagykülsőhonlapunkrakörűhajóbevonatLátogassonteljeskamionállóvállaljuktankokautóbelsőfényezését

Forrás: pepitahirdeto.multiapro.com

Cégünk a szakszerű építési projektek kivitelezésére alakult. Családi házak, lakások, irodaházak, társasházak teljes körű generálkivitelezését, valamint felújítási munkákat vállalunk a Dunántúl szinte bármely pontján. Vállalunk mély és magasépítő munkákat, kézi - gépi földmunkákat, közműépítést, útépítést, tereprendezést, kertépítést, alakító földmunkákat, tereprendezést, ingatlanfelügyeletet, karbantartást, felújítási munkálatokat. Vállalatoknak, önkormányzatoknak, magánszemélyeknek is!


Feladva: 2015-11-06    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: vállalunkfelújításimunkákattereprendezéstföldmunkákatgenerálkivitelezésétmunkálatokatépítésikézikörűszakszerűteljeskarbantartástCégünkmagasépítőmély

Forrás: pepitahirdeto.multiapro.com

Főbb kínálatunk: OMNITRONIC / PSSO dj – stúdió – hangtechnika ::: EUROLTE / FUTURELIGHT látvány – fénytechnika ::: DIMAVERY hangszerek ::: ALUTRUSS traverz ::: OMNILUX fényforrások ::: ROADINGER rack gyártás ::: EUROPALMS műnövények – dekoráció. Nálunk közel 10.000 termék közül válogathat. A megfelelő termékek kiválasztását fotók, videók, részletes termék leírások és pontos méretek segítik. Tekintse meg kínálatunkat... www.showtechnic.hu


Feladva: 2016-12-04    [Zene - Hangszer]

Címkék, kulcsszavak: showtechnictermék2003HUNGARYrackOMNILUXpontosPSSO000traverzleírásokOMNITRONICközelALUTRUSSkínálatunkNálunkhangszerekrészletesFőbbdekorációker

Forrás: pepitahirdeto.multiapro.com

- Szerszámok - Szerszámgépek - Kötőelemek - Rögzítéstechnika - Kötéstechnika - Hegesztéstechnika - Forrasztástechnika - Munkavédelem - Zárak- Lakatok- vasalatok - Festékek- Vegyiáru - Mérőeszközök - Csiszolástechnika


Feladva: 2016-10-04    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: FestékekSzerszámokvasalatokBudapestLakatokKftZárakBauMunkavédelemBarkerForrasztástechnikaSzakáruházHegesztéstechnikaSzerszámKötéstechnikaIparcikk

Forrás: pepitahirdeto.multiapro.com

MÉHÉSZ HUZAL - keret drót dobon és tekercsben. 0,4 és 0,5 mm-es lágy - HORGANYZOTT huzal dobon 1.250,-Ft, - ROZSDAMENTES (inox) huzal dobon 2.500,-Ft/kg. Kiszerelés: 1, 2, 3, 4, 5 kg, igény szerint. (lehet nagyobb is) A meghirdetett ár, 1 kg. dobra csévélt horganyzott huzalra vonatkozik! A dobokhoz, különböző méretű huzaleresztő kapható. A termék postázása, postai díjszabás szerint. Kereskedőket, viszonteladókat is kiszolgálunk! A termékek honlapunkon közvetlenül megrendelhetők!


Feladva: 2016-11-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: huzaldobonszerinthorganyzottdrótkeretMÉHÉSZKereskedőketKfthuzalraPluszinoxdíjszabásDrótszálcsévéltROZSDAMENTESpostázásaAKCIÓdobra250termék

Forrás: pepitahirdeto.multiapro.com

LEGYEN A TE TORTÁD IS EGYEDI! TortaFoto.eu - A weboldal ostya és cukorlap nyomtatással foglalkozik! Tortadíszítés, szülinapi torta, fényképes torták a saját fotóddal! Szállítás országosan!


Feladva: 2017-02-14    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TortaFotoSzállításostyafotóddalweboldalsajáttortákEGYEDIfényképesTORTÁDtortaLEGYENszülinapiOrszágosTortadíszítésfoglalkoziknyomtatássalországosan

Forrás: pepitahirdeto.multiapro.com

Használt számítógépek, laptopok és számítástechnikai kiegészítők, alkatrészek széles kínálatával várjuk üzletünkben Bonyhádon. 7150 Bonyhád, Rákóczi F. u. 1 Tel.: 0620/40-40-500


Feladva: 2017-09-05    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: kiegészítőkszámítástechnikailaptopokBonyhádszámítógépekHasználtalkatrészekbonyhadcomputerhttpsRákóczi7150BonyhádonSzámítástechnikaüzletünkbenvárjuk500

Forrás: pepitahirdeto.multiapro.com

HULLÁMOSÍTOTT ACÉLHÁLÓ (Heidekker háló) gyártása. Egyedi méretekre és különböző kivitelben gyártott hullámosított acélhálók (Heidekker háló) 18x18 mm-től - 115x115 mm-ig, többféle kockaméretekben: sima normál / álló, diagonál / átlós, valamint duplaszálas átlós kivitelben, 2330,-Ft/m²-től Megrendelhető: Nyíregyháza, Szarvas u 85 www.drotspecial.hu Tel: 06-70/453-8288


Feladva: 2016-10-04    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: HeidekkerhullámosítotthálóNyíregyházatőlACÉLHÁLÓkivitelbenátlósdrotspecialDrótszálvalamintacélhálókwwwdiagonálSzarvasállógyártottnormálkülönböző

Forrás: pepitahirdeto.multiapro.com

Kitartó, lelkes embereket keresek Bio termékek katalógusból történő árusításához. A munka teljes mértékben otthon végezhető, és nagyon egyszerű, mivel AUTOMATIZÁLT WEBOLDAL segítségével történik, költség és kötelezettségmentesen. Gyes mellett, nyugdíj mellett, de akár munka mellett is, minimális időráfordítással növelheted a bevételed. MUNKATÁRSKÉNT stabil jövedelem lehetősége egy nemzetközi üzlet partnereként - Nincs felső korlát. Annyit kereshetsz, amennyit csak szeretnél. - Az EU ... további részletek >>

országaiban is nyitott a lehetőség! Válassz most BIO készítményeket a mesterséges szemét helyett! Nézd meg a KÍNÁLATOT: www.egeszsegbomba.mylifecare.hu 100% elégedettségi garancia! Regisztrációs és tagsági díj helyett ajándékokkal és folyamatos akciókkal várunk Téged: + AJÁNDÉK utalvány + AJÁNDÉK VIP hűségkártya + AJÁNDÉK katalógus + AJÁNDÉK magazin + AJÁNDÉK termék Hozd létre ingyenesen felhasználói Partner fiókodat és rakd kosárba meglepetéseinket! Ha kedvet érzel hozzá, és szívesen keresnél pénzt ilyen formában, akkor részletesen tájékozódhatsz a weboldalon. Jelentkezzél fel hírleveleinkre is! www.egeszsegbomba.mylifecare.hu A felmerülő kérdéseidre szívesen válaszolok az alábbi e-mail címen: szerencseneked@gmail.com


Feladva: 2016-11-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AJÁNDÉKmellettmunkahelyettszívesenBIOmylifecareegeszsegbombahttphírleveleinkreakciókkalnemzetközikeresekhozzámegcímenHozdszeretnélegyszerűfel

Forrás: pepitahirdeto.multiapro.com

Nagykereskedelmi cégünk, kiskereskedelmi forgalomban eladásra kínál Meiller Kipper, Meiller, FX Meiller teljes típuscsaládjának minden hidraulikus és kapcsolódó alkatrészét, felújító készletét, felépítmény fő és részegységeket a lehető legkedvezőbb áron. Vállaljuk továbbá minden típusú hidraulika rendszer alkatrészének raktárról és nemzetközi beszerzésből való pótlását, kiváltását, beszerzését, javítását, felújítását.


Feladva: 2017-06-06    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: Meillerhidraulikamindenrendszerkészletétfelújításátforgalombanfelújítójavításátkiskereskedelmitípusúalkatrészétbeszerzésétcégünkkapcsolódókiváltását

Forrás: pepitahirdeto.multiapro.com

Tűzifa? Szén? Szilárd tüzelő? Ha tűzifára (ömlesztett köbméterben, vagy mázsára), vagy szénre (lengyel feketeszén, cseh barnaszén, német brikett) van szüksége, hívjon bennünket! A tüzelő kiszállításán kívül vállaljuk a behordást, illetve megbeszélés alapján a tűzifa felrakását (sliht) is.


Feladva: 2016-11-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tűzifaSzéntüzelővagynémetSzilárdbehordástbarnaszénvállaljukcsehBudapestkívülfeketeszénGáborkiszállításánlengyelFeketeszénreSZÁLLÍTÁSslihtvan

Forrás: pepitahirdeto.multiapro.com

Tectonic Tecto Pack Outdoor kültéri pingpong asztal hálóval, mely nem igényel fel és leszerelést. Egyszemélyes játéklehetőség biztosított! A Tectonic termékek gyártója az elsőosztályú asztalitenisz felszerelések gyártójaként ismert Cornilleau francia gyár. A termék lapjára 3 év garancia vonatkozik, a pingpong asztalra 2 év általános garancia vonatkozik. A Tectonic Tecto Outdoor asztal a márka belépőmodellje a kültéri asztalok között. A termék otthoni szabadidős pingpongozáshoz lett ... további részletek >>

kifejlesztve, könnyen kezelhető No1 minőségű termék. A gyár versenysportban szerzett tapasztalatait az otthoni felhasználásra szánt asztalok gyártási technológiájába átülteti, ennélfogva a pályavonalazás a 4 mm vastag melamine asztallap anyagába van beledolgozva, ezt követi a csillogásmentesítő fedőréteg. Az újító technológiának köszönhetően a pályavonalazás sem mechanikai behatások sem a nap szívó hatására nem fakul, nem károsodik. A Cornilleau kültéri asztalitenisz asztalok szinte egész évben tárolhatóak a szabadban, hóban, fagyban, napsütésben, a teljes mértékben korrózióálló szerkezetnek köszönhetően hosszú éveken át ellenáll az időjárás viszontagságainak. www.tacticsport.hu/termek/cornilleau-tectonic-tecto-outdoor-kulteri-ping-pong-asztal/1448/331


Feladva: 2017-07-15    [Sport - Kemping - Túra]

Címkék, kulcsszavak: kulteritectonicoutdoortectocornilleautermekasztalasztaloknempingpongsemköszönhetőenotthonipályavonalazásasztaliteniszgyárvonatkozikponggarancia

Forrás: pepitahirdeto.multiapro.com

Nemzetközi szinten is kiváló minőségű, sporttáplálkozási-, étrend-kiegészítő- és diétás termékek. Body&Fit termékek. Kategóriák: www.bodyfit-hungary.hu/bodyandfit_ kategoriak


Feladva: 2017-08-01    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: termékekBodydiétássporttáplálkozásiFitkiegészítőétrendminőségűhungarykiválóbodyfitszintenwwwNemzetköziBudapest

Forrás: pepitahirdeto.multiapro.com

Flóra Garden kertészeti Bolt és Webáruház! Szobraink garantáltan fel fogják dobni környezetét! Viszonteladók jelentkezését is várjuk! (06 70/299-2066)


Feladva: 2017-01-12    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: kertimostmárdíszeinkettipegőthttpgarantáltanvagykészletkisöprésSzobrainkárongrillezőtTéliirodájátlegalacsonyabbszökőkutat2066Halásztelekpiacon

Forrás: pepitahirdeto.multiapro.com

Síremlékek és urnák műanyagból! A Magyar Szabadalmi Hivatal által kizárólagos ipari-jogvédelemmel ellátott műanyag síremlék. Könnyű, akár egyénileg felállítható, szállítható, mozgatható, mosható, csavarozható elemekből áll, névtábla, váza, fed lap, anyagában színezhető, esetleg, külön igény szerint fényezhető, nagyon praktikus, esztétikus és kedvező árfekvésű síremlék! Olyan befektetők jelentkezését várjuk, akiket a termékek gyártási joga érdekel!


Feladva: 2016-05-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: síremlékgyártásiakárpraktikusműanyagbólvázatermékekKönnyűnagyonurnáknévtáblaakiketműanyagfényezhetőSíremlékekállvárjukellátottszerintLászló

Forrás: pepitahirdeto.multiapro.com

Táplálékunk az egészségünk! Túlszennyezett világunkban rengeteg káros anyag halmozódik fel bennünk, ezért fontos a szervezetünk megtisztítása, és az ételeink megtisztítása is! Ehhez nyújt segítséget e készülék, mely ózonnal (O3) kitisztítja a zöldségekbe, gyümölcsökbe felhalmozódott vegyszer, rovarölő-szer maradványokat. A húsokból és halakból a hormon és egyéb maradványokat. De fertőtleníthetjük lakásunkat, autónkat a különböző gombáktól, baktériumoktól is. Igazi természetes fertőtlenítő!


Feladva: 2014-10-23    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: megtisztításamaradványokatfertőtlenítőkészülékvegyszerautónkatvilágunkbanfelhalmozódottételeinklakásunkatTúlszennyezettgyümölcsökbeszervezetünkegészségünk

Forrás: pepitahirdeto.multiapro.com

Legújabb digitális festékrétegmérő készülékünk az elmatronic F/NF HANDY. Nagyméretű LCD kijelzője könnyedén leolvasható, sőt a FLIP DISPLAY szolgáltatásnak köszönhetően az LCD kijelzőn megjelenő információk egy gombnyomással 180 fokban megfordíthatóak. Így a mérési eredmények minden esetben kényelmesen olvashatóak. Beépített mérőszonda, automatikus alapanyag felismeréssel. Gyors mérési sebesség, rendkívül egyszerű kalibrálás! 1 évgarancia! Magyar nyelvű használati útmutató! Áfás számla! ... további részletek >>

Szállítás raktárról azonnal! Ár: 49.000.-Ft Bruttó! Honlap: www.elmatronic.webnode.hu/products/elmatronic-f-nf-handy-digitalis-retegmero-keszulek


Feladva: 2017-02-26    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elmatronichandyLCDmérésifestékrétegmérődigitáliskeszulekdigitalisesetbenSzállításkijelzőnsebességkészülékünkmindenszámlaeredményekÁfásköszönhetően

Forrás: pepitahirdeto.multiapro.com

Kameradepo a Biztonsági kamerák és video megfigyelő rendszerek webáruháza. Megbízható, kipróbált infrás beltéri és kültéri kamerák, digitális rögzítők közvetlenül a forgalmazótól. Szerelésre előkészített komplett kamerarendszerek, melyeket csak fel kell szerelnie. Keressen minket: www.kameradepo.hu Tel: 06 20 569 8848 Kameradepo webáruház


Feladva: 2016-03-16    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: kamerákKameradepoBiztonságirendszerekKeressenközvetlenülmegfigyelőszerelnierögzítőkvideokelldigitálisfelwebáruházBudapestcsakkültériKftmelyeket

Forrás: pepitahirdeto.multiapro.com

Adósságbehajtás, Őrzés-védelem, Takarítás, Magánnyomozás, Testőrszolgálat, Sofőrszolgálat... Miért az Alfa 333 Group? Üzletfilozófiánk legfontosabb eleme a személy és a tulajdon védelme, ennek sérthetetlensége, óvása, fenntartása. Összegezve: számunkra Ön a legfontosabb!


Feladva: 2017-02-27    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: AlfaSofőrszolgálatTestőrszolgálatMagánnyomozásTakarításvédelemŐrzésAdósságbehajtásKftGroup333

Forrás: pepitahirdeto.multiapro.com

Pihenjen, üdüljön, kapcsolódjon ki nálunk és szülessen újjá a helyi Zsóry Gyógy-és Strandfürdőben, ami a szó szoros értelmében egy kőhajintásnyira van a Csilike apartmantól. Akcióinkról tájékozódjon a weboldalunkról: www.csilikeapartman.hu


Feladva: 2017-02-28    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: CsilikeáronkőhajintásnyiraszülessenjótegynálunkcsilikeapartmannyáronértelmébenkapcsolódjonwwwTélenszorosüdüljönhttpszóPihenjenweboldalunkrólami

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! Van a környezetében, rokoni, baráti, ismerősi körében munkanélküli, közmunkás, kisnyugdíjas, kis jövedelemért sokat dolgozó modern kori rabszolga, vagy aki folyamatosan hitelekből él és nehezére esik befizetni a számlákat? Ezek az emberek példaképek az Ön számára, vonzónak találja az életüket? Biztos benne, hogy Önnek is ezt a forgatókönyvet írta meg az élet, amelyen nem szabad változtatnia? Úgy érzi, hogy a szerencse folyamatosan elkerüli, és hogy Ön mindig a rossz ... további részletek >>

oldalra kerül? Ismer olyan embereket, családokat, akiknek szívesen elfogadná az életszínvonalát? Sokat álmodozik arról, hogy milyen jó lenne, ha Önnek is jobb élete lenne anyagilag? Sokkal egyszerűbb, mint gondolná! Van egy rossz hírem! Most egy életre elveszem Öntől azt a kifogást, hogy soha sincs szerencséje, hogy soha sincs jó időben jó helyen! Van egy jó hírem! Élete legnagyobb lehetősége kopogtat az ajtaján, amelyet sem a múltban nem kaphatott eddig meg, és a jövőben sem fog soha megkapni máshol! Miért különleges ez a lehetőség és miért teljesen más, mint amikkel eddig megkeresték Önt? Nem kell egy fillért sem befizetnie semmire sem, nem kell megvennie felesleges termékeket, szolgáltatásokat, nem kell MLM rendszerben eladnia semmit sem, nem kell külföldiek zsebét tömni, nincsenek vásárlási és egyéb kötelezettségei! Ezzel szemben már az ingyenes regisztrációjánál kap 12.000,- forintot ajándékba, amelyet felhasználhat a mindennapi vásárlásainál, nyereség részesedést kaphat több mint 10.000 kereskedő és szolgáltató forgalmából, Ön kereshet minden külföldi ember mindennapi vásárlásából, számtalan lehetőség közül választhat szabadon, kap egy ingyenes bankszámlát, kap két ajánlói weboldalt, melyeken regisztráció nélkül is minden információ megtalálható, kap egy webirodát, ahol követheti a bevételeit, tanulhat és fejlődhet nem csak üzletileg, hanem emberileg is! Amit garantálni tudok, hogy kizárólag több pénze lehet, kevesebb nem, ez által semmilyen kockázata nincs, és ha más területen tevékenykedik, akkor továbbra is foglalkozhat vele szabadon, ha szereti azt, amit csinál. Továbbá garantálom, hogy minden segítséget megkaphat, amely szükséges lehet ahhoz, hogy megvalósíthassa minden célját és álmát, amelyet elképzelt magának! Túl szépen hangzik? Ha megismer, ennél még sokkal többet is fogok mutatni Önnek! Email: rozsabusiness@gmail.com Kérdéseivel keressen bizalommal!


Feladva: 2017-02-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemegysemmindenkapkellmégSokatsohamintÖnnekamelyetsokkalmiértmáskörnyezetébenamitÉletedolgozóingyenesVannakazthíremjövedelemért

Forrás: pepitahirdeto.multiapro.com

Gitártanárt keresel Budapest belvárosában? A tanítás külföldi segédanyagokkal, zenei alapokra. Mindenféle stílusban: blues, rock, jazz, funky... Kezdőtől haladó szintig. Nézz körül a Facebook oldalunkon is: www.facebook.com/GitarBasszusgitar


Feladva: 2017-10-12    [Zene - Hangszer]

Címkék, kulcsszavak: facebookstílusbanajánlásoldalunkonMindenféleHirdetőkörülalapokraPepitaNézzzeneioktatásszintigsegédanyagokkalbasszusgitárhaladókülföldiGitároktatás

Forrás: pepitahirdeto.multiapro.com

Eladó bazalt, andezit kockakő új és bontott állapotban. 10x10, 20x20-as méretekben. 4500 Ft/m2 ártól. Érdeklődni telefonon lehet: 06705887417


Feladva: 2017-05-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kockakőBazaltEladólászlóméretekben20x2010x10állapotbanbontott06705887417lehetAndezittelefononÉrdeklődniártólBudapest4500ft

Forrás: pepitahirdeto.multiapro.com

Egyedileg válogatott, magas minőségű gyerekruhák piciknek és nagyoknak. Örök méretgaranciával, akár ingyenes szállítással. A Facebookon is megtalálsz, keresd: Ruhacuka


Feladva: 2017-09-29    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: RuhacukaHasználtHirdetőakárajánlásingyenesEgyedilegszállítássalválogatottFacebookonmagasmegtalálszminőségűkeresdwebáruházgyerekruhákpiciknekÖrök

Forrás: pepitahirdeto.multiapro.com

Vásároljon profi IP kamerarendszert, beltéri éjjellátó IP kamerát, kültéri éjjellátó IP kamerát, szerelési anyagokat Magyarország egyik piacvezető kivitelező cégétől. Mi csak olyan IP kamerákat, hálózati videó rögzítőket, komplett kamerarendszereket ajánlunk Önnek, melyeket cégünk is nap mint nap telepít. Nézze meg web áruházunkat! Kameradepo webáruház Tel: 06 20 569 8848


Feladva: 2014-02-12    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: kamerátKameradeponapéjjellátómelyeketFullcégétőlwwwkamerarendszertÖnnekIparikivitelezőhttpprofiajánlunkpiacvezetőáruházunkatVásároljon8848egyik

Forrás: pepitahirdeto.multiapro.com

Kiválóan működő sugárfúrógép profilváltás miatt eladó.


Feladva: 2017-07-25    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: eladósugárfúrógépFerencTórhmiattprofilváltásműködőKiválóaninotaVárpalota

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés Budapest minden kerületébe és Pest megye több településére is lehetséges nálunk! 10 éves tapasztalattal várjuk hívását, ha sitt szállítást, zöldhulaldék vagy háztartási szemét elszállítását szeretné hatékonyan megoldani! A konténer rendelés szemét és sitt számára nálunk 1 perc alatt lebonyolítható! Telefonon, emailen és a weboldalunkon található űrlapon keresztül is leadhatja rendelését! 1 munkanapon belül leszállítjuk a hulladékgyűjtőt az Ön által megjelölt címre! Kisebb ... további részletek >>

felújításokhoz, kerti munkákhoz és építkezésekhez, bontásokhoz is van megfelelő méretű konténerünk! Konténer rendelés Budapest!


Feladva: 2017-08-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: rendelésKonténernálunkBudapestsittszemétstoptalálhatókonténerünkmegoldaniévesmegjelöltnonweboldalunkonméretűhatékonyanlehetségesáltalemailenvan

Forrás: pepitahirdeto.multiapro.com

Házi ápolást, idősgondozást vállalok szakképzett ápoló képesítéssel. Folyamatos 24 órás bentlakásos ápolásra vállalok bármilyen beteget, vagy gondozásra, felügyeletre szoruló idős nénit, bácsit. Kórházi gyakorlattal, demens betegelállásában is jártas, empátiával, sok türelemmel rendelkező, önmagára igényes, ápolt, tiszta, mosolygós, leinformálható középkorú, beteg centrikus nővér vagyok. Kérem, keressen bizalommal! Kovácsné Erika Tel: 06-30-463-6404


Feladva: 2017-01-11    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ErikaKovácsnévállalokidősgondozásrendelkezőnénitvagyokórásHáiápolástürelemmelidősnővérfolyamatossokszorulóbetegcentrikusképesítésselempátiával463

Forrás: pepitahirdeto.multiapro.com

Most adunk egy tippet, mivel váltsa ki meglévő halogén izzóját, a kevesebb energiafogyasztás végett! LED spotlámpával csökkentheti a világításra fordított energiát! A 3 wattos LED lámpa bruttó 890 Ft-ba kerül, ennyiért legfeljebb 3 halogén izzót vásárolhatunk, ugyanakkor a fogyasztást negyedére csökkenthetjük, így hamar megtérülés a LEDre fordított csere. Energiatakarékos LED spotlámpa 3 watt fogyasztással a 20W halogén helyére az ANRO Épületdíszítés Webáruházban!


Feladva: 2015-04-09    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: LEDhalogén890fordítottANROkevesebbhamarizzók20WizzójátígyWebáruházbruttófogyasztássalmeglévőcsökkenthetjükdarablámpawattváltsanegyedére230V

Forrás: pepitahirdeto.multiapro.com

Alumínium porfestés, színterezés Ablakok és ajtók, zsaluk, szúnyoghálók alumínium szerkezeti elemeinek, profiljainak, medencefedő szerkezetek elemeinek elektrosztatikus felületi kezelése porszórással a RAL-skála minden színében választható. Automatikus és kézi kabin. Kérje árajánlatunkat! Várjuk szíves érdeklődésüket. A porfestés folyamata képekben: www.femarkzsalu.hupont.hu/5/galeri a-porfestes


Feladva: 2017-03-14    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: alumíniumelemeinekporfestésKérjefelületiAblakokkabinelektrosztatikusszínterezéskéziAutomatikusszerkezetekZalaegerszegválaszthatómedencefedőKftminden

Forrás: pepitahirdeto.multiapro.com

Rejtett Kamerák raktárról otthoni és ipari használatra is! www.kameradepo.hu/komplett-rejtett -kamera-rendszer


Feladva: 2017-06-14    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: RejtettBudapestKameradepokészletünketóriásimeghasználatraNézzeipari8211otthoniKamerarendszerekraktárrólKamerák

Forrás: pepitahirdeto.multiapro.com

Varázslatos gyermek ruhák – Vásárolj olcsón otthonról! Új tavaszi,nyári kollekció amivel kislány álmok válhatnak valóra! Gyors szállítás! Új és használt kislány alkalmi és ünneplő ruhák elérhető áron.


Feladva: 2017-04-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: ruhákkislányáronelérhetőhasználtolcsónszállításVásároljGyors8211valóragyermekválhatnakVarázslatosálmokBudapestamivelButikkollekcióManóruha

Forrás: pepitahirdeto.multiapro.com

Kreatív hobbi kis- és nagykereskedelem - Webáruház Kategóriák: Akciós kifutó termékek Bizsualkatrészek Csomagoló anyagok Díszíthető tárgyak Festékek lakkok ragasztók Fűző anyagok Gyöngyök Könyvek Kreatív alapanyagok Modellezés formaöntés Órakészítés Papíráru Szalvétatechnika Szerszámok eszközök Textilek szalagok Zsanérok csatok zárak csavarok


Feladva: 2017-09-21    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: WebáruházKreatívanyagokSzalvétatechnikaragasztókPapírárulakkoknagykereskedelemÓrakészítésFestékekcsavarokkisformaöntéstárgyakzárakhobbiModellezés

Forrás: pepitahirdeto.multiapro.com

100+ nyelvpárban fordítunk szakszövegeket, a legmodernebb nyelvtechnológiai eszközökkel, magasan képzett szakfordítók bevonásával, professzionális irodai háttérrel. Specialitásunk a többnyelvű projektek kezelése, magyarról és angolról fordítunk egyszerre akár 40+ nyelvre. Leggyakrabban az alábbi témakörökben fordítunk, napi kapacitásunk több száz oldal: - jogi és pénzügyi szakszövegek, műszaki dokumentációk - felhasználói kézikönyvek, útmutatók, honlapok és online tartalmak - ... további részletek >>

szoftverfelületek és mobil applikációk - betegtájékoztatók, egészségügyi kiadványok - marketing anyagok - tréning és e-learning anyagok, multimédia tartalmak Irodánk kiemelten sok műszaki és élelmiszeripari szöveget fordít, ezekkel a projektekkel két külön divíziónk foglalkozik. A fordításokat fordítástámogató szoftverrel készítjük el, így lehetőség nyílik a szövegen belüli és a korábban lefordított szövegek közti egyezőségek felismerésére. További előnyök: - ismétlődésekkel arányos kedvezményes vállalási ár - garantált, következetes terminológia használat - könnyebb és hatékonyabb minőségellenőrzés - rövidebb határidők A fordításhoz kapcsolódó szolgáltatásainkra is felhívjuk a figyelmét: - lokalizálás - lektorálás - nyelvi konzultáció - fordítómemória és terminológiaépítés - szövegszinkronizálás - stílusútmutató - nyelvi tesztelés - gépi fordítás és utószerkesztés - DTP - internationalization „i18n” - leírás - kreatív fordítás | transzkreáció - voice over Kérje ajánlatunkat! www.edimart.com/szolgaltatasok


Feladva: 2017-04-12    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: fordításfordítunkműszakinyelviakártartalmakanyagokdokumentációkszakszövegeketfelhívjukfordítástámogatóalábbiovertranszkreációkövetkezetesegészségügyi

Forrás: pepitahirdeto.multiapro.com

Fellépésre, ünnepségre önnek, gyermekének, unokájának szüksége van Magyar, tájegység, illetve népviseleti ruhára? Küzdősportban vesz részt ön, gyermeke, unokája, és szüksége van egy masszív egyedi hozzávaló ruházatra? Megvett Magyar, tájegység, illetve népviseleti ruhát, amit át kell alakítani? Vett egy küzdősporthoz való cuccot, és át kell alakítani? Pusztán csak át kell varrni, megerősíteni, mert gyengén van varrva, és szétesik?


Feladva: 2016-08-17    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: kellvanegyszükségenépviseletiilletvetájegységalakítaniMagyarhozzávalógyengéngyermekénekegyedimertönnekVettmasszívmegerősíteniünnepségreamit

Forrás: pepitahirdeto.multiapro.com

Az elhunyt hamvasztásának és hamvainak hozzátartozó részére történő átadásának lehetőségeiről, körülményeiről és a szolgáltatás díjáról kaphat részletes információt. A Gyászhuszár Temetkezés munkatársai elintézik Ön helyett a bürokratikus tennivalókat, melyek az elhunyt hamvasztásának megszervezése során felmerülhetnek. HamvasztásTemetkezési szolgáltatás kedvező áron Budán a Móricz Zsigmond körtérnél és Pesten az Igazságügyi Intézetnél!


Feladva: 2017-09-30    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: TemetkezésGyászhuszárhamvasztásánakelhunytszolgáltatásmelyekkörülményeirőlHamvasztásTemetkezésitennivalókatIntézetnéllehetőségeirőlbürokratikusIgazságügyi

Forrás: pepitahirdeto.multiapro.com

Vezetőket és munkatársakat keresek online munkához. Számodra mi a legfontosabb: - egészség? - pénz? - szabadidő? - anyagi függetlenség? Nem kell választanod, mert kitartó munkával mindegyik elérhető . Csatlakozz a Moringa Life csapatához. Velünk és egy automatizált rendszer segítségével építsd fel saját üzleted.


Feladva: 2017-06-15    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekVezetőketfelAlizelérhetőpénzépítsdKádármindegyikegészségsegítségévelmunkávallegfontosabbrendszerkitartóSzámodraautomatizáltmertcomegy

Forrás: pepitahirdeto.multiapro.com

Munkásszállást keres? Országos adatbázisunkban megtalálhatja az Önnek megfelelőt! Megbízható, korrekt szállásszolgáltatóktól. Miért érné be kevesebbel? Minőségi szállásokat kínálunk munkásszállói árakon! Tiszta, komfortos, kulturált és olcsó szálláshelyeket kínálunk látogatóink számára. Az oldalon található országos adatbázis munkát vállalók számára biztosít lakhatási lehetőséget, de bázisként szolgálhat túrstaszállások kereséséhez is egyéb programokhoz, ideális, olcsó, igényes szállást ... további részletek >>

kereső turistáknak turistaszállásként. A legtöbb szállás kínálatában külön mosdó és televízió csatlakozási lehetőség, ingyenes WIFI található!


Feladva: 2016-10-17    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: olcsószámáraországostalálhatókínálunkMegbízhatómosdóTisztaIdeálismegfelelőtvállalókkülönárakonprogramokhozÖnnekmunkátkínálatábanmunkásszállóiWIFI

Forrás: pepitahirdeto.multiapro.com

Négy féle online platformról jövő jövedelemből részesülhet. Exponenciálisan növekvő kereset. Megbízható kifizetés. A ”Likes XL” már bizonyított- most toább fejlődik és aki aug . 12- ig taggá válik óriási előnnyel tud legális coinokhoz is jutni. 0.01centes kezdő árfolyam Bővebb információért jelentkezni: skype joe197238


Feladva: 2017-07-21    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8221fejlődikExponenciálisanjutninekedtoábbrészesülhetcoinokhozlehetőségmostjövedelembőllegálisbizonyítottjoe197238jövőtudmárskypeplatformrólaug

Forrás: pepitahirdeto.multiapro.com

Aranyszarvas Apartmanház! Szarvason a Történelmi Magyarország szívében található Aranyszarvas Apartmanház Étterem és Grill Terasz újra megnyitotta kapuit. Vendégeink számára biztosítjuk a felejthetetlen, élményekben gazdag kikapcsolódást és pihenést. Minőségi apartmanok, 100 méter széles vízpart, óriási medencék, jacuzzik, szaunák várják a pihenni vágyókat.


Feladva: 2017-09-09    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: AranyszarvasÉtteremApartmanházvárjákSzarvaspihenéstTeraszszaunákajánlókikapcsolódástGrilljacuzzikHirdetőgazdagmedencékPepitaélményekbenóriási100

Forrás: pepitahirdeto.multiapro.com

Cégünk tapasztalt emberei vállalják a nehéz tárgyak, berendezések, eszközök (gépek hűtők, klímák, jakuzik, zongorák, pianínók, egyéb nehéz hangszerek, stb.) szakszerű mozgatását, szállítását. Raktárainkban lehetőséget biztosítunk ügyfeleinknek, akár azonnal bútorok, eszközök, egyéb ingóságok rövidebb-hosszabb idejű elhelyezésére.


Feladva: 2017-10-03    [Lakossági szolgáltatás]

Címkék, kulcsszavak: eszközöknehézegyébtárgyaktapasztaltakárpianínókCégünkügyfeleinknekzongorákelhelyezéséreBudapestbiztosítunkjakuzikidejűCsacsitranszlehetőségetklímák

Forrás: pepitahirdeto.multiapro.com

Komplett házimozi, moziszoba, multiroom rendszerek építése! Próbálja ki otthonában · HáziMozi beállítás · Egyedi ajánlatok · Profi helyszíni telepítés Moziszoba tervezés-építés | Mark Levinson erősítők | Revel hangfalak | REL mélyládák | Arcam www.hazimozistudio.hu/szolgaltatas ok


Feladva: 2017-05-27    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: 183HáziMoziMoziszobatervezésPróbáljawwwépítéseArcamtelepítésrendszerekmélyládákhelyszínimultiroomRELProfiKompletthangfalakajánlóRevelajánlatok

Forrás: pepitahirdeto.multiapro.com

Klíma javítás, klímatelepítés - akár hűtésre, akár fűtésre -, karbantartás (gázzal feltöltés, gombátlanítás, fertőtlenítés), áthelyezés garanciával!!! Klíma telepítés 4m csőhosszig nettó 43.000 Ft! Minőségi klímakészülékeink: Panasonic, Nord, Samsung, Midea, Fisher, Fujitsu, Daikin


Feladva: 2015-04-01    [Lakossági szolgáltatás]

Címkék, kulcsszavak: klimaakárgaranciávalKlímaszerelés000wwwnettóDaikincsőhosszighűtésreFujitsutelepítésklímatelepítésFisherjavításMideaáthelyezéstólSamsungNord

Forrás: pepitahirdeto.multiapro.com

Imádom a 3 kutyámat, 4 éve élek velük panelban. A napi 3 kötelező séta miatt olyan, mintha főállás mellett még plusz 3 műszakban dolgoznék. Rohanni kell hozzájuk haza bárhonnan, bármit abbahagyva. Szakadó esőben és késő este is minden nap ugyanabban az időben kell levinnem őket. Elegem lett ebből az életvitelből. Ők is és én is jobbat érdemlek. Ez csak egy kertes házzal oldható meg, amire viszont jelenlegi állásomban esélytelen, hogy megkeressem a pénzt. Pont jókor hozott össze a sors a DXN ... további részletek >>

Ganoderma kávés online Network Marketing üzlettel: www.kavekiraly.hu/uzleti_lehetoseg Rólam bővebben itt olvashatsz: www.kavekiraly.hu/az_en_tortenetem Itt bizony kell dolgozni, szóval aki munka nélküli gyors meggazdagodást keres, ne nézze meg az oldalam!


Feladva: 2016-11-02    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kellmegIttkavekiralykávéshttplehetosegElegemkutyámathozottabbahagyvadolgoznioldhatóminthauzletiőketImádomoldalamjókorbármitházzalolyanegy

Forrás: pepitahirdeto.multiapro.com

Vásároljon első kézből a Devon fürdőszobabútorok magyarországi forgalmazójától, nagy és kiskereskedelmi kiszolgálás, kedvező ár! Fürdőszobabútoraink széles választékával várjuk önöket csepeli raktár áruházunkban. Bútoraink festett fényes fehér MDF előlappal rendelkeznek, lapraszerelt állapotban, karton dobozban kerülnek átadásra. www.majerszerviz.hu/furdoszobabuto r.html


Feladva: 2017-09-19    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: furdoszobabutorDevonválasztékávalkézbőlMDFszélesmajerszervizelsőfehérFürdőszobabútorainkwwwVásároljonfényeskedvezőátadásraajánlófestettkiszolgálás

Forrás: pepitahirdeto.multiapro.com

Komáromi János (Málca, 1890. december 22. – Budapest, 1937. október 7.) író, újságíró. Több tucat elbeszélés és regény szerzője. Sorozatcím: Komáromi János munkái gyűjteményes kiadás IV. Kiadó: Genius Könyvkiadó Rt. Kiadás éve: 1930 Kiadás helye: Budapest Kötés típusa: egészvászon Terjedelem: 233 Nyelv: magyar Méret: Szélesség: 13.00cm, Magasság: 19.00cm Kategória: Irodalom szépirodalom regény, novella, elbeszélés Dedikált, aláírt könyvek Antik könyvek ... további részletek >>


Feladva: 2017-04-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: KiadásBudapestgenius1930DedikáltelbeszélésnapokszepregénykirJánosKomáromi00cmkönyvekSzélességHirdetőaláírtTöbbMéretPepitaéveújságíróíró

Forrás: pepitahirdeto.multiapro.com

PSORATINEX Tisztító Gél 200 ml -es kiszerelésben Mikor ajánlott a készítmény alkalmazása? A psoriasis enyhe és középsúlyos, krónikus (stabil) formájában a tünetek (erythema, beszűrődés, parakeratosis, viszketés) csökkentésére, a száraz, hámló, pikkelyes bőr ápolására. Gyógyszernek nem minősülő gyógyhatású készítmény. A készítmény összetevőinek hatását szakirodalmi adatok igazolják. A készítmény két hatóanyaga: szalicilsav és kátrány emulzió.


Feladva: 2014-02-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: készítményGélTisztítóPSORATINEXerythemahatóanyagakiszerelésbenGyógyszernektünetekkét200ápolásáraformájábanbőrstabiligazoljákpikkelyeskrónikusnem

Forrás: pepitahirdeto.multiapro.com

Családi vállalkozásunk több évtizedes tapasztalattal áll mindennemű parkettás munkában Budapest és környéke lakosságának rendelkezésére. Pontos megbízható kivitelezés. Garancia munkáink a honlapon találhatók. Igény esetén szobafestő, mázoló, tapétázó szakembert tudunk ajánlani, akivel régi jó munka kapcsolatban állunk.


Feladva: 2017-01-05    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BudapestparkettaIgényBarabásmunkatalálhatókmunkábanlakkozásrégihonlaponparkettásakivelmunkáinkmindenneműcsiszolásajánlaniGaranciaálltudunktöbb

Forrás: pepitahirdeto.multiapro.com

Egysoros, kétsoros és háromsoros árazógép forgalmazás! Pénztárgép szalag minden méretben. Minden típusú gép javítása, kellékanyag ellátása. Ruházati kellékek, belövőpisztolyok, függőszálak, papírcímkék, kézi szálak értékesítése. Üvegre, tükörre is írható színes tollkészlet. A dátumnak a nap/hónap/év sorrendet kell követnie. Az élelmiszerek jelölésével a 19/2004. (II. 26.) FVM-ESzCsM-GKM együttes rendelet foglalkozik. Honlapunkról letölthető! Szerviz, javítás. Rendelésre ... további részletek >>

csomagküldő szolgálat. Vállalunk gépátalakítást is.


Feladva: 2017-06-27    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: MindenárazógépgépHonlapunkrólajánlókellszálaktípusúfoglalkozikHirdetősorrendetkéziegyüttesPepitahónappapírcímkékgépátalakítástméretbenrendelet

Forrás: pepitahirdeto.multiapro.com

A porckopás, más néven arthrosis, az ízületeket érintő betegség. Azoknak, akiknél a porckopás okozta problémák jelentkeznek, ajánlott glükozamint és kondroinint együttesen tartalmazó étrend-kiegészítő szedése, mely segít fenntartani a porcok rugalmasságát, vízzel való telítettségét, tápanyag ellátottságát, így védve az ízületeket a porckopástól. A Chondrosamin® az enyhe és középsúlyos esetekben, 2-3 hét alatt már képes a fájdalmat is csökkenteni. Javasolt évente több alkalommal ... további részletek >>

kúraszerűen megismételni a használatát. Tudjon meg többet: www.gyapjumarket.hu/spl/268919/Etrendkiegeszitok-taplalekkiegeszitok


Feladva: 2016-11-19    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: porckopásízületeketétrendarthrosisChondrosamincsökkenteniajánlottporckopástólmástöbbetfenntartanifájdalmatjelentkeznekDebrecenmegsegítképesvédve

Forrás: pepitahirdeto.multiapro.com

Már 24 féle hangulat-színváltós nyaklánc közül választhat a legjobb áron a Lili Bizsu Webáruházban www.lilibizsu.hu Házhoz szállítás már 650Ft-tól akár ingyenesen is


Feladva: 2017-10-22    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: színváltóshangulatBizsuLilimárszállításnyakláncHázhozlilibizsuwwwféleWebáruházbanWEBÁRUHÁZnyakláncokingyenesenakárárontóllegjobb650Ftközül

Forrás: pepitahirdeto.multiapro.com

Ez a vergődés ismétlődik már több éve hónapról hónapra? Változtasson rajta! Változtatás nélkül nincs változás! Ha nem változtat az életén, akkor mitől vár változást? Élni akarja az álmait vagy álmodni a céljait? Ugye nagyszerűnek tűnik, hogy hetente akár több ezer Dollárt is kereshet játszi könnyedséggel? Minden internetes munkával foglalkozó ember álma egy ilyen lehetőség, de a helyzet az, hogy az álom ez esetben mindenképpen csak álom marad. Több átveréssel is lehet találkozni az internetes ... további részletek >>

munka lehetőségek közt. Ha ilyen kétes kimenetelű ajánlatot keres, akkor csalódni fog. mert nem Önn ek szól. Munkát ajánlunk kiemelten magas fizetésért. Az okos ember előre gondolkodik, a buta a múltban él, és a még butább azt gondolja, hogy ha nem tesz semmit sem, akkor sokkal jobb lesz Neki! Sajnos ezért is sok család fog úgy élni, mint most, sok év múlva is, sőt sokkal rosszabbul! Ajánlat azoknak, akiknek komoly céljai vannak és olyan havi jövedelemre van szükségük, amelyből kényelmesen biztosíthatják családjuk megélhetését: / kb. 500.000,- / hónap / Pl: Első sorban több szabadidővel rendelkezők, kiskeresetűek széles kapcsolatokkal rendelkezők vagy több gyermekes családok, stb. Munkaidő: Heti 30 – 40 óra Egyedülálló, rendkívülien magas jutalékkal keresek olyan embereket, akik széleskörű ismeretséggel és kapcsolatokkal rendelkeznek! Jelentkezzen ha konkrét céljai vannak, mindenben segítek. Kérem, hogy az email címemen jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-05-08    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogytöbbnemakkorolyanélnivannakembercéljaimagasspórolvagyfogálombárrendelkezőkfizetésébőljelentkezzenilyenkapcsolatokkalsokkalvégéigjön

Forrás: pepitahirdeto.multiapro.com

Személyesen szeretném bemutatni a következő, megbízható és német precizitással gyártott ALOE VERA termékeket: Sminkek, Babaápolási termékek, Parfümök, Vitaminok, Ivógélek, Hajkondicionálók, Terhességi csík elhalványító krémek és sok minden más hasonlót! Pécsi helyszínen várlak előzetes egyeztetés után tájékoztató .ahol minden terméket kipróbálhatsz, tesztelhetsz saját magad teljesen INGYEN! Ha kérdéseid lennének, keress bátran az alábbi elérhetőségeken!


Feladva: 2016-12-27    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: VERAALOEmindenlennénektermékekettájékoztatóPécselhalványítókérdéseidutánÉvacsíkINGYENegyeztetésPétermannTerhességiteljesengyártottelőzetesmagad

Forrás: pepitahirdeto.multiapro.com

Irodák, lakások napi, heti, havi takarítása, nagytakarítás, biotakarítás, igényes egyedi munkavégzéssel, profi személyzettel, gépekkel. Kárpit, szőnyeg, padlószőnyeg tisztítás profi extrakciós géppel. Cégeknek, magánszemélyeknek, mindenkinek. Igényes, precíz munkavégzés, korrekt árakon. További szolgáltatásainkról érdeklődjön honlapunkon, vagy telefonon. REND A LELKE MINDENNEK!


Feladva: 2016-01-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: IgényesprofiRENDlakásokgépekkeltelefononIrodákmindenkinekszemélyzettelvagyPécsmagánszemélyeknekmunkavégzésselhonlapunkonKftCégeknekegyedigéppel

Forrás: pepitahirdeto.multiapro.com

Nem érzed magad biztonságban? Úgy érzed veszélyben van az életed? Van megoldás!!! Egy különleges harcművészet. A leghatékonyabb önvédelmi technikák. Az alapok 6 hónap alatt elsajátíthatóak. A támadó erejét használd fel a győzelemhez! - Önvédelmi tanácsok - Utcai szituációk kezelése - Jogtalan támadások elhárítása - Pszichikai felkészítés Ne legyél áldozat!


Feladva: 2017-09-26    [Sport - Kemping - Túra]

Címkék, kulcsszavak: BajaÖnvédelmiVanönvédelemérzederejétmegoldástámadásokNemtámadó06304670677JogtalanBajánelsajátíthatóakInfoválságindulkezelésealattvégéighónap

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés a Konténer Gurutól telefonon és emailben is lehetséges! Hívás előtt az egyik legfontosabb kérdés, hogy hova szeretné elhelyezni a konténert! Vizsgálja meg, hogy befér-e a kapuján vagy csak az utcán marad-e hely a lerakásához. Ez utóbbi esetben ugyansi lehet, hogy területfoglalási engedélyre lesz szükség, ami módosíthatja a leszállítás időpontját. A konténer rendelés a főváros valamennyi kerületébe és Pest megye több településére is lehetséges még hétvégén is. Ha lomtalanítást ... további részletek >>

tervez, hívjon még ma, hogy a feleslegessé vált holmik ne az út szélén végezzék! Kérdések és válaszok konténer rendelés előtt weboldalunkon!


Feladva: 2017-08-16    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: konténerhogyrendelésméglehetségeselőtttervezkonténertidőpontjátKittiválaszokutóbbilomtalanítástelhelyeznileszállításKellérKérdéseklerakásáhozami

Forrás: pepitahirdeto.multiapro.com

Fashion Plus divatos női ruha webáruház, naponta bővülő divatos női ruha kínálattal, és akciókkal ajándékozza meg látogatóit. Napi Fashion Plus divat tippek a divatos női ruha webáruház kínálatát felsorakoztatva kiegészítőkkel és szép divatfotókkal, a legjobb divat tippeket nyújtja a divat és női ruhák szerelmeseinek. Női ruhák és alap darabok, pulóverek, pólók, divatos nadrágok, divatos szoknyák, kabátok és kiegészítők bő választéka!


Feladva: 2016-10-29    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: NőidivatosruhadivatPlusFashionruhákwebáruházdarabokkiegészítőkkelajándékozzaalapfelsorakoztatvaakciókkalkínálatátválasztékakínálattalkiegészítők

Forrás: pepitahirdeto.multiapro.com

Tisztítást igényel valamilyen felületen, de nem tudja, hogy mivel végezze el? Kérdezzen, segítünk. Speciális tisztítószerekkel állunk rendelkezésére. Tisztítószer és mosószer közvetlenül a magyar gyártótól, termelői és viszonteladói áron. Kérjen termékismertetőt! Érdeklődni: 06-30-8531179


Feladva: 2014-02-17    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: miveltudjanemrendelkezésérefelületentermékismertetőtállunkvalamilyenKérjentisztítószerekkeligényeláronSpeciálisTisztítástviszonteladóisegítünkker

Forrás: pepitahirdeto.multiapro.com

Jelentkezz haladó webprogramozó képzésünkre, melynek elvégzése után cégünknél akár azonnal munkába tudsz állni webfejlesztőként! Emelt szintű, gyakorlatias képzés PHP, MySQL, Javascript, HTML5 nyelveken, OOP keretrendszerek használatával. Részletek: www.szhweb.hu/kepzes/halado-webpro gramozo/ A haladó képzés jelentkezési feltétele valamilyen webes szakirányú előképzettség. A tanfolyam díja akár 100%-ban visszakapható!


Feladva: 2017-01-12    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: képzéswebprogramozóhaladóakárszhwebRészletekEmeltwebeshasználatávalwebfejlesztőkéntJelentkezzvalamilyenkeretrendszerekállniKomlófeltételeOOPtudsz

Forrás: pepitahirdeto.multiapro.com

Elhunyt szerettei fotóját megörökítő porcelán plakettek. Fénykép alapján porcelánfestékkel készülnek, 80 °C felett beégetve, kopásálló felülettel és fotó minőségben. Plakettek nagy forma és méretválasztékban! Sürgősséggel akár 2 nap alatt is elkészül a sírkőkép és már a ravatalozáson is ott lehet.


Feladva: 2016-01-04    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: PlakettekporcelánkészülnekBudapestméretválasztékbanporcelánfestékkellehetDekormániaformaalapjánottfényképesnagyFényképravatalozásonragaszthatómár

Forrás: pepitahirdeto.multiapro.com

Zeneszeretõ - Bakelit rajongók figyelmébe! Az Audió Design Studió hosszú évek óta foglalkozik hangrestaurálásal. A stúdió vállalja minden tipusú hanganyag rendbe hozatalát, archív hangzók feljavítását ujra masterelését. Bakelit lemezek, kazetták, professzionális szinten történõ átirása, zajmentesítése az az, a hangzó anyagok restaurálása, digitális technológiával úgy , hogy a kész anyag megegyezzen az eredeti hangzással. Ne hagyja, hogy kincsei kárba vesszenek!


Feladva: 2017-10-09    [Zene - Hangszer]

Címkék, kulcsszavak: stúdióDesignBakelithogy245anyagévektörténátjátszáshozatalátkészhosszúszintenhangjavításrendbeúgyprofesszionálisDigitalizálásvesszenekhanganyag

Forrás: pepitahirdeto.multiapro.com

Weboldalak üzemeltetőjeként és keresőmarketingesként biztosan kijelenthetem, hogy az internetre tartalmakat elhelyezők döntő többsége egyáltalán nem foglalkozik azzal, hogy amit készít, az megjelenjen - például a Google - keresésekben! Végeztem egy saját felmérést, ami alapján úgy tűnik, van egy általános elképzelés arról, hogy ez a kereshetőség vagy: - magától megtörténik - nem a tartalom készítőjének a feladata - a szolgáltató dolga a kereshetőség biztosítása A válaszok alapján ... további részletek >>

megdöbbentem, de ezek után egyáltalán nem csodálkozom sokak internetes eredménytelenségén... Nem szeretnék játékrontó lenni, tehát a Pepita Hirdető szabad felületei változatlanul elérhetőek lesznek még a játszadozóknak is. Azoknak azonban, akik már a játszadozáson túl vannak, jó pár lehetőséget kínálhatok ingyenesen is és több-kevesebb befektetéssel egyaránt. A legkomolyabbaknak maximum 30.000 Ft éves költséggel! Automatákkal nem, automataként viselkedőkkel szintén nem, viszont azokkal, akik jó kereshetőséget szeretnének webtartalmaiknak szívesen beszélgetek, levelezek! Fentiek alapján ez NEM FELHÍVÁS hirdetés feladására, az legyen tudatos és tervezett inkább...


Feladva: 2017-05-30    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: NEMalapjánhogyegyakikegyáltalánHirdetőPepitavagykereshetőségtudatospárdolgainternetrewebtartalmaiknakelérhetőekáltalánosbetűkkelévesinternetes

Forrás: pepitahirdeto.multiapro.com

Alumínium zsalugáterek készítését vállaljuk — A FEMARKZSALU Kft új szolgáltatása: ajtó- és ablakzsaluk készítése alumíniumból. A számos variáció közül ajánljuk a védő zsalugátereket (biztonsági és nem biztonsági) típusban. Kérje ajánlatunkat méret szerint! www.femarkzsalu.hupont.hu/9/alumin ium-zsaluk-keszitese


Feladva: 2017-04-04    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: biztonságiKftFEMARKZSALU8212közülvállaljukszerintvariációkészítésétméretszámoszsalugáterekajánlatunkatalumíniumbólAlumíniumKérjekészítésetípusban

Forrás: pepitahirdeto.multiapro.com

Angol - igény szerint, minden szinten: - nyelvoktatás, korrepetálás, kiegészítő tanítás, - szintentartás, felzárkóztatás, - felvételire, nyelvvizsgára, érettségire, állásinterjúra, pótvizsgára, osztályozó vizsgára felkészítés, - tanulócsoportok mentorálása, konzultáció, - fordítás, - online tolmácsolás (előre egyeztetett idópontban) - az angol nyelvhez és kultúrterülethez tartozó témában célirányos felkészítés Tanítási módszerem: részletes magyarázat, stabil elméleti ... további részletek >>

alapok, házi feladat, gyakorlatorientáltság Óradíj és Fizetés: tanóra: 2700 Ft/50 perc fordítás, tolmácsolás: megegyezés szerint fizetés módja: átutalással bankszámlára Számlaképes vagyok. Rugalmas időbeosztással várom a tanulni vágyókat! A rendszeresség az egyik legfontosabb a nyelvtanulás során. Elfoglalt vagy? Sok a dolgod? Nem probléma: a tanóra időtartama megegyezés alapján akár 20 perc is lehet (ennek megfelelő árral)!


Feladva: 2017-04-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: angoltanórafizetésszerinttolmácsolásfordításpercfelkészítésmegegyezésidőtartamaalapokkorrepetálásegyikkultúrterülethezmódjaosztályozóelméletistabil

Forrás: pepitahirdeto.multiapro.com

A bárányhimlő felnőttkorban súlyos szövődményeket okozhat, terhes nőkre nézve pedig különösen veszélyes, mert maradandó károsodást okozhat a magzatnak. A bárányhimlő lefolyása után a szervezet immunis lesz a vírusra, így aki egyszer már elkapta, többet nem fog szenvedni a betegségtől. Főként a téli és a tavaszi hónapokban terjed, lappangási ideje 2-3 hét, ezután jelentkeznek a bőrön a piros pöttyök. Mit tegyünk bárányhimlő ellen? Bárányhimlő ellen sokféle gyógymód létezik, általában csak a ... további részletek >>

tüneteket kell kezelni, azaz a viszketést csillapítani, mert az elvakart hólyagok heget hagyhatnak maguk után.


Feladva: 2016-10-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BárányhimlőutánmertellenokozhatterjedfelnőttkorbanazazmártegyünkkárosodásthónapokbanKittikezelniegyszerMitmaradandótavasziKellérkellakitéli

Forrás: pepitahirdeto.multiapro.com

Modern és klasszikus olasz gyerekbútorok prémium kivitelben. Számtalan színből és elemből válogathat. Látogasson el üzletünkbe. 1093 Budapest Közraktár utca 20./a Telefon: 061-215-33-74


Feladva: 2017-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: olaszwwwBudapest1093klasszikusmatracfutarüzletünkbeModernLátogassonBútoráruházlineaflexbutorválogathatLineaflexwebelembőlgyerekbútor215színből061

Forrás: pepitahirdeto.multiapro.com

20 éves tapasztalattal vállalunk magas minőségben kárpittisztítást Budapesten. Igény estén az Ön otthonában szakszerűen megtisztítjuk padlószőnyegét, ülőgarnitúráját. Irodai szőnyegek tisztításában nagy gyakorlatunk van. Bármilyen kárpitos felület tisztítását vállaljuk, amit lehet vizes-mosószeres módon tisztítani. A textilek több, mint 90 %-a tisztítható. Nagy rutinunk van folteltávolításban. Leragasztott padlószőnyeg tisztítást német technológiával és gépekkel végezzük. Rágógumit ... további részletek >>

nyom nélkül ki tudunk venni!! Autó kárpittisztítás-t is a megadott helyszínen végezzük el. Irodai székek és ágybetétek tisztítását is vállaljuk. A tisztítást kérheti szerint magas tisztítóhatású BIO minősítésű szerrel is!


Feladva: 2017-01-21    [Lakossági szolgáltatás]

Címkék, kulcsszavak: minőségbenmagasvállalunktapasztalattalévesBudapestJánosUjlakikárpittisztításBudapestenProfikárpittisztítást

Forrás: pepitahirdeto.multiapro.com

Kellemes környezetben, elérhető áron, apartmanként működő családi ház kiadó Gyulán. A szálláshely felszerelt konyhával(mikró, hűtők, tea-, kávéfőző, szendvicssütő, kenyérpirító, edények) rendelkezik. A szobákban TV. A kertben lehet grillezni, bográcsozni, szalonnát sütni, az ehhez szükséges eszközök biztosítva vannak. Az udvarban ingyenes, zárt parkolási lehetőség. A gyulai Várfürdő öt percre van a szálláshelytől.


Feladva: 2016-08-12    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: Gyulánkiadóparkolásiapartmankéntbográcsoznihűtőkzártárongrilleznimikróingyeneselérhetőlehetkonyhávaludvarbankörnyezetbenkertbenfelszereltvannak

Forrás: pepitahirdeto.multiapro.com

Tradicionális thai masszázskezelés Budapesten a 13. kerület szívében. Az eredeti thai masszázs kezelés enyhíti fáradtságát, csillapítja fájdalmát és segít visszaszerezni frissességét. Serkenti, nyugtatja a lelket és a testet.


Feladva: 2017-03-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BudapestthaiSmilekerületthgaitradicionálisMasszázsszalonMasszázsszívébenBudapestenmasszázskezelés

Forrás: pepitahirdeto.multiapro.com

Új Kocsik Érkeztek!!! Most Több Darabból Választhat! Téliesített, Kiváló Állapotban Lévő Büfékocsi Berendezéssel Együtt Kiadó! Rendelkezik a szükséges szakhatósági engedélyekkel, személyautóval, B-s jogosítvánnyal kényelmesen vontatható, azonnal munkára fogható! A bérléshez 1 havi bérleti díjnak megfelelő kaució szükséges! Külföldi használat esetén a bérleti díj havi 400,- Euró, a kaució pedig Magyarországtól való távolságtól függ! Egész Szezonra Történő Bérlés, és előre fizetés esetén ... további részletek >>

díjkedvezményt biztosítunk! Büfékocsi Kölcsönző Eger, A Legjobb Feltételekkel!!! Nyitva: H-P: 08-16:30; SZ: 08-12; V: Zárva Kérem a fenti időpontokban érdeklődjenek!!! Kérem tekintse meg honlapunkat!


Feladva: 2016-10-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BüfékocsibérletiKölcsönzőKéremszükségeseseténkaucióBérléshaviEgerEgészÁllapotbanmegkényelmesenfüggKiválótekintsehasználatjogosítvánnyalKülföldi

Forrás: pepitahirdeto.multiapro.com

Csendes, nyugodt környéken, jól felszerelt (kábel TV, mikró, klíma, komplett konyha 5 és 6 férőhelyes (szükség esetén pótágyazható), panorámás apartmanok kiadók egész évben. Az apartmanok külön bejáratúak, de szükség esetén egybenyithatók. Főszezonban csak hetes turnusokban bérelhetők! Internet hozzáférési lehetőség ingyen. skype.zsebikem SZÉP-Kártya elfogadóhely.


Feladva: 2016-04-28    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: zsebikemeseténszükségillapartmanokelőnyugodtFőszezonbanházpótágyazhatóCsendesegybenyithatók15000férőhelyesskypeBalatonalmádiapartmankonyhaingyen

Forrás: pepitahirdeto.multiapro.com

Az Ozeki Informatikai Kft. programozás iránt elhivatott egyetmi hallgatóknak kínál diákmunka lehetőséget. Szakmai gyakorlat feltételei: - Nappali tagozatos hallgatói jogviszony - Programozó informatikus, Mérnök informatikus szakon folytatott felsőfokú tanulmányok - Kötelező tárgyak teljesítése (teljesítési igazolás, leckekönyv másolata) A jelentkezés módja: a job@ozek i.hu email címünkre küldött fényképes önéletrajzzal és jelentkezési adatlappal lehet. www.jobs.ozeki.hu/index.php?owpn=7 4


Feladva: 2017-03-24    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: KftgyakorlatSzakmaiOzekiDebreceninformatikusjelentkezésikínáligazolásProgramzóProgramozóönéletrajzzalhallgatóknakteljesítésijogviszonyfényképesiránt

Forrás: pepitahirdeto.multiapro.com

Könyvelés és bérszámfejtés kedvező áron Angyalföldön a Full Active Bt. könyvelőirodában. Egyéni vállalkozások és társas vállalkozások könyvelése kedvező áron. SZJA bevallás magánszemélyeknek kedvező áron. Könyvelését bízza hozzáértőkre! Visszamenőleges könyvelést is vállalunk. Ha bármilyen kérdése lenne könyvelés ügyben, keressen minket bizalommal. Tel: 412-08-06, Fax: 412-08-07


Feladva: 2015-01-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: áronkedvezőkönyvelésActiveFullAngyalföldönbérszámfejtés412vállalkozásokhozzáértőkreEgyéniminketbízzakönyvelőirodábankeressenKönyvelésétügybenlenne

Forrás: pepitahirdeto.multiapro.com

Miért válassza a mi utazási irodánkat? Mert... - 80 utazási iroda ajánlatait találja nálunk! Foglaljon egy helyen azonos feltételekkel Mert... - 27 éves vállalkozás vagyunk! Megbízható, 100% magyar tulajdonban Mert... - Tapasztalt kollégák segítenek a választásban. Gyors és szakszerű ügyintézés Mert... - Online foglalhat, minden kötelezettség nélkül Folyamatosan frissülő akciós ajánlataink: www.telen-nyaron.hu/utazas/utazaso k/promo/akcios-utak.html


Feladva: 2017-07-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: MertutazásitelenirodatulajdonbanutazasFoglaljonfoglalhatPepitamagyarnyaronnálunkOnlineMinute100találjaLastMegbízhatówwwajánlataitügyintézés

Forrás: pepitahirdeto.multiapro.com

24 h ápoló/háztartásvezető állásunk van LANDSHUT-ban, a család a munkáltató. Idős otthonos ÁPOLÓ-i állásaink BAJORORSZÁGBAN vannak, feltétel eü. végzettség. Az AMBULANTE mobil ápolói állásunk FRANKFURTBAN van eü. végzettséggel és jogosítvánnyal rendelkezők részére. A szállás mindhárom helyen megoldott. Némettudás szükséges szintje állástól függően A2-től B1-B2-ig. További infók a www.nemetmunka.hu/apolo.html weboldalunkon, ahol regisztrációs lehetőség is van. Érdeklődni munkaidőben a ... további részletek >>

+36 1 920 3433 budapesti, vagy a +49 8641 6949 000 német vezetékes számokon lehet. Várjuk jelentkezését! Német Munka Team


Feladva: 2017-02-10    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: vanMunkaNémetÁPOLÓállásunkTeamszámokonjogosítvánnyalállásainkállástólvezetékesvégzettséggellehetőségszintje000FRANKFURTBANregisztrációsIdősotthonos

Forrás: pepitahirdeto.multiapro.com

A szem alatti karikák eltüntetése házilag eddig nem volt lehetséges. Exkluzív kezeléseken kellett részt venni annak, aki professzionális módszereket szeretett volna igénybe venni. A Byas azonban ezt otthon is elérhetővé tette bárki számára. A szem alatti sötét karikák eltüntetése mostantól házilag is lehetséges! Ez maximális hatékonyságot garantáló készülék magunkkal is vihető, hogy bárhol járunk, percek alatt üdévé, frissé varázsolhassuk tekintetünket. A magabiztosságba többé nem csúszhat hiba! ... további részletek >>

A szem alatti karikák, táskák és ráncok ellen a Byas Eye Lifter a hyaluronsav erejét veti be.


Feladva: 2017-07-17    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: alattiszemeltüntetésekarikáknemByasráncoklehetségesházilagvennibárholvoltLiftervolnahogyeddigEyesötéttöbbészeretettvihetőKittiszámára

Forrás: pepitahirdeto.multiapro.com

Budapest első fogyatékossággal élő emberek által alapított kávézója. A kávézóban dolgozó csapat nagyon színes és nagy szeretettel vár minden látogatót. Egy pár szó rólunk: www.nemadomfelkavezo.hu/rolunk.php


Feladva: 2016-10-06    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: nagyfogyatékossággalszíneselsőnagyonBudapestcsapatStevedolgozókávézókávézóbanfelkávézójaadomlátogatótalapítottNemmindenáltalváremberekélő

Forrás: pepitahirdeto.multiapro.com

Építés, felújítás, kőműves munka terén biztosan számíthat ránk. Az Épelem Bau Kft vállalja minden építés, felújítás és kőműves munkával kapcsolatos feladatot, akár kulcsrakészen, akár rész munkafázisként. A cég több mint 12 éve panaszmentesen működik, a minőség pontosság és megbízhatóság jegyében. Kérjük látogasson a www.epelembau.hu honlapunkra. Köszönjük megtisztelő bizalmát!


Feladva: 2016-10-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kőművesfelújításépítésÉpelemmunkaKftakárBaukulcsrakészenmegtisztelőminőségfeladatotKöszönjükránkműködikkapcsolatoshonlapunkraszámíthatmunkával

Forrás: pepitahirdeto.multiapro.com

Itt az idő, az ablakcsere ideje. Vásárolja Ön is nyílászáróját nagykerből 48% kedvezménnyel! Rendelje meg most ablakait és ajándékba adjuk az egyik ablakra a redőnyt vagy szúnyoghálót! (250000 Ft feletti rendelés esetén) IGLO5, IGLO5 CLASSIC •5 kamrás, •70 mm beépítési mélységű, •2x külső EPDM gumitömítéssel, •alap üvegezése 4/16 Ar/4 Low-e thermofloat üveggel, argon gázzal töltve, •Uw=0.92 W/m2K, •EN-674 szabványnak megfelelően, •MACO MULTI ... további részletek >>

MATIC KS vasalattal, •Lehetőség változó vastagságú üveg beépítésére Redőny, szúnyogháló, reluxa kedvező áron, rövid határidővel! További 5% kedvezmény nyugdíjasoknak és egyedülálló 2 vagy több gyerekes családoknak Látogasson el weboldalunkra, ahol részletes leírást talál termékeinkről. 2017. május 1-31. között regisztráló felhasználóink között ajándékokat sorsolunk ki, amelyet megrendelésével együtt szállítunk! Ajándékok: Hoppe Secustic kilincs 3 megrendelőnk minden ablakára, amelyet tőlünk rendel, Aereco légbevezető 5 lakásba, amelybe tőlünk rendelik a nyílászárókat.


Feladva: 2017-05-02    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 8226vagyRedőnyAblakamelyetközötttőlünkIGLO5MULTIablakaitmájusLowEljöttamelybetöbbeseténHoppeszúnyoghálóMACOmost2017üvegezéseBudapestmeg

Forrás: pepitahirdeto.multiapro.com

Minőségi 4-8 tojásos leves és köret tészták kaphatók, megrendelhetők. A termékek hagyományos összetétellel, de modern technológiával készülnek! 100% Magyar Termék!


Feladva: 2016-10-10    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: kaphatókTerméktésztákMagyarköret100leveskészülnektojásostechnológiávalMinőségimodernKondorosösszetétellelkondorositesztahagyományosgyártótól

Forrás: pepitahirdeto.multiapro.com

----Pick téliszalámi reklám áron! ---- Pick eredeti téliszalámi ára : 4390 Ft/kg Herz eredeti téliszalámi ára : 4390 Ft/kg Csongrádi füstölt kolbász ára : 1190 Ft/kg Pick paprikás szalámi ára : 990 Ft/db ---- Budapest XI. Bocskai út 42 sz. ----- ---- Telefon: 061/3611-609 ---- Web: http://www.lazarhus.hu Email:lazarhusmintabolt@gmail.com< /a>


Feladva: 2016-08-16    [
Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: áraPicktéliszalámiLázár4390Budapesteredetiszalámi1190Hús3611kolbász061füstöltárakTelefonCsongrádicomHúsboltBocskailazarhusmintabolt@gmail

Forrás: pepitahirdeto.multiapro.com

Professzionális airbrush munkák, képek, grafikák laptopra, bukósisakra, gépkocsira, motorkerékpárra, falra, stb... akár hozott fotóról, vagy egyedi elképzelés alapján. Portré vagy házi kedvenc, esetleg fantáziaképről legyen szó, egyaránt megvalósítom.


Feladva: 2015-01-19    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: képekairbrushvagygrafikákszófotórólmunkáklegyenhozotthupontfantáziaképrőlakárgrafikakProfesszionálisesetlegstbairbrushkepekZoltánkedvencfalra

Forrás: pepitahirdeto.multiapro.com

Az MS-METAL KFT. tevékenysége közé tartozik különböző acéltermékek, fémtömegcikkek gyártása, valamint ezen termékek értékesítése. Megrendelőink igényei alapján gyártunk különböző stancolt, hajlított vagy görgőzött, hegesztett lemezalkatrészeket, különböző polcokat, polcszerkezeteket, állványszerkezeteket, fali síneket, fali tartókarokat, valamint raktártechnikai elemeket és egyedi acéltermékeket. A gyártott termékek vasfoszfátos alapozással, elektrosztatikus vagy tribosztatikus porlakk ... további részletek >>

bevonattal készülnek. Termékeink segítségével minden tárolási probléma gyorsan és egyénileg megoldható. Tevékenységünk közé tartozik az álmennyezeti elemek gyártása és értékesítése, mely mind beltéren, mind kültéren használható. A méretválasztékból a kombinációs lehetőségeket kihasználva minden igényt kielégítő polcrendszer állítható össze, legyen az irodában, lakószobában, gyerekszobában, kamrában, garázsban. Ha vásárolni szeretne, válasszon webshopjaink közül!


Feladva: 2016-12-31    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: mindenkülönbözőközévalamintvagymindfaliértékesítésetermékekgyártásatartozikelemeketpolcszerkezetméretválasztékbólhegesztettporlakktevékenységePolc

Forrás: pepitahirdeto.multiapro.com

Aszfaltozás, útépítés A-Z-ig már 10 m2-től!!! Az ország egész területén a legolcsóbban! Kézi és gépi aszfaltozás egyaránt. Cégeknek, hivataloknak és magánszemélyeknek is! Tevékenységeink: - telephelyek, utak, terek, parkolók, gépkocsi bejárók, járdák, kerékpárutak építése - aszfaltozása - kátyúzása - térkövezése - betonozása Csarnokok, magtárak, minőségi kivitelezés olcsón, rövid határidővel, garanciával! Hívjon bizalommal, készséggel várunk minden érdeklődőt!


Feladva: 2017-01-25    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: aszfaltozásútépítésáronAkciósvárunkKézicsarnokokBetonútterekkészséggellegolcsóbbanbetonozásaAszfaltUtakbizalommalegésztérkövezéseJozeftelephelyek

Forrás: pepitahirdeto.multiapro.com

Bontott kisméretű tégla 75 Ft/db Országos kiszállítás! www.bontott-tegla.co.hu


Feladva: 2016-09-12    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: teglabontottkisméretű75FtÉrdKöveswwwkiszállításOrszágos

Forrás: pepitahirdeto.multiapro.com

Eladó, megfelelő ajánlat esetén kiadó az egész évben nyitva tartó, 650 m²-es Pelcz Apartmanház! Befektetésre is ajánlott! A Balatontól 150, a városközponttól pedig mindössze 200 m-re fekszik. A házban 8 db apartman található, mindegyik külön bejárattal és fedett terasszal rendelkezik. Apartmanjainkban egy időben legfeljebb 38 vendég elszállásolására van lehetőség. Főszezonban csak egész hetekre, szombat délutáni érkezéssel és szombat reggeli távozással fogadunk vendéget.


Feladva: 2016-02-13    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kiadószombatApartmanházEladóPelczegészvankülöntávozássalBalatontólelszállásolásáraeseténmindegyikreggeliajánlottvendégajánlattalálhatólegfeljebb

Forrás: pepitahirdeto.multiapro.com

FŐ-TEHERTAXI, budapesti tehertaxi szolgáltatás. Teherszállítók, fuvarozók, költöztetők, bútorszállítók, rakodók. Fuvarosok Budapesten, házhoz szállítás akár azonnal. Pianínó, páncélszekrény szállítók.


Feladva: 2015-09-13    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: tehertaxiBudapest06309404757bútorszállítókbútorszállításszállítókköltöztetőkfuvarozáspáncélszekrényfuvarozókPianínóTeherszállítókazonnalszolgáltatásakár

Forrás: pepitahirdeto.multiapro.com

Tökmagolaj eladó. Igazi, 100%-os stájer technológiás tökmagolaj a termelőtől. - 1 liter 4300 Ft. - 0,5 liter 2200 Ft. Bővebb információ honlapunkon: www.balogholaj.hu/tokmagolaj


Feladva: 2017-03-28    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: tökmagolajlitertechnológiásbalogholajstajerhttp100honlapunkonIgaziinformációeladóBővebbKerkabarabás2200FtPéterBalogh4300Fttermelőtől

Forrás: pepitahirdeto.multiapro.com

Szállítás, költöztetés, árufuvarozás és minden más egyéb, ami belefér egy 1.5 t-ás Mazda dobozos kisteherautóba, azt korrekt, áfamentes fuvarköltséggel elszállítja Önnek a Thomka Trans fuvarozó cég. Hívjon bizalommal, akár hétvégén is!


Feladva: 2017-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: fuvarozásThomkaköltöztetésSzállításHívjonkorrektmáscégaztmindenfuvarozóautóbacomTransteheherárúwordpresskisthomkatransönnekdobozoshttpGöd

Forrás: pepitahirdeto.multiapro.com

Betűvésés Budapest. Szimbolikus és spirituális faragott és fényezett kő dísztárgyak. Garantáltan egyedi kézműves alkotások Dunai görgetek kövekből! Hozhatja a saját kövét is!


Feladva: 2016-04-24    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: BudapestDunaiGarantáltandísztárgyakkövétfényezettsajátfaragottHozhatjaspirituáliskövekbőlSzimbolikusgörgetekBetűvésésalkotásokViktorkézműveskövek

Forrás: pepitahirdeto.multiapro.com

A látás egyik legnagyobb értékünk. 6 féle olyan gyakorlatot tanulhat meg, aminek otthoni ismétlésével javítani, tudja saját és családja látását. A gyakorlatok könnyen megtanulhatók és együtt ismételheti az egész család. Időpont egyeztetésért, bővebb információért hívjon a 06-30/907-47-86 telefonon. Életmód Stúdió - www.eletmod-debrecen.hupont.hu/36/ a-latas-helyreallitasa-termeszetes- uton


Feladva: 2017-09-17    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: debrecengyakorlatokhelyreallitasagyakorlatotinformációértlátásátlatasolyanbővebbcsaládjahupontféleegyeztetésértsajátértékünkIdőponttudjaeletmod

Forrás: pepitahirdeto.multiapro.com

Figyelmedbe ajánlom, ha passzív jövedelem forrást keresel!


Feladva: 2017-10-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: firstcoinforrástjövedelempasszívajánlomFigyelmedbeCsabanhelyvalutájadigitáliswwwjövőhttpkeresel

Forrás: pepitahirdeto.multiapro.com

Egyedi, megnyugtató környezetre vágyik? Színes hétköznapokra és egy kis romantikára? Vigyen az életébe egy csipetnyi csodát led csillárokkal! Kényelem a távirányító használatával és megannyi szín, mintázat, egyedi és különleges formavilág! Nézze ezt a fénytörést, mint valami varázslat… Energiatakarékos, színváltó led csillárok automata fényerő szabályozással, ajándék távirányítóval és garanciával!


Feladva: 2013-10-27    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: csillárokWebáruházledkülönlegesegyCsodafényegyedifénytöréstKényelemvágyikfényerőeztcsillárokkalkörnyezetreautomataNézzecsodátmegnyugtatócsipetnyi

Forrás: pepitahirdeto.multiapro.com

A Wilson Burn széria a 2017. évi tavaszi szezonra teljesen megújult mind anyagában, mind külső megjelenésében. A széria három tagja (95 CV, 100 CV, 100S CV) új megerősítést kapott a Countervail technológia révén, amelyet félévvel korábban a Blade szériánál mutatott be először a Wilson. Az ütők megjelenése is harmonizál a Blade és Pro Staff ütők színvilágával, ami minimál dizájnt jelent, fekete alapszínnel, tiszta vonalakkal és matt festéssel. Az ütőket a szériákra jellemző szín teszi ... további részletek >>

megkülönböztethetővé a többitől, így a Burn ütők messziről felismerhetők a feketébe ágyazott narancsszínükkel. A Burn széria teniszütői az alapvonal játékosok számára készülnek, akik nagy erővel hátulról játszva ütik a labdát, s ezzel tartják ellenfelüket folyamatosan nyomás alatt a mérkőzés utolsó pillanatáig. www.lhsport-shop.hu/tenisz/teniszuto/wilson-burn-95-cv-teniszuto


Feladva: 2017-04-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: burnwilsonütőkszériateniszutomindBlade2017PepitaakikStaffmesszirőlrévénfolyamatosanmattkészülnekProtechnológiaanyagábanellenfelüketvonalakkal

Forrás: pepitahirdeto.multiapro.com

Egy falat Székelyföld, egy falat hagyomány, egy falat egészség. Boltunkban megtalálják a legfinomabb székely kézműves élelmiszereket. A Székely Falat kiváló füstölt hústermékeit, a madarasi, székelyszentléleki és torockói sajtokat, házi vajat, Szász Illyés méhészetéből kikerülő havasi bio mézeket és egyéb mézkülönlegességeket, Gáll Erzsébet házi lekvárjait és szörpjeit, az Ábel székely mustárt, a Csíki áfonyát, a Hargita Gyöngyét és számtalan egyéb székelyföldi manufaktúrákból kikerülő terméket


Feladva: 2015-10-24    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: FalategyszékelyegyébházikikerülőÁbelLászlóIlyésmanufaktúrákbólélelmiszereketszörpjeitBagiSzászszékelyföldikézműveslekvárjaitboltvajatErdélyi

Forrás: pepitahirdeto.multiapro.com

Sporthálót gyártótól! Mindenféle sporthálót gyártunk minőségi anyagból, kézilabda, futball, röplabda, hoki, kosárlabda, teniszháló, célzó fal, labdafogó háló, védőháló és egyedi kérést is kielégítünk.


Feladva: 2017-01-11    [Sport - Kemping - Túra]

Címkék, kulcsszavak: sporthálótMindenféleteniszhálógyártótólkosárlabdaBékéshokiKonstantinkielégítünkröplabdaDumakéréstfutballSporthálóegyedikézilabdavédőhálóanyagból

Forrás: pepitahirdeto.multiapro.com

Könyvelés - Cégalapítás - Székhelyszolgálat Hosszított esti és hétvégi elérhetőséggel állunk Ügyfeleink rendelkezésére. Jelenlegi és leendő partnereinkkel a kölcsönös és feltétlen bizalmon alapuló baráti és üzleti kapcsolatra törekszünk, hiszen ebben a szakmában ez elengedhetetlen. Kft, Bt könyvelése 7.000 Ft-tól Egyéni vállalkozó könyvelése 6.500 Ft-tól Székhelyszolgálat 4500 Ft-tól Cégalapítás 19.990 Ft-tól Célunk, hogy az Ön számára is hasznos segítség lehessünk ... további részletek >>

mindennapjaihoz. Reméljük, hamarosan Önt is ügyfeleink körében üdvözölhetjük, s egyúttal várjuk mielőbbi jelentkezését. Részletes információ weboldalunkon!


Feladva: 2016-10-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: tólmindenMostügyfeleinkCégalapításSzékhelyszolgálatingyenKönyveléskönyveléseÜgyfelünknekegyúttalbarátiszámáraelérhetőséggelEgyéniüdvözölhetjükalapuló

Forrás: pepitahirdeto.multiapro.com

Velence Korzón második referenciaszalonunkba kreatív, munkájára igényes munkatársat keresünk műkörmös és pedikűrös munkakörbe! Érdeklődj telefonon! - 20 323-7254 www.biohajklinika.hu/hu/dolgozz-ve lunk/cikkek/dolgozz-velunk


Feladva: 2016-08-30    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: VelencekeresünkmunkakörbepedikűrösGabriellaműkörmösNovotniPEDIKŰRÖSTmunkatársatMŰKÖRMÖSTigényesmunkájára7254kreatív323referenciaszalonunkbatelefonon

Forrás: pepitahirdeto.multiapro.com

Segítünk megvédeni mindent, ami Önnek fontos. Otthona, munkahelye biztonságát a távfelügyelet garantálja. Kiépítjük biztonsági rendszerét, távfelügyeletbe kapcsoljuk, és bármilyen riasztás esetén akár 5 percen belül a helyszínen a segítség. Mi nem jobbak, hanem másabbak vagyunk a konkurenciánál a professzionális vagyonvédelem területén!


Feladva: 2017-07-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: nemrendszerétmindentsegítségbiztonságimegvédenihelyszínenKiépítjükterületénSegítünkbelülgarantáljavagyonvédelemajánlópercentávfelügyeletHirdetőakár

Forrás: pepitahirdeto.multiapro.com

Eladó tulajdonostól Bpest. Rákoshegy - Nagyhangácson az Orgoványi utcában 620,2 nm-es, külterületen lévő bekerített kertgazdasági, szántó, gazdasági épület, kivett lakóház, udvar megjelölésű ingatlan és a hozzá tartózó 44,8 nm szolgalmi út. A telken villany és a vezetékes víz bekötve a házba, gáz az utcában, gyűrűs kút, bontandó vagy erősen felújításra szoruló 36 nm-es faház (2 helység, külön WC, tusolós mosdó, veranda és 26 nm-es fedett tároló) van. Csatorna, szennyvíztároló nincs. ... további részletek >>

Személygépkocsi tárolás kerítésen belül megoldható. Utca fronti személykapu, oldalsó gk. bejárat. A terület átminősítése gazdasági területté a Fővárosnál folyamatban van. Befektetésnek is ajánljuk. BKV busszal 10 perc a KöKi . Tájékoztatás csak telefonon! Az ár alkuképes irányár.


Feladva: 2017-10-16    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vanEladógazdaságiutcábanirányárfedettkivettRákoshegyerősenUtcavillanyépületalkuképes26nmBpestfolyamatbanvagymegoldhatótelkenszántótelefonon

Forrás: pepitahirdeto.multiapro.com

Az Ezermester Magyarország legrégibb és legnépszerűbb általános technológiai magazinja. Gépek, szerszámok, technológiák, építés, kert, újdonságok, ötletek. Facebook oldal: www.facebook.com/ezermester.hu


Feladva: 2017-09-11    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: ezermesterfacebookáltalánosoldallegnépszerűbbötleteklegrégibbújdonságokMagyarországkertajánlóépítésHirdetőtechnológiákPepitaszerszámokHobbimagazin

Forrás: pepitahirdeto.multiapro.com

Egyre több az anyagi helyzetével elégedetlen fiatal! A harmadik ikszbe lépve már senki nem engedheti meg azt a luxust, hogy ne törődjön saját és családja jövőjével. Legkésőbb harmincas évei során mindenkinek szembesülnie kell azzal, hogy felelősséggel tartozik saját és esetleges családja jövőjéért, ha tetszik ha nem. Éppen ezért 30-as éveiben kell alaposan megterveznie a jövőjét pénzügyei szempontból is. Nem kifogás, hogy a jövőt senki nem látja előre, hiszen ha van egy terve, még egy ... további részletek >>

bizonytalanságból eredő esetleges akadályokat is sokkal jobban fogja venni. A most negyvenes éveiben járó szendvicsgeneráció 15-20 év múlva szorult helyzetbe kerülhet, hiszen amellett, hogy a gyermekeit támogatja majd, valószínűleg részben a szüleiről is gondoskodnia kell. Ön mikor tervezi, hogy megtegye a szükséges lépéseket ahhoz, hogy emberi életet éljen nyugdíjas korában? Felajánlom az elégedetlen fiataloknak egy zseniális lehetőséget, mert sokszor még családalapítás előtt vannak, még van idejük pár év kemény munkájával, hosszú ideig élvezni a boldog életet. Ha nem lépnek időben, akkor sajnos nagy az esélye, hogy sokan egyre lentebb fognak csúszni az életben, és ez a társadalomra is súlyos kihatása lesz! Ha valaki saját magán nem akar segíteni, akkor mi sem tudunk segíteni, de ha hajlandó megismerni új lehetőségeket, akkor minden segítséget meg tudunk adni annak érdekében, hogy a családjuknak sokkal jobb életszínvonalat biztosítsanak Jelentkezzen önéletrajzzal és motivációs levéllel: rozsabusiness@gmail.com


Feladva: 2017-03-28    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmegegyresajátakkoregyelégedetlenkelléletetesetlegestudunkéveibenfiatalsokkalsenkihelyzetévelanyagihiszencsaládjatöbbvansegíteni

Forrás: pepitahirdeto.multiapro.com

Professzionális segítségre és gyógyításra számíthat az UNIQA legújabb betegségbiztosításával, ha egy súlyos, „rettegett” betegség ütné fel Önnél a fejét. A Best Doctors közreműködésével felkutatjuk Önnek az adott betegség legjobb specialistáit a világon, teljes körűen megszervezzük és térítjük a külföldi gyógykezelését 2 millió euró összeghatárig. Tájékozódjon honlapomon a Med TopDoc betegségbiztosításról, vagy kérjen tájékoztatót!


Feladva: 2015-01-18    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: MedbetegségTopDocBestlegújabbteljesbetegségbiztosítássalfejéthonlapomonUNIQAvilágonÖnnélTájékozódjonszámíthatspecialistáitfelösszeghatáriglegjobb

Forrás: pepitahirdeto.multiapro.com

Budapesti fuvarozó cég megbízható nemzetközi gépkocsivezetőket keres. Választható munkarend, napidíjas rendszer. Feltétel: C+E kategória, GKI sofőrkártya, PÁV. Kezdőket betanítunk. Érdeklődni a megadott telefonszámon, vagy itt üzenetben: www.crosseuropa.hu/hu/jelentkezes- sofornek


Feladva: 2015-11-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: gépkocsivezetőketmunkarendCrosseuropaÉrdeklődniVálaszthatókeresünkbetanítunkkeresKezdőketPÁVnemzetközisofőrkártyamegbízhatóGKIcégkategóriafuvarozó

Forrás: pepitahirdeto.multiapro.com

Horvátországi ingatlanok. REN Ingatlanközvetítő (15 éve partnerünk) ajánlatából helyeztük el az oldalon. A linkeken, az oldalukra jutva sok ház, villa, lakás, és isztriai ház közt válogathat… www.kekadria.hu/ingatlan/hingatlan 1.html


Feladva: 2017-10-05    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: ingatlanokHorvátországiKékAdriaházpartnerünkisztriaiévelakásIngatlanközvetítővillaRENsokjutvaoldalukralinkekenoldalakon8230oldaloneladókiadó

Forrás: pepitahirdeto.multiapro.com

Rutinos számítógép szerelőt keres? Megtalálta. Számítógép szerviz Budapest egész területén házhoz megy. Amit vállalok: számítógép javítás, szerelés, karbantartás, amennyiben megoldható, bővítés, korszerűsítés. Nem csak asztali számítógépet, hanem laptopot is szervizelek. Ha meglévő gépét szeretné lecserélni, akkor a számítógép vásárlásban is megbízható partnere lehetek. Ne habozzon, tekintse meg weboldalamat a további részletekért és minél hamarabb kérjen ajánlatot.


Feladva: 2016-06-22    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: számítógépszervizBudapestterületénArnoldrészletekértmegyakkorteljesNemtovábbiházhozlecserélnikorszerűsítésweboldalamatszeretnébővítésmegegész

Forrás: pepitahirdeto.multiapro.com

Családi ház, építési lehetőséggel Eladó Felsőpakonyon, 900 nm-es telken fekvő, 92 nm-es, 2 szobás, cirkó fűtéses, összkomfortos, nagy fürdőszobás, nagy konyhás, belsőgarázsos hőszigetelt tégla családi ház. A szobák szalagparkettával, a többi helyiség kerámialappal burkolt. Fúrt kút, melléképület, kerti tartózkodó Befektetésnek is! A telken még egy lakás építhető, akár teljesen elkülönítve is. Vasúttal a KöKi és a nyugati pu. közvetlenül elérhető, M0 5km. Iskola, óvoda, ... további részletek >>

élelmiszer bolt van. Nézze meg, ha megtetszett, szeretettel várjuk.


Feladva: 2017-06-29    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: házcsaládilehetőséggelnagyépítésitelkenmegóvodakonyhásépíthetőkerámialappalIskolalakáshelyiség5kmfürdőszobásegyFelsőpakonyvárjuktöbbielérhető

Forrás: pepitahirdeto.multiapro.com

Törökbálinton a Depóba raktári takarítási munkára keresünk főállású takarítókat délelőttre, illetve délutánra egyaránt (reggel 6 és délután 18 óra között elosztva 2 x 8 órában átfedéssel). Feladatok: kézi és gépi takarítás egy szép igényes rendezett raktárban. Napi 8 órás munkaidő hétfőtől péntekig, a hétvégék szabadok. Elsősorban férfi alkalmazottat keresnénk, de minden megoldásra nyitottak vagyunk. Jelentkezni telefonon a 20/9-268-790-es számon, illetve önéletrajz küldésével lehet, ... további részletek >>

fizetési igény megjelölésével.


Feladva: 2017-05-29    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: illetveküldésévelátfedésselmindenállásúNapiállásönéletrajzórábankeresnénkkeresünkraktárbantakarítóelosztvaalkalmazottatmunkárarendezettszámon790

Forrás: pepitahirdeto.multiapro.com

Comac Hungary - Comac Márkakereskedés Nem akar sok pénzt egyszerre elkölteni? Nem akarja, hogy a cége likvid tőkéje csökkenjen? Akkor érdemes hosszútávra, azonos havi költséggel járó fix összegű bérlésben gondolkodni! Nincsenek szervíz költségek, nincsenek rejtett költségek, nincsenek apró betűs részek! Bővebben honlapunkon olvashat erről!


Feladva: 2017-09-18    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: nincsenekComacNemköltségeklikvidBővebbenfixcégeHungaryrészekjáróhogyajánlóbetűsköltséggelakarjaHirdetőapróhaviPepitaazonoselkölteniáron

Forrás: pepitahirdeto.multiapro.com

Kedvező áron vállalom I. osztályú kerítés lécek készítését kemény fából, légszáraz anyagból. A kerítéslécek 22 mm vastagságban, bármely marásmintával, gyalulva és csiszolva készülnek, igényes minőségben. Dísz- és élberakott kerítésléceket, lapkerítéseket, kutyaházakat készítek, a vásárló igényének megfelelően. Akár saját tervezés alapján is. Szállítás megegyezés szerint az egész országban. Hívjon bátran, vagy írjon!


Feladva: 2017-08-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: lécekkerítésosztályúmegegyezéslapkerítéseketvastagságbanlenadebora@gmailvállalomSzállításkerítésléceket22mmírjonáronalapjánÉlberakottkerítéslécekvagy

Forrás: pepitahirdeto.multiapro.com

Számítástechnikai szerviz Pécsen a Lánc utcai rendelőnél. Nyomtatók és számítógépek javítása, olcsó nyomtató kellékanyagok. HP DesignJet plotterek javítása helyszínen. Pécs, Farkas István utca 8. Nyitva hétfőtől péntekig 9-től 17 óráig.


Feladva: 2017-01-17    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: PécsjavításaszervizSzámítástechnikairendelőnélutcaihelyszínenLáncPécsenóráigplotterektőlDesignJetpéntekigkellékanyagokImrehétfőtőlnyomtatóKovács

Forrás: pepitahirdeto.multiapro.com

A SkyWatcher 70/500-as lencsés távcsövét kis méretének, könnyű súlyának köszönhetően egyszerűen magunkkal vihetjük családi kirándulásaink alkalmával. Városoktól távol, sötét égen igen kitűnő mély-eges távcső: hatalmas látómezejébe sziporkázó nyílt halmazok sokasága vagy a kiterjedt, sejtelmes csillagközi ködök is beleférnek. De a távcső nappal sem hagyja unatkozni: jól használható spektívként a környező táj megfigyelésére. Az alaptartozék zenittükör egyenes állású, de jobb-bal irányban ... további részletek >>

megcserélt képet ad. A csomagban 25 mm-es, valamint 10 mm-es Super Bárium okulárokat találunk, melyek 20x és 50x-es nagyítást adnak. Spektívként alkalmazva 8-24 mm zoom okulárt javaslunk, mely a 21x-62x nagyítástartományt fedi le. Még nagyobb nagyítások elérésére egyszerű 2x-es Barlow lencse is a csomagban található. Az AZ-2 mechanika egyszerűen használható, ideális természetfigyelésre. Az okulártálcára számos kiegészítőt helyezhetünk, akár az észlelőteánkat is. A kihúzható alumíniumláb pedig testmagasságunkhoz igazítható. www.tavcso-mikroszkop.hu/termek/skywatcher-70-500-az2-refraktor


Feladva: 2017-07-01    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: skywatchertávcsőSpektívkénthasználhatóegyszerűen500csomagbanmelyködökPepitaigazíthatózoomSuperegestermészetfigyelésremegfigyeléséremagunkkalkitűnő

Forrás: pepitahirdeto.multiapro.com

Igényes megjelenésű klímás autók sofőrrel kérhetőek. Kiállás Budapesten díjtalan. Autóink rendelhetők már 6.000.-/óra díjtól. Számoljon velünk, részletekért klikkeljen a www.szepauto.5mp.eu oldalra.


Feladva: 2017-03-20    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: KiállásCsaládivelünkkérhetőekpartiSzámoljonsofőrrelCégesdíjtólautókRendezvényóraklímásAutó000megjelenésűoldalraEsküvőmárIgényes5mpRichárd

Forrás: pepitahirdeto.multiapro.com

Ne törődjön bele abba, hogy nem néz ki úgy, ahogy szeretne. Van segítség! Dr. Rusz Zoltán, plasztikai sebész vagyok. Honlapomon megtalálja szakmai önéletrajzomat és itt a referenciamunkáimról készült fotókat is meg tudja tekintetni.


Feladva: 2017-10-15    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ZoltánRuszplasztikaiabbafotókatbelekészülttörődjönreferenciamunkáimrólsegítségkerületittVanBudapestönéletrajzomatszeretnesebészetszakmaiahogy

Forrás: pepitahirdeto.multiapro.com

Klasszikus és modern olasz konyhabútorok nagy elemválasztékával várja Önt a Lineaflex Olasz Bútoráruház és Ágybetét Stúdió.


Feladva: 2016-09-02    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: OlaszBútoráruházLineaflexÖntvárjaelemválasztékávalnagykonyhabútorokmodernStúdióKlasszikusÁgybetétkerBudapestkonyhabútor

Forrás: pepitahirdeto.multiapro.com

A magas fehérvérsejt szám rendellenes állapot, mely általában fertőzést mutat. Ugyanakkor pajzsmirigy túlműködés is állhat drasztikus mértékű megemelkedésének hátterében. Az alacsony fehérvérsejt szám szintén nem ideális, hiszen fogékonyabbá tesz a betegségekre. Ez általában kemoterápia, sugárkezelés, csontvelő rendellenesség és vírusfertőzés miatt fordul elő. Egy egészséges szervezetben a fehérvérsejtek az összes sejt 1%-át teszik ki, az ennél magasabb és alacsonyabb arány betegség meglétét ... további részletek >>

mutatja. A fehérvérsejt és vörösvérsejt terápiák a kiváltó ok ismeretében kezdhetők meg.


Feladva: 2016-08-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fehérvérsejtállapotáltalábanvörösvérsejtszámkemoterápiamutatjahátterébenszervezetbenmeglététmegemelkedésénekegészségesrendellenesbetegségekrebetegség

Forrás: pepitahirdeto.multiapro.com

Falszigetelés - Acéllemezes falszigetelés - Falszigetelés injektálással, - Dryzone-os injektálással - Magasnyomású injektálással - Háttérinjektálással - Tömbinjektálással A falszigetelés összes technológiájával állunk 20 éve a lakosság, illetve az önök szolgálatában.


Feladva: 2017-05-07    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: falszigetelésinjektálássaltechnológiájávalellenösszesfalakvizesTömbinjektálássalutólagosanHáttérinjektálássalinjektálásszolgálatábanönökMagasnyomásúéve

Forrás: pepitahirdeto.multiapro.com

Ön hagyományos szakácskabátban szeret dolgozni? Vagy kedveli a modern divatos munkaruhát? Mi mind kettőben tudunk Önnek segíteni. Már közel száz féle kész fazonból választhat, rendelhet akár egyéni kívánság szerint is. 100% pamut, vagy kevert szálú alapanyagból, vékony vagy vastagabb kivitelben, tetszésének megfelelő színben a hozzá harmonizáló kivehető gombokkal is elkészítjük szakácskabátját. Kívánságra céglógót, nevet, beosztást tudunk a kabátba hímezni.


Feladva: 2016-10-11    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: vagytudunkkészhímeznimodernharmonizálókevertfélekabátbakedvelihozzápamutszázdolgozniszínben100közelbeosztástszeretmegfelelőszerintMárakár

Forrás: pepitahirdeto.multiapro.com

Minden információ, ami a tűzifavásárláshoz kell. - Mire kell odafigyelnie tűzifavásárlásnál? - Milyen a jó tűzifa? - Mennyi a korrekt tűzifa ár? Száraz, hasogatott bükk, csertölgy, gyertyán tűzifa - mindenféle méretben. Válasszon kínálatunkból, szállíttassa házhoz! www.tuzifa.ws


Feladva: 2016-09-30    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tuzifakellhasogatottSzárazkínálatunkbólMilyeneladóVálasszontűzifavásárlásnálméretbenodafigyelniemindenfélegyertyánMirecsertölgytűzifavásárláshozbükk

Forrás: pepitahirdeto.multiapro.com

Asztali sörcsapolók, hogy mindig legyen hideg sör a vendég előtt! Kell-e bármit még mondani ahhoz, hogy ellátogasson a honlapunkra?


Feladva: 2017-07-15    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hogysörcsapolókAsztalimégDebrecenbármitajánlóKellHirdetőelőttPepitavendégsörhonlapunkrahidegellátogassonlegyenmindigahhozmondani

Forrás: pepitahirdeto.multiapro.com

Most vegye meg, vagy kösse le álmai otthonát, nyaralóját! Nálunk most akár önerő nélkül is lakáshoz juthat! Amennyiben tőlünk (vagy megbízott ingatlanközvetítőinken keresztül) vásárolja meg lakását, a CSOK és a kedvezményes kamatozású hitelügyintézésben is segítünk önnek! Ezen felül partner ügyintézőnk állami támogatás intézésében is segít önnek + 8 millió Forint államilag garantált kedvezményes hitel intézésében is! A kivitelezést már megkezdtük! BADACSONY LEGKORSZERŰBB ... további részletek >>

PANORÁMÁS, ENERGIATAKARÉKOS KLIMATIZÁLT TÁRSASHÁZA ÉPÜL! CSOK IGÉNYBE VEHETŐ!!! www.facebook.com/groups/1573877696240446/permalink/1690129964615218


Feladva: 2017-07-21    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kedvezményesvagyönnekmegCSOKintézésébenmosthitelNálunk16901299partnerÁlomotthonTÁRSASHÁZAmegbízottnyaralójátpermalinkfelülKLIMATIZÁLTgarantált

Forrás: pepitahirdeto.multiapro.com

Hitelkártyák, személyi hitelek, egyesítése egy hitelbe! Jelenlegi hiteleinek havi törlesztését akár 50-40%-ra is le tudjuk csökkenteni. Még mielőtt fizetésképtelenné válik, jelentkezzen! Az ügyintézésért jutalékot nem kérünk, bankokkal vagyunk szerződve! Szűcsné B. Erzsi Személyi kölcsön értékesítő vezető 1214 Budapest Csepeli út 83. Telefon: 06-30-841-0329 E-mail: i nfo.szbe@gmail.com Web: www.hitel-city.hu és www.hitelügyintézés.com


Feladva: 2017-07-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzemélyiegyesítésehitelekcomBudapestcitytörlesztésétvezetőSándorjutalékothitelhaviértékesítőSzűcsügyintézésértszbe@gmailhiteleinekkölcsöninfo

Forrás: pepitahirdeto.multiapro.com

A német tulajdonban lévő U&D Select Group Dél-Németországba keres: betanított és segédmunkásokat marhavágóhídra és tésztagyárba! Szállás igény esetén biztosított. Munkábajárásban tudunk segíteni. Német nyelvtudás nem feltétetel! Hosszútávú biztos munkalehetőség! Heti 5 munkanap, szombatonként túlórázási lehetőség Magyar nyelvű ügyintézés. Közvetítői díj nincs! Jelentkezni és, érdeklődni a delnemetmunka@gmail.com e-mail címen lehet. Telefon: +49151/26389661 és +3630/6485271


Feladva: 2017-10-19    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: NémetbetanítottDélnyelvűNémetmunkanemcímenmarhavágóhídraMagyarSegédmunkanyelvtudásmailsegédmunkásokatlehetőségcomtúlórázásisegítenikerestudunk

Forrás: pepitahirdeto.multiapro.com

Eladó új Huawei Honor okostelefonok! Honor 5X Honor 7 Honor 7i Honor 8 Honor V8 Honor Note 8 Huawei Mate 8 Részletekért látogasson el weboldalunkra! www.puremobile.hu/huawei


Feladva: 2016-10-28    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: HonorHuaweiokostelefonokpuremobileweboldalunkralátogassonRészletekértMateNoteEladóBudapest

Forrás: pepitahirdeto.multiapro.com

Rongyszőnyegek: A másra már nem használható, nagyobb darab farmeranyagokból készítjük. A rongyszőnyegek általában a kék különböző árnyalataiban készülnek, de gyártunk fekete, szürke, ritkábban barna színekben is. Az összes rongyszőnyegünk kézi szövésű. 70 cm szélesek és 70 cm-től 6 méteresig mindenféle méretben gyártjuk. Kérésre egyedi méretekben is! Kreatív szőnyegek: Ezeket a szőnyegeinket a farmernadrágok zsebeiből, ülepéből, övrészéből, stb készítjük. Kézzel varrottak, ezért az összes ... további részletek >>

darab teljesen egyedi. A gyakoribb méreteken kívül, megrendelésre egyéb méretekben is elkészítjük őket. Nézze meg a szőnyegeinket! www.oldblue.hu/index.php/szonyegek


Feladva: 2017-04-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: rongyszőnyegekszonyegekszőnyegeinketegyedidarabösszesKreatívméretekbenkészítjükstbnemoldblueméteresigméretekengyártunkövrészébőlmárwwwtőlmásra

Forrás: pepitahirdeto.multiapro.com

Vízálló, csúszásmentes meleg burkolatok, fahatású, kőhatású, szövött és minimál design padlók széles választéka. Click és Loose-Lay padlórendszerek. Az anyag rugalmassága miatt minden helységbe alkalmas, akár falra, pultra, bútor homlokzatra is rögzíthető. Mikrofózolt élekkel, sima, előkészített burkolaton egy 1-3mm-es ragasztóágyba helyezve, gyorsan, kosz-és zajmentesen lerakható, padlófűtéshez is! A különböző termékcsaládjainkat és a színválasztékot megtalálja a www.magicfloor.hu oldalon!


Feladva: 2017-03-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: magicfloorburkolatokVízállókoszszövöttrögzíthetőVinyloldalonanyaggyorsankőhatásúhomlokzatraLuxuspadlórendszerekhelyezvefahatásúbútorwwwLayLoose

Forrás: pepitahirdeto.multiapro.com

- Minden gumiabroncs új! - Számlát és 2 éves garanciát biztosítunk. - Az ár tartalmazza a szállítási költséget (*Utánvételes fizetés esetén +1500 Ft a csomagra). - Bármilyen címre szállíthat Magyarországon belül, beleértve szervizpartnereink bármelyikét. - Figyelem: Csak gumiabroncsot szállítunk. Amennyiben a képen felni is látható, csak a jobb szemlélhetőséget szolgálja.


Feladva: 2017-01-25    [Autó - Motor - Jármű]

Címkék, kulcsszavak: gumikcsakjobbbeleértveköltségetáronbelülszállításiláthatókedvezőMagyarországontartalmazzafelnitéliszállíthatbiztosítunkképencímregaranciátéves

Forrás: pepitahirdeto.multiapro.com

Segítünk berendezni, kérje Önnek szóló ajánlatunkat: www.hu-mago.hu/boltok-tervezese-sz erelese Vállaljuk boltok: felmérését, tervezését, látványterv készítését, összeszerelését, bontását. Szolgáltatásaink: » Boltok tervezése, szerelése » Bevásárlókocsi felújítás » Galvanizálás » Raktári állvány építés » Sorompó telepítés Új és használt forgalmazott termékeink megtekintéséhez látogasson el weboldalunkra!


Feladva: 2017-04-17    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 187BoltokszerelésetervezéseösszeszerelésétkérjeállványkészítésétweboldalunkraberendezniRaktárilátványtervlátogassonSegítünkGalvanizálástervezésétmago

Forrás: pepitahirdeto.multiapro.com

Rusztikus kerti bútor, kerti garnitúra csomoros nyárfából eladó, tetszés szerinti méretekben és színekben a gyártótól megrendelhetõ! Garantált minõség, kedvezõ árak! Termékeink: asztalok, padok, székek, fatálak, sarokpadok, egyedi faragott bútorok, komplett kerti és étkezõ garnitúrák. Éttermek, vendéglátóegységek, borozók, sörözõk berendezését is vállaljuk. Tel: +36209325853 ; Web: www.artholz.hu ; info@ artholz.hu


Feladva: 2016-11-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 245kertibútorokRusztikusárakTeleladókomplettkedvezvállaljuknyárfábólségberendezésétcsomorosfaragottmingarnitúraegyediGarantáltsörözbútorwww

Forrás: pepitahirdeto.multiapro.com

Savmentes alapanyagokból készült különleges kartonpapír lapok. Az alapanyaguk káros anyagokat és vegyszereket nem tartalmaz. Csak az egyik oldalon mintás, a másik egyszínű narancssárga. Mérete: 24,5x34 cm (200 g/m²) Többféle mintával. www.otlet-kucko.hu/index.php?route =product/product&product_id=13938


Feladva: 2017-10-15    [
Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: productmintásanyagokatphpPepitanarancssárgakárosindexkartonegyszínűalapanyagukkuckomásiklapokotletkartonpapírwwwoldalonkülönlegesmintávalCsak

Forrás: pepitahirdeto.multiapro.com

Nadrágok, ruhák, szoknyák és kabátok rövidítését, szűkítését, vagy karcsúsítását vállaljuk rövid határidőre, korrekt áron. Cipzárcsere, cipzárjavítás szakszerűen! Cím: Budapest IX. Tompa utca 22. Ruhaszerviz Nyitva: h,sz,p,: 9,15-17,00-ig k,cs,: 10,00-18,00-ig A szombati nyitva tartásról érdemes előzetesen érdeklődni! Tel.: 06-1-215-7047 Várom szeretettel! www.divatruha.hu/index.php?page=ru haszerviz


Feladva: 2016-07-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: RuhaszervízFERENCVÁROSBANNEKEDBudapest251kítésétérdeklődjöncipzárjavításrövidítésétnyitvatartásrólCipzárcserekabátokszombatiáronszoknyákNyitvakorrekt

Forrás: pepitahirdeto.multiapro.com

Vízszerelést, javítási munkákat, épületgépészeti munkákat, vízvezeték szerelési munkákat vállalunk Budapest és környékén, Pest megyében. Csaptelep csere, mosdó, mosogató csere javítás, vízóra csere, beépítés. Kerti csap készítés, kerti akna, vízóraakna készítése, telepítése. Minden ami vízzel kapcsolatos, szerelés, javítás, kivitelezés. Szivattyúk telepítés fúrt kutakra, kútfej telepítés, szerelés, javítás. Csaptelep csere, javítás (zuhany, kád, mosdó, mosogató), teljes felújítás ... további részletek >>

lebonyolítása. Keressen minket bizalommal!


Feladva: 2017-04-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: javításcserekertiCsapteleptelepítésmunkákatmosdóvízóraPestvízszerelőszerelésfelújításaknamosogatóVízszerelésfúrtszerelésiSzivattyúkkészítéskád

Forrás: pepitahirdeto.multiapro.com

A Nash H-Gun botzsákban egyszerre 3 darab 360-as bojlis/pontyozó horgászbotot tárolhatunk. Az extrán párnázott belsőnek köszönhetően botjaink és orsóink is tökéletes biztonságban vannak. 12 hónap garancia, számlaadás. A kiszállítás ingyenes! Webshopunkban azonnal megrendelhető: www.globalstore.hu/shop/nash-h-gun-12ft-3-rod-holldal-botzsak/ További jellemzők: - Nagyméretű külső cipzáras zseb, mely merítőszák vagy ernyő tárolására alkalmas. - Külső cipzáras zseb, melyben például ... további részletek >>

leszúrók tárolhatók. - Erős anyagokból készült, megerősített dupla varrásokkal, megbízható hosszú életű cipzárakkal. - Párnázott fogantyú, állítható vállpánt. - Alumínium merevítő a megfelelő stabilitás miatt.


Feladva: 2017-10-04    [Sport - Kemping - Túra]

Címkék, kulcsszavak: zsebcipzárasKülsőgunPárnázottnashmerítőszákpontyozócipzárakkalshopHorgászbotleszúrókvannakmelybojliséletűglobalstorepéldáulbiztonságbanmiatt

Forrás: pepitahirdeto.multiapro.com

Rozsdamentes fazék 40 liter, Perfect Home 12740 Anyaga: rozsdamentes acél Mérete: átmérő 42 cm; szélessége füllel: 49 cm; magassága: 40 cm Űrtartalma: kb. 40 liter Súlya: 2,73 kg Használható: gáz-, elektromos-, kerámialapos tűzhelyen Tisztítása: Semleges folyékony mosogatószerrel mossa el. Kerülje a karcosodást okozó szerek és eszközök használatát! www.fullmarkt.hu/Rozsdamentes-faze k-40-liter-Perfect-Home-12740


Feladva: 2017-09-21    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: Rozsdamentesliterfazek12740HomePerfecthasználatáttűzhelyenMéreteeszközökkerámialaposacélszerekelektromosAnyagaokozógázajánlókarcosodástHirdető

Forrás: pepitahirdeto.multiapro.com

Neked most fáj a hátad? Nem érsz rá, mikorra kapnál időpontot? Vagy csak most lenne időd egy kis masszázsra? Hívj! Vagy mentsd el a számomat, hogy kéznél legyen, amikor kell! imerít a mindennapos rohanás? Vagy fásulttá tesznek a szürke hétköznapok? Már régen érezted szeretve magadat? Ha olyan masszázsra vágysz, ahol érzed, hogy szeretettel vagy érintve, akkor jó helyen jársz :) Ebben az órahosszában a figyelmem csak a tiéd, aminek hatására teljesen kipihentnek, ... további részletek >>

ellazultnak fogod érezni magadat. A relaxált állapot már önmagában is beindítja a szervezet regeneráló folyamatait, aminek hatására gyógyulások mennek végbe a legkülönbözőbb területeken. Ezt még fokozhatjuk azzal, hogy a kezelés elején immunerősítő energiákat indítok el, ami a masszírozás ideje alatt végig dolgozik a test izmaiban, sejtjeiben. Aki erre vágyik, szívesen jön vissza újra és újra és újra ... Ha kipróbálnád Te is, szeretettel várlak Kecskeméten a Széchenyivárosban csendes környezetben.


Feladva: 2017-09-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vagyhogyújramostszeretettelmagadathatásáraaminekcsakmármasszázsraolyanLauravárlakmennekrelaxáltkellizmaibanEbbenelejénszeretveTündeamikor

Forrás: pepitahirdeto.multiapro.com

Szabaduljon meg adóssággal terhelt cégétől, akár több milliós tartozás esetén is. Eladósodott veszteséges, banki vagy köztartozással terhelt,tagi hitel és házipénztár gondokkal küzdő, csődközeli cégek ÁTVÉTELE, kiközvetítése belföldi partnerek részére. Hivatalos, gyors ügyintézés, jogi garanciával. (Végrehajtás, végelszámolás NEM AKADÁLY) 15 MFt feletti adósság esetén is! Problémás cégek adás vétele, ügyvezető kölcsönzés, cégalapítás.


Feladva: 2016-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: cégekeseténterheltSzabaduljonNEMkiközvetítésebankiügyvezetőKatalinvégelszámolásÁTVÉTELEveszteségesvételeMagyarVégrehajtáscsődközeliEladósodottadás

Forrás: pepitahirdeto.multiapro.com

A lakásfelújítás stressz mentes lebonyolításáért hívjon minket, bontástól a kulcsátadásig, nálunk minden egy kézben.


Feladva: 2017-03-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: lakásfelújításkulcsátadásigBudapestenbontástólminkethívjonlebonyolításáértmentesstresszkézbenegyBudapestmindenÁdámnálunkHomenszki

Forrás: pepitahirdeto.multiapro.com

Örökre búcsút vehet a súlyos patron és toner kiadásoktól, aki képes újratölteni azokat. Lehet akár tintasugaras, vagy lézernyomtató, esetleg fénymásoló. A módszerben segítünk. Vásároljon egy liter nyomtatótintát, vagy töltse újra drága tonerjét, akár 1.000 Ft alatti palackozott tonerporral!


Feladva: 2015-03-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: vagytoneregyakártintaestonerVásároljonkiadásoktólezerTintapatronsegítünkmódszerbenpatronfénymásolósúlyostonerjétlézernyomtatóvehetdrágabúcsút

Forrás: pepitahirdeto.multiapro.com

Angol online tanfolyam kezdőknek és újrakezdőknek, ha nincs időd nyelviskolába járni itt a helyed! Most 20 ingyenes ONLINE leckével próbáld ki magad és fejleszd tudásodat. Képek, videók és különböző feladatok segítenek az angol nyelv elsajátításában. Tesztek és gyakorlási lehetőség INGYEN. Tanulj otthon, a saját időbeosztásod szerint! Webcímünk: www.tanoda.shp.hu


Feladva: 2016-10-29    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: angolONLINEkezdőknekotthonpróbáldWebcímünkújrakezdőkneknyelvleckévelszerintidőbeosztásodtanfolyamsegítenekingyenessajátOrszágosfeladatokMostTünde

Forrás: pepitahirdeto.multiapro.com

KINEZIOLÓGIA, A TEST KEZELÉSE, A LÉLEK GYÓGYÍTÁSA Egészségmegőrző, gyógyulást elősegítő energetikai kezelés. Segítő beszélgetés - testünk üzenetei, betegségek lelki okai. Stresszoldás. Belső gyógyító energiánk aktiválása. Energia blokkok oldása. Önismeret, készség és képességfejlesztés. Életmód tanácsadás. Családterápia. Bach virágterápia. Budapestről és vonzáskörzetéből várom vendégeimet, telefonon előre egyeztetett időpontokban: 06-30/637-2022


Feladva: 2013-11-10    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: virágterápiaKINEZIOLÓGIABachCsaládterápiaStresszoldásEnergiabeszélgetésaktiválása2022Segítőkerenergiánk637kezelésBudapestgyógyítóidőpontokbanBelső

Forrás: pepitahirdeto.multiapro.com

A Fürdődézsák 2x2.5-től-2x4.2m-ig bármilyen méretben elkészítjük. Kerek és ovális formában! Kedvező árak! e-mailben minden érdeklődőnek méret szerinti konkrét árat adunk. Ajándék sóval. A kályha anyaga ko36. Egyedi kívánságokat is teljesítünk értelmes határokon belül! Az árak nem akciósak, de az ár-érték arány átlagon felüli! A fürdő dézsa ma már nem azt jelenti mint akár 500 esztendővel ezelőtt! A kályhának köszönhetően minden évszakban használhatja. Extra méret, szuper ár, 4x2-es kettő ... további részletek >>

kályhával: 699.000 Ft! Extrákkal bővíthető! Más dézsák 309.000 Ft-tól! www.furdodezsak.com 06203979102 pollakferi@icloud.com Fűthető fürdődézsa. A parti dézsa, merülő dézsa, dézsa fürdő és kerti dézsa wellness élményeket ad (Hot Tub). Társasági élményfürdőzésnek kiváló módja. A dézsa felszereltsége: lépcső, pad, védőrács, italtartó, kályha, tető, kályhacső. Parajdi sót adhatunk hozzá.


Feladva: 2017-05-09    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: dézsafürdődézsaFűthetőfürdő000árakméretnemmindencomkályhaTubHotlépcső4x2sóvalkerti500Kerekfábólhozzátólakciósakfelszereltségeszuper

Forrás: pepitahirdeto.multiapro.com

A vörös szőlőlevél magas antioxidáns tartalmáról ismert keringésfokozó hatású. Az Ultra Weich vörösszőlő levél krém enyhíti a fájdalmas feszülő érzetet a bőrfelületen és frissíti a fáradt, elnehezedett igénybe vett végtagok vérkeringését, ezzel kellemes, hidratált érzést biztosít. Minden bőrtípusra alkalmazható. Külsőleg, a bőr felületén alkalmazandó. Ingyenes szállítási lehetőséggel! www.mososzerbolt.hu/id/00245_UW_Vo rosszolo_level_krem_100_ml_


Feladva: 2016-01-27    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: hatássalbőrfelületetfokozóhidratáljaKeringésNyugtatjaKftsejtregenerációtFutureFokozzaCudywebáruházesetérekrémmosószertüneteklevélHazailábNehéz

Forrás: pepitahirdeto.multiapro.com

Massive Tools Magyarország legnépszerűbb ipari felsőmarókés családja. Több mint 20 éve a hazai piacon. Ár/Minőség, legjobb. www.felsomarokes.hu és www.botex.ro Telefon: 70/3788393 További import termékeink: Csiszolószivacsok, szorítók, körfűrészlapok...


Feladva: 2017-05-22    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: botexfelsőmarókéswwwToolsMassiveiparifelsomarokeslegnépszerűbblegjobbMagyarországMinőségcsiszolószivacsokpiacontermékünkhazaiBudakesziimportéve

Forrás: pepitahirdeto.multiapro.com

Azért, mert a Gano Excel mellett már 4 éve elköteleztem magam, és amit életem egy jó lépésének tartok. Azért, hogy lecserélhesd a hagyományos kávéd egy egészséges és finom kávéra, amelytől jelentősen javul az energiád és a közérzeted. Azért, ganodermát, a spirulinát, és a Cordycepst tartalmaznak termékeink, és ezek jótékony hatására bármikor szükséged lehet. Egészség és szépség egy helyen! Azért, mert nekem már jövedelmem van ebből a „munkából”, és segíthetek Neked is ... további részletek >>

abban, hogy Te is tisztes jövedelemre tegyél szert. Persze csak akkor vagyok jó választás a számodra, ha neked is fontos a szabadság, az anyagi függetlenség és az egészség.


Feladva: 2017-08-16    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AzértegyegészségmárnekedhogymertExcelválasszakkorspirulináthagyományosmunkábólGanoszépségengemcsakganodermátlecserélhesd8222Tatabányalehet

Forrás: pepitahirdeto.multiapro.com

Mobil- és infocuccok akár ingyenes szállítással, garanciával. www.techdiszkont.superwebaruhaz.hu /mobiltelefon-k79599 HP, Acer, ASUS, Samsung, LG, Nokia, Alcatel, Genius, Canyon és egyéb márkák választéka.


Feladva: 2017-03-31    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: techdiszkontMobilASUSMobilboltAcersuperwebaruhazválasztékamárkákwwwegyébgaranciávalCanyonszállítássalGeniusingyenesAlcatelakárNokiainfocuccok

Forrás: pepitahirdeto.multiapro.com

Ha gyűjtöd a hanglemezt, ajánlom figyelmedbe a Rock LP oldalt. Rock, Pop, Disco, Soul, Funky, Jazz, Blues... Kedvező árfekvésben.


Feladva: 2016-07-18    [Zene - Hangszer]

Címkék, kulcsszavak: RockBluesgyűjtödJazzBudakesziFunkyTiborSoulBotkaDiscoVinylPopBakelitHanglemezoldaltfigyelmedbeárfekvésbenajánlomKedvezőhanglemezt

Forrás: pepitahirdeto.multiapro.com

Lakberendezés Egyéni Igényekre Teljes körű Építészeti és Belsőépítészeti 3D Látványtervezést kínálunk: Tervezőknek · Gyártóknak · Beruházóknak · Magánszemélyeknek


Feladva: 2017-07-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 183MagánszemélyeknekIgényekreEgyéniBeruházóknakLakberendezésGyártóknakajánlóTervezőknekHirdetőkínálunkPepitaLátványtervezéstLátványtervezésValósághű

Forrás: pepitahirdeto.multiapro.com

Moteck SW 280 kétszárnyas kapunyitó szett: 83500 Ft Országos házhoz szállítás, 1 év garancia! Magyar nyelvű telepítési és programozási útmutatóval! Szeretné kézben tartani a kényelmet? Ha IGEN! Akkor Önnek találták ki az elektromos kapunyitószettet! Egy távirányítóval megoldja a kapunyitást, sőt a kerti világítást is kapcsolhatja a távirányító segítségével! A Moteck SW-280 egy igen kedvező árú, extra sallangoktól mentes, kiváló ár/érték arányú, több éve forgalmazott kapunyitó szett ... további részletek >>

márka. Természetesen az nem akadály, ha Önnek egy régi kertkapuja van: a motor felszerelhető régi, új, egy-, vagy kétszárnyú kapura is, illetve tolókapuk esetén szinte a legtöbb, már működő kapura is. A kapunyitó szettek felszerelése tehát nem kíván különösebb átalakítást a meglévő kapurendszerén! Egyszerű telepítés, komolyabb szakértelmet nem igényel a felszerelése! Megrendelés, további technikai információk weboldalunkon: www.boltcenter.hu


Feladva: 2016-09-20    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: kapunyitóegynemszettÖnnekfelszerelésekétszárnyúkapuraigenrégi280MoteckMegrendeléskényelmetkülönösebbmentesházhoztolókapukvilágítástakadálysőt

Forrás: pepitahirdeto.multiapro.com

GKI képzés és vizsga RÉSZLETFIZETÉSI LEHETŐSÉGGEL! Ingyenes tananyagot biztosítunk! Korábbi GKI igazolvánnyal rendelkezők esetén 59.900 Ft/fő. Ne maradjon le róla! Tel.: 0620-248-6818; www.fuvinfoiroda.hu/tanfolyamok/ke pzesek-gepjarmuvezetok-reszere/gki- soforoknek


Feladva: 2017-04-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: GKImájusvizsgatananyagot248képzésünkreIngyenes0620LEHETŐSÉGGELTelindulóRÉSZLETFIZETÉSIrólaJelentkezzenmaradjon900képzéshétfőeseténBudapestwww

Forrás: pepitahirdeto.multiapro.com

Keresünk németországi intenzíves ápolásra szoruló betegekhez ápolókat, gyermekápolókat, diplomás nővéreket, két heti váltásban, jó kereseti lehetőséggel. Jelentkezni német nyelvű fényképes önéletrajzzal lehet e-mailben. Elvárások: -honosított (Anerkennung) vagy honosítható bizonyítvány -középszintű német nyelvtudás(B2-es nyelvvizsga) -munkatapasztalat Bővebb információ telefonon: H-P, 9-16 óráig!


Feladva: 2017-10-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németnémetországiElvárásokkétmunkatapasztalatMohácsmailbennővéreketnyelvvizsgaKftlehetdiplomásnyelvtudás2011önéletrajzzalgyermekápolókatKezeknyelvű

Forrás: pepitahirdeto.multiapro.com

Művészi fa urnák! A céget működtető művészcsalád tagjai közt van a fát szerető és értő iparművész, elhivatott festőművész, aki még ismeri a régi nagy mesterek titkait, ötletekben gazdag tervező, vagy ahogy manapság divatosan nevezik ”designer” A vállalkozás gyárt egyedi és kis szériás sorozatban is! Már a Facebook-on is: www.facebook.com/Urnakeszito


Feladva: 2013-03-31    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: manapságelhivatottTapolcahttpwwwfacebookcomUrnakeszitoahogyiparművészkoporsókFacebookonvagyértőurnaisMártervezőszeretőurnáksorozatbangazdagfátvan

Forrás: pepitahirdeto.multiapro.com

HONDA GL 1500 GOLD WING - 1989-07 HAVI 74 KW 101 LE 154.982 KM !! 2018-05-ig érvényes MŰSZAKIVAL, 2 GYÁRI kulccsal,Jó állapotú első- hátsó gumikkal és féktárcsákkal, Barna BŐR ÜLÉSEK, AM/FM RÁDIÓ, TOLATÁS FUNKCIÓ, Elöl-hátul kiépített 12V rendszer, Kéz és Térdfűtés, MAGYARORSZÁGI RENDSZÁMOS!!!!!! Rendezett MAGYAR okmányokkal, azonnal megvásárolható!!!!! Eladó: 1.199.000.- Ft (Csereár 1.299.000 .-Ft) Akár hétvégén is megtekinthető, előzetes egyeztetés alapján! További képekért és ... további részletek >>

járművekért kérem keresse fel honlapunkat! www.markamotor.hu/magyar/motorok/gl-1500-gold-wing/legujabbak/osszes Teljes körű ügyintézés, Magyar rendszámos motorok névre írása, igény esetén friss Szerviz! Házhoz szállításban tudunk segíteni!


Feladva: 2017-11-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: WINGGOLDMAGYAR1500000RENDSZÁMOSHONDAmotorokHirdetőTovábbiféktárcsákkalrendszerosszes154199szállításbanPepitaképekértgumikkalKézTeljes101

Forrás: pepitahirdeto.multiapro.com

1991 óta működő faipari cég garanciával vállalja, egyedi igények szerinti konyha, szoba, gyerekszoba, fürdőszobabútorok, polcrendszerek, beépített szekrények, valamint irodabútorok, egyedi bútorok készítését, és különféle asztalos munkákat. Bemutatótermünkben rendelkezésre állnak anyagminták, melyekből kiválaszthatja az ön által elképzelt egyedi kialakítású bútorát, valamint a webáruházunkban forgalmazott bútorainkból néhány darabot.


Feladva: 2015-11-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: egyediKoránvalamintbútorát1991munkákatszobakialakításúkftasztaloskonyhaKereskedelmikülönféleszerintielképzeltBútorkészítőkészítésétigényekáltal

Forrás: pepitahirdeto.multiapro.com

Balatonfenyvesi kiadó vízparti nyaralók, apartmanok, szobák! Foglalja le időben balatoni nyaralóját! Ha a válság miatt nem tud külföldre utazni, válassza az olcsóbb hazait! Akció! Június 25-ig és augusztus 25 után -20%! SZÉP kártya elfogadóhelyek várják! Keressen bennünket bizalommal!


Feladva: 2016-09-18    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: BalatonfenyvesbalatonivízpartikiadóaugusztusválságJúniusnyaralójátnyaralóAkcióbizalommalhazaitidőbenbennünketolcsóbbFoglaljaKeressenválasszatud

Forrás: pepitahirdeto.multiapro.com

5 Féle Napkristály ital egy dobozban - 5 x 500ml - 5 Napos Bioflavonoid program - Kibővített összetétel - A legkorszerűbb nanotechnológia - Új vonzó íz, kellemes a gyomor számára. A flavonoidok a szervezet antioxidáns kapacitását növelik, amely képes csökkenteni a szabadgyökök sejteket romboló hatását. Támogatják a védekező rendszer optimális működését. A vörösszőlő segíti az érrendszer optimális működését, javítja a keringést. Antioxidáns tulajdonsága révén, segíthet megvédeni a bőrt is...


Feladva: 2015-11-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: optimálisitalNapkristályAntioxidánsműködésétszabadgyökökvonzócsökkenteniszabananotechnológiaérrendszerképesbőrtlegkorszerűbbsegítiFéleamelyVali

Forrás: pepitahirdeto.multiapro.com

Exkluzív olasz italtartó földgömbök, sakkasztalok széles választékban. Rövid szállítási határidővel.Megrendelheti honlapunkon, vagy személyesen üzletünkben. 1093 Budapest közraktár utca 20./a www.matracfutar.hu www.lineaflex-butor.hu


Feladva: 2017-02-15    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: BudapestsakkasztalokolaszlineaflexwwwItaltartókmatracfutarszállításiutcaRövidközraktárválasztékbanszéles1093üzletünkbenföldgömbökszemélyesenvagy

Forrás: pepitahirdeto.multiapro.com

Év végi, szilveszteri műsorok rendelhetők Blue cat


Feladva: 2017-11-06    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: műsorokszilveszterivégicatBluerendelhetőkpaul

Forrás: pepitahirdeto.multiapro.com

A Google kereső algoritmusa folyamatosan változik, mondhatni finomodik... Ennek lehetséges következménye lehet, hogy néhány - addig jól kereshető - weboldal, esetleg hirdetés kereshetetlenné válik, eltűnik. Általánosságban természetesen törekszünk arra, hogy a hirdetéseinkkel ez ne történjen meg! Garantáltan megóvni azonban csak azokat a felügyelt tartalmakat tudjuk, melyekre konkrétan felkérnek. Köszönjük a bizalmat, amit egy-egy hirdetés feladással kifejeznek a kedves látogatóink, ... további részletek >>

de a legjobb az lenne, ha a fontos dolgokra külön fel is hívnák üzenetben a figyelmünket egy üzenettel! Marad a mottónk, mely alapján keresőinket is üzemeltetjük: Nekünk az a fontos, ami Önnek az!


Feladva: 2017-05-19    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: egyhogyfontoshirdetéshívnákÁltalánosságbanamitkövetkezményeüzemeltetjükazonbanHirdetőfeleltűnikbizalmatlehetségeskeresőinketmegóvniPepitakülön

Forrás: pepitahirdeto.multiapro.com

Országosan olyan üzletkötőket keresünk csapatunkba, akik nem kezdők már az értékesítésben, de kimagasló teljesítményükért elvárják a megbecsülést is cserébe. Talán pont Téged keresünk? Magas kereseti lehetőség, NEM MLM! Ha ilyen üzletkötőnek tartod magad, küldj önéletrajzot az alábbi email címre andras.bogar@athletastic.co m! Vagy ismersz valakit, aki ilyen üzletkötői munkát keres, kérlek, vedd fel vele a kapcsolatot.


Feladva: 2017-10-02    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünküzletkötőketNEMilyenvalakitcsapatunkbamagadkapcsolatotTalánismersztartodvelecserébeVagyolyanüzletkötőnekfelmegbecsüléstcomOrszágosan

Forrás: pepitahirdeto.multiapro.com

Környezetbarát tisztítószer, amely lehetővé teszi a zsíros szennyeződések eltávolítását minden felületről. Különösen alkalmas a tűzhely, a sütő és a főzőlap zsíros lerakódásainak eltávolításához. Bőrgyógyászatilag tesztelt. Ecolabel minősítéssel rendelkezik, amely tanúsítja a környezetkímélő, biológiailag könnyen lebomló összetevőket. - 750 ml-es szórófejes flakon www.vegatar.hu/id/01352_Neutral-Gr een-oko-zsiroldo-750-mL


Feladva: 2017-04-04    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: 750amelyNeutralGreenökozsírostanúsítjatisztítószerzsiroldotűzhelykörnyezetkímélősütőbiológiailaglehetővéfőzőlapkönnyenteszilerakódásainaklebomló

Forrás: pepitahirdeto.multiapro.com

Gázmegtakarítás 12-15%. Turbo Booster Gázfogyasztás csökkentő. ÁRA FÉL ÉV ALATT MEGTÉRÜL, utána folyamatos megtakarítás! Hivatalos engedéllyel! Bemérések és beszerelési útmutató a honlapunkon! www.patikamagazin.eu/?modul=oldal& tartalom=1205809


Feladva: 2015-11-05    [Vegyes hirdetések]

Címkék, kulcsszavak: GázmegtakarításfolyamatosBudapestmeregtelenitesutánaNEODYUMwwwMEGTÉRÜLhttpALATThonlapunkonFÉLútmutatóÁRAbeszerelésicsökkentőbemérésekGázfogyasztás

Forrás: pepitahirdeto.multiapro.com

Miért népszerűek a videók? Talán azért, mert képesek sokkal több vizuális üzenetet közvetíteni viszonylag rövid idő alatt... Meglehet, azonkívül még szórakoztatóbbak is néha, mint a megszokott webtartalmak. Így, vagy úgy nem véletlen, hogy egyre többen használjuk hirdetni valamit! Ennek ellenére egyenlőre nem fedezték a legtöbben azt, a videók is webtartalmak. Alapból nem kereshetőek, csak a videót tároló szolgáltatónál (például YouTube, Vimeo), ahová nem mindenki látogat azért el, ... további részletek >>

lássuk be! Léteznek a videók népszerűsítésére más módok is, mint nálunk is, a beágyazás... Jó ez is, de ez esetben a mi látogatóinknak válik kereshetővé csak, ami azért nem utolsó, de... Miért ne jelenne meg a Google keresésekben egy videó? Pláne, ha ott nagyságrendekkel többen keresnek valamit minden másodpercben! A Pepita Hirdető minden nyilvános videót kereshetővé tud tenni a Google-on, pont ugyan úgy, ahogy a hirdetéseket és a hirdetők webhelyeit! Csak kérnie kell! (Nem jár automatikusan senkinek sem sajnos...) Alább, a YouTube csatornánkon összeválogatunk néhány hirdetői videót... www.youtube.com/playlist?list=PLJKQOllTKBIMgTYld2pKPoldbPj5rcrYw


Feladva: 2017-07-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: nemcsakazértvideótvideókkereshetővéúgymindenvalamitwebtartalmakGoogleMiértmintYouTubetöbbenHirdetőPepitamégsokkalmindenkihirdetéseketpersze

Forrás: pepitahirdeto.multiapro.com

3 rétegű üveggel, 80 mm vastag, 6 légkamrás ablakok és ajtók, 2-4 héten belül legyártva a kívánt méretre. Beszerelést is szakszerűen kivitelezzük, 1994 óta nyílászárókkal foglalkozunk. Kizárólag német „A” osztályú minőség, 7 év teljes körű garanciával. Többféle műanyag, fa és alumínium nyílászárót forgalmazunk, biztosan megtalálja az Önnek megfelelőt. A legjobb nyílászáró árak nálunk vannak. Részletes árlisták: www.ablakajtoaruhaz.hu/hu/arlistak.html Rendelje meg most az ... további részletek >>

ablakait, a párkányt ajándékba adjuk minden 200.000.- Ft feletti rendeléshez Július 30-ig. A beépítést 6500.-/m2 áron végezzük. Nézzen körül weboldalunkon és a webáruházunkban: www.ablakajtoaruhaz.hu/hu/aruhaz/category/muanyag-ablak.html


Feladva: 2017-07-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: ablakajtoaruhazhttpshtmlablakáronmuanyagmostmegszakszerűenÖnneküveggelrendeléshezosztályúRendeljeBeszereléstmegtaláljarétegűfeletti8221arlistak

Forrás: pepitahirdeto.multiapro.com

Online kávé üzlet! Nemzetközi munkalehetőség kényelmesen otthonról! Új korszak az MLM üzlet történetében: A kezdőcsomagok árának 110-150%-a levásárolható www.kavekiraly.hu/blog-2014-12-22- DXN_DSP_Dynamic_Start_Program__A_ki t__B_kit__C_kit 70%-os heti bónuszkifizetés: www.kavekiraly.hu/blog-2014-12-01- DXN_DSP_Dynamic_Start_Program__Ingy enes_Ganoderma_kave_csomagok


Feladva: 2016-09-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kitwwwProgramStartDynamicDSPkávéDXNOnline2014blogkavekiralyüzletMLMGanodermaegészségesbónuszkifizetéskorszakIngyenesAkkorhetiotthonról150

Forrás: pepitahirdeto.multiapro.com

Balatonlellén családi ház már 5 személytől max 16 főre kiadó. Családoknak ideális. Ingyenes wifi, biztonságos parkolás zárt udvarban. Ár megegyezés szerint.


Feladva: 2015-10-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: családiBalatonlellénkiadóházudvarbanzártparkolásBalatonlellebiztonságosJánoswifiSzabóIngyenesideálisCsaládoknakszerintfőremegegyezés

Forrás: pepitahirdeto.multiapro.com

VATTACUKOR ÁRUSÍTÁS MEGRENDELÉSE RENDEZVÉNYEKRE! Az új édesség „Fairy Floss” magyarul annyit tesz: TÜNDÉRPEHELY. Gyermek-napok, koncertek, falu-, városnapok, családi napok, rendezvények rendszeres, megbízható résztvevői vagyunk! Manapság egy rendezvény már nem is képzelhető el vattacukor nélkül! Árainkat megegyezés szerint alakítjuk! Gépeink az összes élelmiszer higiéniai követelménynek megfelelnek! Számlaképesen várunk minden megrendelést, ahol arra szükség van.


Feladva: 2017-05-04    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: vattacukorRENDEZVÉNYEKREMEGRENDELÉSEÁRUSÍTÁSnapokmárszükségvárosnapokösszes8222rendezvényarrafaluGépeinkédességegyaholkoncertekalakítjukGyermek

Forrás: pepitahirdeto.multiapro.com

14 év iskolai angol tanítás után rádöbbentem, hogy csak egy helyben toporgok, nem jutottam közelebb a céljaimhoz. Elegem lett a hónapról-hónapra élésből, ezért elkezdtem keresgélni, mit is lehetne tenni annak érdekében, hogy több pénzt keressek, és több szabadidőm legyen. Ekkor találkoztam a Ganoderma kávéval a DXN online üzlet keretében. Bárki tudja csinálni és komoly befektetés nélkül elkezdhető, mindenféle diploma és előképzettség nélkül. Engem nagyon megfogott a személyre szabható honlap ... további részletek >>

is, amit a csatlakozáskor kaptam: http://kavekiraly.hu/uzleti_lehetoseg Rólam bővebben itt olvashatsz a honlapomon: http://kavekiraly.hu/az_en_tortenetem Csatlakozni itt tudsz: http://kavekiraly.hu/member_registration_private Keress bátran, ha kérdésed van: http://kavekiraly.hu/kapcsolat


Feladva: 2016-10-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kavekiralyhttptöbbnélkülhogyittszabhatólehetnevankomolyközelebbhonlapomonEkkoriskolaiszemélyremitkérdésedcsinálnijutottamolvashatszlegyen

Forrás: pepitahirdeto.multiapro.com

Hegesztő minősítő tanfolyamok indulnak a hét minden napján. A tanfolyamra jelentkezéshez ELŐKÉPZETTSÉG nem szükséges! Az MSZ EN ISO 9606-1 szabvány szerint lehetőség van magyar illetve német (TÜV) vizsga megszerzésére is. A magyar vizsgákhoz a Magyar Hegesztőminősítő Testület operatív szervezete az MHtE, a német vizsgákhoz a TÜV Rheinland Intercert Kft. biztosítja a vizsgabiztost. Kérésre egyszerre egy vizsgadarab meghegesztésével két bizonyítvány szerezhető, MSz és DIN szerinti is!


Feladva: 2016-01-10    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: tanfolyamokHegesztőnapmindenminősítőhétegyBudapestminősítésselWeldcontrolTÜVszerintszabványszükséges9606nem287ELŐKÉPZETTSÉGindulnak

Forrás: pepitahirdeto.multiapro.com

Siófoki Aranyparton apartmanok szabad strand mellett kiadók. Földszinti 3 szobás,fürdőszobás, konyhával nappalival, Tv, hűtő, kertkapcsolatos apartman 4-5-6 főnek. emeleti 1 szobás fürdőszobás, tv. hűtő felszereltséggel. Ebből 2 db van. Szép kártyát elfogadunk. Légkondi igényelhető térítés ellenében. Bővebben: gosyapartmanok.info


Feladva: 2016-09-29    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: hűtőfürdőszobásszobásapartmanokSiófokiBővebbenvízpartimellettellenébenstrandtérítésszabadigényelhetőemeletiLégkondifőnekAranypartonelfogadunkSzép

Forrás: pepitahirdeto.multiapro.com

Eladó 2 emeleti (!!!) napfényes, déli fekvésű gázkonvektoros lakás. A lakás körbe lakott, ezért minden oldalról fűtött falak veszik körbe, a rezsi minimális. A szoba hagyományos parkettás, a többi helység járólapos. parkra néző, nincs utcazaj, por. A lépcsőház kulturált a bejárati ajtó, lépcsőház ablakok kivannak cserélve hőszigeteltre. Külön WC, fürdőszoba! A konyha az előtérből nyílik nem a szobán át kell megközelíteni, mint a legtöbb garzonban. Ingatlan ügynökök, hirdető cégek kíméljenek! ... további részletek >>

Érdeklődni: +36 30 575 3168, +36 70 588 8033


Feladva: 2017-10-07    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: Eladólépcsőházlakáskörbehőszigeteltredéli588nézőmintveszikcserélvenapfényes3168parkramegközelítenifalakkivannakemeleti575járólaposkelltöbbi

Forrás: pepitahirdeto.multiapro.com

Három és négy napos jobb agyféltekés rajzolás ID módszerrel kurzusok akciósan 17500 Ft-ért eszközökkel együtt. Mindenkinek sikerül!


Feladva: 2017-04-30    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: rajzolásagyféltekésjobbeszközökkelHáromértBudapest17500DezsőakciósanImrekurzusokakciómódszerrelsikerülMindenkineknaposegyüttnégy

Forrás: pepitahirdeto.multiapro.com

Kedves Vendégek! Sok szeretettel várjuk Önöket a Büki Gyógyfürdő bejáratától 250 m-re található apartmanházainkban!


Feladva: 2016-08-17    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SzállásÖnöketvárjukszeretettelSokVendégekapartmanházainkbanKedvestalálhatóBükfürdő250ApartmanbejáratátólMolnárGyógyfürdőBükfürdőnBüki

Forrás: pepitahirdeto.multiapro.com

C#.net programozó állás Debrecenben! Friss diplomásoknak, végzős Programozó és Informatikus hallgatóknak... Feltételek: - Felsőfokú szakirányú végzettség - Minimum középfokú angol nyelvtudás - A programozás szenvedélyes szeretete Részletek: www.jobs.ozeki.hu/index.php?owpn=2 5 Jelentkezés módja: A job@ozek i.hu e-mail címre beküldött fényképes önéletrajzzal és a pozícióhoz kapcsolódó jelentkezési adatlap pontos kitöltésével. Folyamatosan várjuk a jelentkezőket!


Feladva: 2016-03-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: netProgramozójob@ozekiszakirányúpontosmódjaFelsőfokúadatlapOzekiJelentkezésFeltételekjelentkezésifejlesztőszeretetehallgatóknakkapcsolódószenvedélyes

Forrás: pepitahirdeto.multiapro.com

150% nyereség 10 napon belül. Hogyan működik? Regisztrálj most és kapj 100 $ bónuszt azonnal. Az ajánlat csak az újonnan regisztrált tagok számára érhető el.


Feladva: 2017-11-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: ajánlatHogyanújonnanbelülcsaknaponnyereségazonnal150bónusztElvira100KedvezőkapjérhetőmostszámáraRegisztráljtagokműködikregisztrált

Forrás: pepitahirdeto.multiapro.com

Nyugtató-lazító hatás: a test átmelegszik, könnyeddé válik az idegek kisimulnak az izmok ellazulnak az idegrendszer megnyugszik a vér- és nyirokkeringés megélénkül javul a sejtek oxigén- és tápanyagellátása salak- és méreganyagok kiválasztása hormonális hatás (érintésre a szervezet endorfin és oxitocin hormont állít elő, amelyek a test saját stressz- és fájdalomcsillapító szerei).


Feladva: 2015-08-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatástestméreganyagokpozitívellazulnakelőNagysalakhogyizmokállítmasszástápanyagellátásacéljakisimulnakhormontrelaxációsoxigénvégzőidegekválik

Forrás: pepitahirdeto.multiapro.com

DOKA PERI monolit födém zsaluzatok készítése, bérbeadása, értékesítése. Vasszerelések összeállítása, födém betonok készítése


Feladva: 2015-07-08    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: készitésefödémbérbeadásaBélamonolitZacharovitsPERIDOKAzsalufarmösszeállításawwwszerelésekcomvaszsalufarm@gmailértékesítése9006426zsaluzatok

Forrás: pepitahirdeto.multiapro.com

Szeretné, ha haja egészséges, csillogó és dús lenne? Szeretne kellemes környezetben, igazi szakemberek által gyógyulni, szépülni? Nem elégedett a boltokban kapható hajápoló termékekkel? Szalonunk a következő szolgáltatásokat ajánlja: -Hajgyógyászati kezelések: hajhullás, kopaszodás, korpa, zsírosodás, száraz, vékony, töredezett haj és fejbőr panaszok problémájára. Több mint 20 éves tapasztalattal! Személyre szabott kezelési programok, professzionális gyógyászati anyagok, komfortos érzés ... további részletek >>

kezelés közben! Mikrokamerás hajdiagnosztika, fejbőr és hajvizsgálat -Biofodrászat: Haj-állapotfelmérés speciális kamerával. Az Ön stílusának és hajszerkezetének legmegfelelőbb módszerekkel dolgozunk. Vegyszermentes hajfestés a haj szerkezetét erősítő festékkel, (maximális őszfedéssel) Természetes eredetű styling anyagok (hajhab, zselé, hajlakk), melyek meg is vásárolhatóak! Referenciaszalonunkban speciális, biológiailag aktív növényi hatóanyagokkal dolgozunk! Hajmosás, styling, vágás személyre szabottan, az ön haj-és fejbőrtípusának megfelelően. Ionos hajszárítás, kolloid ásványi anyagokkal történő hajfeltöltés. Vegyszermentes hajfestés, hajszerkezet-visszaépítés, vékonyszálú haj erősítése Egyedülálló, a hajszálak szerkezetébe beépülő biológiailag aktív növényi hatóanyagaink biztosítják, hogy az Ön frizurája nemcsak szép, hanem egészséges is legyen!


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hajBiofodrászatnövényifejbőraktívhajfestésSzeretnebiológiailagVegyszermentesegészségesszemélyrekezelésekstylingHajgyógyászatianyagokdolgozunkNovotni

Forrás: pepitahirdeto.multiapro.com

Profi Őrzés Többéves szakmai tapasztalattal, jól képzett szakemberekkel. Biztonságtechnika · Magánnyomozás · Komplex biztonságtechnika · Őrzés-védelem A Justice Security olyan tanácsadó és szolgáltató vagyonvédelmi cég, mely igyekszik teljes körű szolgáltatást nyújtani, ha vagyonvédelemről van szó.


Feladva: 2017-07-14    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: Őrzés183szakmaibiztonságtechnikacégszódíjnyertesszolgáltatószakemberekkelvantanácsadóképzettvagyonvédelemrőlolyanjólnyújtaniSecuritytapasztalattal

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! A Szuvorov Kft. édesipari termékek importálásával és forgalmazásával foglalkozik. Szeretnénk, hogy minél több helyen jelenjenek meg termékeink, ezért várjuk viszonteladók jelentkezését! Szerződött partnereinknek akár kizárólagos forgalmazási jogot tudunk biztosítani, terület megjelöléssel! Az ország távolabbi pontjain található kiskereskedelmi egységek számára, (megrendelt mennyiségtől függően) ingyenesen szállíttatjuk ki megrendeléseiket. Termékeink ... további részletek >>

megtekinthetőek a honlapunkon.


Feladva: 2016-10-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TermékeinkSzuvorovtalálhatóUramakárminélpontjainHölgyempartnereinknekhogymegrendeléseikettávolabbiTiszteltSzerződöttSzeretnénkszállíttatjukország

Forrás: pepitahirdeto.multiapro.com

Cseh és magyar szövegek fordításával foglalkozó csehországi számlaképes magánvállalkozó vagyok. Aprólékosabb, illetve további információt honlapomon találhat.


Feladva: 2016-08-01    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: CsehtalálhatfordításávalhonlapomonszövegekinformációtmagyartovábbiilletveLetoviceAprólékosabbFerdinandvagyokTóthmagánvállalkozófordításszámlaképes

Forrás: pepitahirdeto.multiapro.com

Állást keres? Vizsgázik? A táblázatkezelés, az adatbázis-kezelés egyáltalán nem nehéz! Meg fogja látni, mennyire egyszerű az Excel, az Access, vagy a Word, a PowerPoint. Milyen szép dolgokat lehet Corel vagy Flash segítségével létrehozni. Egyszerűen, gyorsan megérthető. Forduljon hozzám! Tapasztalataim szerint az egyéni foglalkozás előnye, hogy kevesebb idő alatt, hatékonyabban lehet elsajátítani az új ismereteket, mivel csak Önre figyelek, mindennel csak addig foglalkozunk, ameddig ... további részletek >>

Ön igényli, nem kell senkihez sem igazodnia. Fontos előny az is, hogy nincs ”kihagyott” óra. Csoportban, ha Ön nem ér rá, nem tud az órára eljönni, a csoport halad tovább, Így Önnek, ha a lépést tartani akarja, pótolnia kell a kimaradt óra anyagát. Szívesen tanítok csoportokat is, ebben is hosszú múltra tekinthetek vissza.


Feladva: 2016-07-21    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nemtáblázatkezeléshogyóravagykelllehet8221kezelésadatbázisEgyszerűencsakkevesebbtovábblétrehoznimindennelExcelanyagátelőnyeVizsgázikhalad

Forrás: pepitahirdeto.multiapro.com

Horvátország, Dalmácia, Zadari Riviéra. Budapesttől 630 km-re, 4 nemzeti park közelében, Zadartól 15 km-re északra Privlakán, közvetlenül a tengerparton 40.000 nm-en fenyőfák árnyékában helyezkedik el a Dalmacija Camp***Holiday Komplex, sekély, homokos, köves öböl szélén, jól kiépített stranddal, parti zuhanyozókkal. Itt minden megtalálható, élelmiszerbolt, zöldséges, pizzéria, bajor söröző, grillház, parti pub, étterem, gyerekjátszótér, szép, tiszta vizesblokkok, wifis pub, fagyizó. Itt ... további részletek >>

ajánlunk összközműves 4-6-8 fős, 2-3 szobás, nappali-konyhás, fürdő-wc-s, klímás, wifis, kábeltv-s mobil-home apartman házakat nagy terasszal, heti (heti 210 euro-tól) és telepített klímás, wifis, tv-s lakókocsikat (heti 30 e Ft-tól). 2007 óta várjuk érkező utasainkat. Áraink 10-20 %-al olcsóbbak a kemping árainál. Magyar iroda, programok, kölcsönző. Videó ajánlásaink: www.youtube.com/user/TravelVirServis


Feladva: 2017-04-13    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: hetiwifisHorvátországpartitólIttpubklímástisztaPrivlakánÁrainkmegtalálhatótelepítettkonyhásKomplexwwwszépészakrautasainkateuromindennappali

Forrás: pepitahirdeto.multiapro.com

A száj fertőtlenítő propolisz fogkrém használata természetes módját jelenti a rendszeres fogápolásnak. Vele javíthatjuk a fogak és az egész szájüreg egészségét, elejét vehetjük a gyakran a fogak elvesztését okozó ínybetegségnek. A propolisz hatásai a fogakra kórokozó ellenes tulajdonságainak köszönhetőek. A benne lévő flavonoidok gondoskodnak a baktériumok távol tartásától és legyőzéséről, ha azok már megfertőzték a szájüreget. Használata ajánlott azoknak is, akik már ínygyulladással vagy ... további részletek >>

fogínyvérzéssel küzdenek. A száj fertőtlenítő propolisz fogkrém véd a szájpenész és az afták ellen is. www.propolisz.fluormentes.com/propolisz-tinkturat


Feladva: 2017-07-06    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: propoliszfogkrémfogakHasználatafertőtlenítőszájmárelvesztésétajánlottrendszereslévőjelentibennegyakranmódjátszájüregetköszönhetőekvehetjükelejét

Forrás: pepitahirdeto.multiapro.com

A méh pempő nemcsak étrendkiegészítőnek kiváló, de a bőr- és hajápoláshoz is az egyik legjobb termék. A méhek állítják elő, hogy ezzel a sűrű, ragacsos anyaggal táplálják királynőjüket. A méh pempő áldásos hatásait az ember már korán felfedezte és alkalmazza ma is szinte valamennyi betegség ellen sikeresen. Hatásait annak köszönhetjük, hogy benne rendkívül sok hasznos anyag található. A létfontosságú tápanyagok mellett számos más értékes összetevőt tartalmaz, többek közt acetilkolint és 10-HDA ... további részletek >>

savat is. Ezek adják intenzív gyulladásgátló antivirális és az agyműködést elősegítő hatásait.


Feladva: 2017-07-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásaithogypempőméhkiválóértékessűrűbenneétrendkiegészítőnekintenzívkoránmásezzelnemcsakadjákmárszámoselőköszönhetjükKittiEzekemberannak

Forrás: pepitahirdeto.multiapro.com

Alsóörsi kiadó szálláshelyek fényképes gyűjtőoldala. Panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Több mint 100 fényképpel a szálláshelyekről és a településről! - SZÉP kártyát elfogadó szálláshelyek Alsóörsön - Egész évben nyitvatartó (kidó) szálláshelyek - Weboldal: www.zimmerinfo.hu/alsoors/hu.htm


Feladva: 2017-11-08    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfonélkülvillákAlsóörsöndíjhtmvendégházakelfogadóközvetítésialsoorsPanziókkártyátszálláshelynélgyűjtőoldalaSZÉPlehetőséghttp

Forrás: pepitahirdeto.multiapro.com

Építésvezetőt keresünk felvételre, az alábbi elvárásokkal. Szakmai önéletrajzokat a hazai@upcmail.hu e-mail címre várjuk. FŐBB FELADATOK, MUNKÁK: Kivitelezési munkák teljes körű helyszíni koordinálása, alvállalkozók munkájának irányítása Ütemtervek készítése, határidők betartása és betartatása Árkalkulációk, anyagrendelések előkészítése, elektronikus építési napló vezetése Minőségi munka megkövetelése és ellenőrzése Minden egyéb építésvezetői feladat AZ ÁLLÁSHOZ TARTOZÓ ELVÁRÁSOK: ... további részletek >>

Legalább 3 éves kivitelezésben történt szakmai gyakorlat (magasépítés) Önálló és felelősségteljes munkavégzés Jó szervező és koordináló képesség Nagy terhelhetőség, rugalmasság Problémamegoldó- és feladat centrikus hozzáállás Jó kommunikációs képesség B kategóriás jogosítvány, saját gépkocsi ÁLLÁS, MUNKA TERÜLETE(I): Építőipar, Kivitelező, General kivitelező MUNKAVÉGZÉS HELYE: Rugalmas munkavégzési hely – Budapest-Pest megye


Feladva: 2017-09-19    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: feladatszakmaiMUNKAmunkákMUNKAVÉGZÉSképességkivitelezőbetartatásaPestteljesellenőrzésealábbiProblémamegoldóbetartása8211történtÁLLÁSmegkövetelése

Forrás: pepitahirdeto.multiapro.com

Hatékony nyelvtanulás kezdőknek és újrakezdőknek. Közérthető nyelvtani leírások, érthető magyarázatokkal. Az otthoni tanulás segítője.


Feladva: 2017-09-12    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nyelvtanulásHatékonymagyarázatokkalérthetőleírásoknyelvtaniKözérthetőújrakezdőknekkezdőkneksegítőjetanulásIstvánotthoniotthon

Forrás: pepitahirdeto.multiapro.com

Robway Hoverboard-ok széles választéka. Legjobb minőség, garancia, Samsung akkumlátor, Bluetooth, Innovatív applikáció. 79.900 Ft-tól www.cityroll.hu/robway.html


Feladva: 2017-09-22    [Autó - Motor - Jármű]

Címkék, kulcsszavak: robwayHoverboardBluetoothHirdetőakkumlátorPepitaSamsunghtmlgaranciaminőségcityrollLegjobbwwwválasztékatólszéles900applikációGyőrInnovatív

Forrás: pepitahirdeto.multiapro.com

Még mindig a leghatékonyabb módja a dohányzás leszoktatásnak a biorezonanciás kezelés. Kínlódás, és elvonási tünetek nélkül. A biorezonanciás kezeléssel megszűnik a nikotin éhség. Stresszoldást és általános méregtelenítést is adunk,a tartós eredmény érdekében. A rögzült szokások oldását életmód tanácsokkal segítjük. A kezelés személyre szabott, kérjük hozza el magával az utolsó szál, félig elszívott, majd eloltott cigarettáját. Időpont egyeztetésre hívjon a megadott telefonon.


Feladva: 2017-05-19    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kezelésMégbiorezonanciáskérjükDebreceneredményIdőpontnélkülszabott06309074786tartóscigarettájáttünetekszemélyrecigarettátóladunkeloltottelvonási

Forrás: pepitahirdeto.multiapro.com

Mindig akad, aki mindent maga csinál, mert mindenki másnál jobb, ügyesebb... Jó sokan vannak, de valahogy mégis láthatatlanok maradnak, mert azért mégsem úgy vannak az internetes megjelenés alapvetései, ahogy ők gondolják. A Pepita Hirdető kínál olyan megoldásokat, amivel láthatóvá lehet válni a weben, csak kérni és használni kell... Szolgáltatásaink ebben: www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60547


Feladva: 2016-04-23    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: látszanivannakHirdetőmertPepitalehetMindigmegjelenéssokanláthatóváinternetesügyesebbamivelnemjobbmegoldásokatvagyúgymásnálolyaninterneten

Forrás: pepitahirdeto.multiapro.com

Budapestiek figyelem! Ha szeretne egy csendes kisvárosban élni, vagy nyaralót venni, itt a lehetőség! Gyomaendrődön, a vizek városában, 20 m-re a holtághoz közel - ami intenzíven telepített (harcsák, amurok, pontyok és más ragadozó halak vannak) 80 nm-es ház eladó. Az ingatlan a 60-as években épült, vegyes a falazata tégla, illetve vályog 50 cm-es falvastagsággal. Nyáron hűvös, télen meleg... Nem repedezett, penészes, 2006-ban nyílászáró csere, burkolás, festés és háromfázisú áram ... további részletek >>

lett bevezetve. Az udvari rész 1400 nm, melyben sok gyümölcsfa, alsó épület, garázs található. Családoknak is ajánlom, CSOK igénybe vehető. Az ingatlan per és teher mentes. Nos kíváncsiak, hogy mennyi az ára? Bútorral is eladó 10 millió forint, bútor nélkül 9 millió forint. Komoly érdeklődés esetén az árból engedek!


Feladva: 2017-09-11    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóvárosábanvizekingatlanházmennyi2006holtághozárbólajánlomilletvekisvárosbanudvarihalakbútorralhogypenészes20mengedekcsaládoknaktéglaegy

Forrás: pepitahirdeto.multiapro.com

Divat tippek a teltkarcsú nőknek! A Sylverro Kft. webshopjában mintegy 800 ruházati termék között böngészhet ünnepi és mindennapos ruhák, vagy trendi viselet után kutatva. Üzleteinket személyesen is felkeresheti! Címek, nyitvatartási idők: www.molettdivat.hu/s.uzletek


Feladva: 2017-09-14    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: teltkarcsúDivatnyitvatartásimindennaposnőknekCímekünnepifelkereshetiböngészhettippekszemélyesenközöttÜzleteinkettermékajánlókutatvaruházatiHirdető

Forrás: pepitahirdeto.multiapro.com

Ön kötött biztosítást a lakására, az autójára? Bizonyára igen a válasza. És arra, aki mindezt létrehozta, egy élet munkájával előteremtette, vagyis önmagára kötött-e biztosítást? Ne késlekedjen! Az UNIQA Puzzle balesetbiztosításával korszerű, sokoldalú és magas összegű szolgáltatásokat fizető biztosítással vértezheti fel magát, illetve családját. Tájékozódjon: nézzen bele a www.privatbiztositasok.nanoweb.hu< /a> honlapba, s keresse a Rizikókat.


Feladva: 2013-09-04    [
Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: igenegybiztosítástkötöttprivatbiztositasokválaszaszolgáltatásokatönmagárabeleösszegűvagyisBizonyáranézzenmagaselőteremtetteautójáraTájékozódjonélet

Forrás: pepitahirdeto.multiapro.com

Statikus szakvélemény készítése: - ingatlan vásárlásnál - falkivételnél - átalakításnál - tetőtér beépítésnél - falak repedéseinél - süllyedésnél vagy csak azért, hogy nyugodt legyen ingatlana állapotára vonatkozóan.


Feladva: 2015-10-26    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: szakvéleményStatikusbeépítésnélingatlanatetőtérlegyenátalakításnálnyugodtfalkivételnélhogyvásárlásnálazértingatlancsakkészítésevagysüllyedésnélKft

Forrás: pepitahirdeto.multiapro.com

A Tilta Gravity G1 egy rendkívül könnyű, egyszerűen kezelhető, csúcsminőségű egykezes gimbal, professzionális használatra. Köszönhetően a 0-tól 3 kg-ig terjedő terhelhetőségének, kompatibilitása egyedülálló: a nehezebb DSLR konfigurációtól, a MILC és GoPro kamerákon át az okostelefonig szinte bármivel használható. Ezt nem csak a kifinomult vezérlésnek és a páratlanul erős motoroknak, hanem az egyedülálló váz-kialakításnak köszönheti, amely hosszabb és erősebb, mint bármely más egykezes ... további részletek >>

gimbalnál. Kiterjeszti az alkalmazhatóságát a gimbal markolat felett elhelyezkedő jobb és baloldali rozetta, amelyre monitor, mobil telefon (élőképhez), follow focus vagy más kiegészítő csatlakoztatható. A Gravity G1 markolata egy mozdulattal eltávolítható és a rozetták segítségével egyszerűen kétkezes gimballá alakítható. A működés finomhangolása bluetooth kapcsolaton keresztül a TILTA Assistant App (Androidra és iPhone-ra) segítségével történik. Bővebben: www.gaia.hu/tilta-gravity-g1-gimbal-stabilizator-grt02g1.html


Feladva: 2017-09-04    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: gimbalgravitytiltamássegítségévelegyszerűenegyedülállóegyegykezesbármelyKöszönhetőenfinomhangolásaerőskameracsatlakoztathatókamerákonBővebbenmint

Forrás: pepitahirdeto.multiapro.com

Trump megnyittatja a Kennedy-gyilkosság titkos aktáit A rejtély, hogy Oswald volt-e a gyilkos, és ha igen, magányos elkövető volt-e, vagy egy szélesebb összeesküvés része, a mai napig nem oldódott meg. Itt olvashatsz róla: www.goo.gl/FCQvko Itt, pedig tovább kereshetsz (Google keresőnk): www.pepitahirdeto.multiapro.com/ap ro.php?page_id=60546


Feladva: 2017-10-27    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: KennedygyilkosságvoltIttwwwFCQvkopageOswaldmaipedig60546napigtovábbPepitagyilkosnemkereshetszHirdetőigenoldódottGoogleajánlásmagányos

Forrás: pepitahirdeto.multiapro.com

ÜZLET AHOL SENKI NEM VESZÍTHET! SunMoney az első világot behálózó KÖZÖSSÉGI NAPERŐMŰ PROGRAM - Az üzletet építheted online is - Itt nincs havi kötelező befizetés - Itt nem terméket kell venni, hanem egy termelő eszközt vásárolunk


Feladva: 2016-09-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemIttsunmoneywebofficeSENKIegyonlinehttpsAHOLhanemépíthetedRegisztrációÜZLETvenniüzletetcomTiborkellPROGRAMsunmoneyonlineNaperőművedbotibi

Forrás: pepitahirdeto.multiapro.com

Bizonyára Ön is megbízható, jó műszaki állapotban lévő autóval szeretne közlekedni. Ehhez szükséges a rendszeres karbantartás,autóhűtő javítás, ellenőrzés és gyakran némi szak-tanácsadás autóhűtője optimális üzemeltetésével kapcsolatban. Bízza autóhűtőjét olyan szakemberekre akik az Ön biztonságán kívül az elégedettségére is pályáznak és szem előtt tartják, hogy legközelebb is minket - a minőséget - válassza! Várjuk régi és új ügyfeleinket: Érdről és a környező településekről műhelyünkbe.


Feladva: 2017-05-02    [Autó - Motor - Jármű]

Címkék, kulcsszavak: javításautóhűtőkapcsolatbanÉrdrőlkarbantartásszemBizonyáraüzemeltetésévelügyfeleinketrendszerespályáznakBrigittaoptimálisrégiszükségeselégedettségére

Forrás: pepitahirdeto.multiapro.com

Modell XO-3001US Állapot Új Anyaga: nemesacél Magas fényű Közepén pörgethető láncbetéttel Szélessége: 49-től 57-ig 6 mm Szélessége: 59-től 72-ig 8 mm Belső része domborított, így viselése nagyon kényelmes Súly: 6.70 gramm www.klugex.ekszer.center/69-nemesa cél-gyűrűk


Feladva: 2017-07-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: nemesacélKözepéntőlSzélességekényelmesKarikagyűrűnagyonfényűviseléseMagasgyűrűkígyAnyagadomborítottÁllapotcenterrésze3001USekszerBelsőModell

Forrás: pepitahirdeto.multiapro.com

Fájdalommentes és esztétikus fogszabályozás, a Fogszabályozás Centrum segítségével. Jöjjön el egy ingyenes konzultációra és minden lehetőségről tájékoztatjuk. GYERMEKKORI FOGSZABÁLYOZÁS oldalunk: www.fogszabalyozascentrum.hu/index .php/BLOG/Gyermekkori-fogszabalyoza s


Feladva: 2017-06-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: FogszabályozáshttpesztétikustájékoztatjukmenteslehetőségrőlFájdalommindenBudapestkonzultációragyermekingyenesFelnőttegyJöjjönsegítségévelCentrum

Forrás: pepitahirdeto.multiapro.com

KOBRA AF.1 - a leggyorsabb automata iratmegsemmisítő - 24 óra folyamatos használat - fém hajtáslánc, acél fogaskerekek, edzett acél vágókések - nem szükséges olajozni a vágókéseket - 135 literes hulladéktartály www.kobra-shredder.eu/hu/af1


Feladva: 2016-08-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: kobrairatmegsemmisítőautomatashredderacélwwwhasználatvágókéseketfolyamatosolajoznióraszükségesnemvágókésekleggyorsabbedzettfogaskerekekhajtáslánc

Forrás: pepitahirdeto.multiapro.com

PD Generál Kft Bontásban az első! Gépi földmunkát vállalunk, főképpen Baranyában, de nagyobb volumenű munka miatt az országba bárhova képesek vagyunk elmenni. Az ár mennyiségtől - időtartamtól és helytől függ. Hívjon minket bizalommal, biztosan meg egyezünk!


Feladva: 2016-10-12    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GépiegyezünkföldmunkavagyunkföldmunkátmegbontásképesekbiztosanbárhovaelsőbizalommalországbaBontásbanminketmiattKftHívjonmunkaGenerálfügg

Forrás: pepitahirdeto.multiapro.com

A bélflóra egészségünk szempontjából hasznos és káros baktériumokat is tartalmaz. Több száz mikroorganizmus él itt, alapvetően egyensúlyban. Ám számos tényező van, ami ezt az egészséges egyensúlyt felboríthatja, pl. a stressz, a dohányzás, az alkoholfogyasztás és az antibiotikumok. Miért fontos a bélflóra helyreállítása? A károsodott bélflóra nem tud kellő támogatást nyújtani az immunrendszernek, így ha nem gondoskodunk a regenerálásáról, hosszútávon egészségünk romlani kezd, akárcsak a ... további részletek >>

közérzetünk, vitalitásunk. Ha gyakran kapunk el fertőzéseket, gyanakodhatunk! A bélflóra helyreállítása probiotikummal 100%-ban természetes módon történhet.


Feladva: 2017-04-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: bélflórahelyreállításaegészségünkfontosMiértnemkellőprobiotikummalegészségesTöbbromlanitudezttartalmazkárosodottamibaktériumokathosszútávonvan

Forrás: pepitahirdeto.multiapro.com

A fekete bodza sok olyan hatóanyagot tartalmaz, melyekkel hosszútávon is növelhetjük védettségünket a különböző betegségekkel szemben. Az immunerősítéshez az egyik legjobb gyógynövény, hiszen hatékony a vírusokkal, baktériumokkal szemben vívott harcban, természetes antibiotikumként viselkedik, miközben a már fennálló betegség tüneteinek csökkentésére is képes. A Sambucol bodza szirup gyerekeknek is egész évben adható étrendkiegészítő, melyet a láz és a köhögés csillapításához is használhatunk. ... további részletek >>

Biztonságos és rendszeresen alkalmazható székrekedés és bélgyulladások esetén. Sambucol fekete bodza szirup rendelés itt!


Feladva: 2017-05-23    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: bodzaszirupSambucolszembenfeketeimmunerősítéshezrendszeresengyerekeknekKittiharcbanittbetegségekkelBiztonságosképesKellérvívottrendeléskülönböző

Forrás: pepitahirdeto.multiapro.com

A Balaton-felvidéken, Badacsonyhoz 5 km távolságra káptalantótii szálláshelyek fényképes gyüjtőoldala. Kiadó panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Sok fényképpel a szálláshelyekről és a faluról. - Weblap: www.zimmerinfo.hu/kaptalantoti/hu. htm


Feladva: 2017-05-10    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: zimmerinfoszálláshelyekközvetítésipanziókszálláshelynélKiadówwwlehetőséggyüjtőoldalahttpfoglalásifényképesWeblapközvetlenfalurólelérhetőségükkelSok

Forrás: pepitahirdeto.multiapro.com

Eger belvárosában, a Gólya utcában, a vár és a strand között középen (az EKE. B. épületétől 2-4 perc, a Líceumhoz 4-5 perc, a Leányka utca 5-10 perc séta) ELADÓ EGY FÖLDSZINTI LAKÁS! 18 Millió Ft. Érdeklődni: 20/9680-016 A lakás 59 m2, 2,5 szoba. A szobák parkettásak, a fa ablakok redőnnyel és ráccsal védettek. A fűtés, gáz konvektorral, a meleg víz átfolyós gáz víz melegítővel. Az előszoba 6 m2, a nappali 18 m2., a szoba 15 m2, fél szoba 6,5 m2, konyha 7,5 m2, fürdő ... további részletek >>

szoba 2,9 m2, speiz 1 m2, balkon 2,5 m2 / a szobából nyílik. A pincében egy 4 m2. nagyságú zárt tároló tartozik a lakáshoz. Közös költség 9400.- Ft.


Feladva: 2017-09-04    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: szobapercEgerlakásegybelvárosábanvízgázFÖLDSZINTIELADÓvárnappaliredőnnyelsétautcábanelőszobaablakokpincébenGólyamelegítővelparkettásakutca

Forrás: pepitahirdeto.multiapro.com

Elege van a magas közös költségből? Szeretné csökkenteni kiadásait? Válassza az AXA Trend Kft. szolgáltatását! Professzionális társasházkezelés; közös képviselet; társasházak és lakásszövetkezetek jogi képviselete; könyvelés; könyvvizsgálat! Amennyiben az Ön társasháza – közgyűlési határozat alapján – szerződést köt az AXA Trend Kft. társasházkezelővel, a társasház közös képviseletére, akár 10%-al csökkenthetjük a közös költséget.


Feladva: 2015-10-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: közösKftTrendAXA8211társasházkezelésProfesszionálistársasháztársasházaszolgáltatásáttársasházkezelővelAmennyibenVálasszakönyvvizsgálatkiadásaitSzeretné

Forrás: pepitahirdeto.multiapro.com

Gerincsérv, derékfájás, lumbágó, isiász, hátfájás, porckorongsérv, térdfájdalom, ízületi fájdalom? Meglepő fájdalomcsillapító tapasztalatok egy 7 perces VIDEÓban! 4 ember mondja el tapasztalatait és azt, hogy pontosan mit csinált!


Feladva: 2015-12-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Gerincsérvizületitapasztalataitporckorongsérvmondjahátfájás33580emberisiász4124VIDEÓbanlumbágóclikapercderékfájáshttptapasztalatokcsináltMarcsi

Forrás: pepitahirdeto.multiapro.com

Hölgyeim és Uraim! Engedjék meg hogy bemutatkozzam,Ábrahám Zsolt vagyok Esküvői és Parti Dj. Minőségi szolgáltatást nyújtok elérhető áron számlaképesen, országosan! Céges rendezvényre, Születésnapra, vagy egy fergeteges szilveszteri bulira is szívesen megyek. Elérhetőségem: 0620/274-0390 Az Őszi ár akció elkezdődött! 25%kedvezmény, minden Esküvő árából! Leinformálható nívós referenciával, komplett minőségi hang és fénytechnikával,(RCF hang, ledes lámpák fények, Pioneer Dj pult, Shure ill, ... további részletek >>

Sennheiser mikrofonok. Zenéim a hetvenes évektől napjainkig(retro, pop, rock, rock&roll, alternatív, funky, stb. Magyar és külföldi top slágerek, vagy igény szerint mulatós zenéimre táncolhatnak, IDŐKORLÁT NÉLKÜL akár hajnalig.www.edjbier.hu zsoltbraham@freemail.hu Budapest XXII. ker


Feladva: 2017-10-16    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: CégeshangminőségiBudapestrendezvényreZsoltrockÁbrahámvagynyújtokNÉLKÜLUraimMagyarkedvezményZenéimszilveszteriszolgáltatástIDŐKORLÁTRCFHölgyeim

Forrás: pepitahirdeto.multiapro.com

Vállalom családi házak kivitelezését, átalakítását, felújítását, burkolást, hőszigetelést, gipszkarton szerelést, térkövezést, illetve mindennemű kőműves munkát. Hívjon bizalommal!


Feladva: 2016-10-24    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kőműveshőszigeteléstmunkákatburkolástbizalommalfelújítástHívjonátalakítástmunkátkivitelezésétházakmindenneműcsaládiilletveVállalomtérkövezéstIstván

Forrás: pepitahirdeto.multiapro.com

Masszázskrémek, olajok profi masszőröknek, wellness, szépség stúdióknak, vagy otthonra. Masszőrök, kozmetikusok, természetgyógyászok az országban bárhol, kedvező áron vásárolhatnak masszázskrémeket, olajokat, higiéniai papír és textil árukat, masszázskellékeket. www.harmoniamasszazskellek.hu Rendelési összeghatár nincs, kedvező kiszállítási díjak!


Feladva: 2016-03-16    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: kedvezőolajokMasszázskellékdíjaktextilMasszőrökHarmóniakiszállításipapírotthonragyógykrémekhigiéniaivagyMasszázsnincsolajokatstúdióknakösszeghatár

Forrás: pepitahirdeto.multiapro.com

Idős személy ápolását gondozását vállalom, egészségügyi tapasztalattal.


Feladva: 2017-10-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vállalomgondozásátápolásátszemélyIdősDebrecen06309074786tvállalokgondozástapasztalattalÁpolástegészségügyi

Forrás: pepitahirdeto.multiapro.com

Alaplap javítás garanciával! Laptop, notebook alkatrészek eladása, burkolat, és zsanér javítás, csavarpótlás...


Feladva: 2017-07-15    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: javításalkatrészeknotebookLaptopgaranciávalAlaplapNagykőröscsavarpótlásajánlóHirdetőzsanérPepitaburkolatszervizeladásaLaptopalkatrészek

Forrás: pepitahirdeto.multiapro.com

Tel: 06 20 2374592 gazm ester@agl.hu Ne engedje hogy a rágcsálók megzavarják Budapesti otthona nyugalmát! Rágcsálóirtásnál fokozott figyelmet fordítunk arra hogy illetéktelenek valamint a haszonállatok ne férjenek Budapesten hozzá a rágcsálóknak szánt irtószerhez. Hogyan veheti igénybe budapesti rágcsálóirtási szolgáltatásunkat?


Feladva: 2017-10-21    [Lakossági szolgáltatás]

Címkék, kulcsszavak: budapestihogyfigyelmetrágcsaloirtórágcsálóknakfokozottegérirtáshozzáRágcsálóirtásnálpatkányirtásBudapestennyugalmátszolgáltatásunkatRágcsálóirtásférjenek

Forrás: pepitahirdeto.multiapro.com

Szeretnél egy könnyen megjegyezhető domain nevet és egy weboldalt? Esetleg tetszenek a rövidebb, pár betűből álló domain kombinációk? Vagy egy régi, koros domainnel szeretnéd segíteni a weboldaladat, hogy már az elején előnnyel indulj a többi lappal szemben? Bővebb információ és az eladó weboldalak teljes listája itt tekinthető meg: www.eladhatatlan.hu/elado-domain-w eboldal


Feladva: 2016-04-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: domainegyeladóweboldalakweboldalbetűbőlakciósanweboldaladatpárinformációneveksegítenieladorövidebbBővebbszeretnédeladhatatlantetszenekszemben

Forrás: pepitahirdeto.multiapro.com

Frappáns – vicces és hasznos ajándék ötletek nagyon jó áron Mindenkinek! Ha csak ötletekre vágysz, akkor is szívesen látunk weboldalunkon vagy facebook oldalunkon! Nálunk minden alkalomra találsz jó ötletet, legyen az születésnap, névnap, karácsony, évforduló, Valentin-nap, nőnap, ballagás, házavató! Kínálatunkat folyamatosan frissítjük. Személyes átvételi lehetőségünk Budapesten, a Márton utca 5. szám alatt, ahol kipróbálhatod termékeinket. Honlapunk: http://atomzsir.hu


Feladva: 2016-09-30    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: atomzsirajándékötletekkipróbálhatodlátunkfolyamatosanhasznoslegyenaholszívesenKínálatunkatviccesötletet