0.21 hirdetések - ingyen apróhirdetés egyszerűen

Nincs találat .... Nézze meg kiemelt hirdétéseinket.

Komáromi János (Málca, 1890. december 22. – Budapest, 1937. október 7.) író, újságíró. Több tucat elbeszélés és regény szerzője. Sorozatcím: Komáromi János munkái gyűjteményes kiadás IV. Kiadó: Genius Könyvkiadó Rt. Kiadás éve: 1930 Kiadás helye: Budapest Kötés típusa: egészvászon Terjedelem: 233 Nyelv: magyar Méret: Szélesség: 13.00cm, Magasság: 19.00cm Kategória: Irodalom szépirodalom regény, novella, elbeszélés Dedikált, aláírt könyvek Antik könyvek ... további részletek >>


Feladva: 2017-04-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: KiadásBudapestgenius1930DedikáltelbeszélésnapokszepregénykirJánosKomáromi00cmkönyvekSzélességHirdetőaláírtTöbbMéretPepitaéveújságíróíró

Forrás: pepitahirdeto.multiapro.com

Rövid- és hosszú ujjú bababody rendelhető kiváló minőségben és mosást tűrő nyomással, felirattal, többféle mintával. Rocker és motoros babáknak is, online rendeléssel. Webáruházunkban leadott rendelését 3-5 napon belül kiszállítjuk az ország bármely területére. www.rockpont.polomania.hu/termekek /4857_Babaruha-Rocker_es_motoros_be bibody


Feladva: 2017-08-24    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: motorosbababodyRockerujjúkiszállítjukmintávalhosszúbelültöbbféleRövidnaponfelirattalBudapestrendelésétnyomássalRockPontleadotttűrőbébiknek

Forrás: pepitahirdeto.multiapro.com

Japánológiával és fordítással foglalkozó, számlaképes fiatalember vagyok. Versenyképes áron: japánul, angolul, magyarul, bármilyen párosításban vállalok fordítást, amelyet a legkörültekintőbb professzionális alapossággal készítek el. Kérés esetén küldöm az általam biztosított szolgáltatásokhoz kötött árakat. Amennyiben felkeltettem érdeklődét, kérem jelezzenek vissza a elérhetőségeim egyikén. Érdeklődni: Soós Kálmán Mobil: +36 20 984-0472


Feladva: 2016-04-27    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: KálmánSoósfordítástvállalokbármilyenjelezzenekJapánológiávaleseténmagyarulkéremangolKérés0472angolulérdeklődétJapánkészítek984japánulMobil

Forrás: pepitahirdeto.multiapro.com

Megmentjük és olcsó csereautót is biztosítunk! Autómentés, furgon szállítás, daruzás (patakból - árokból), autószállítás non-stop. Budapest és Pest megye azonnal, vidéki autómentés esetén a lehető legrövidebb időn belüli elindulás. Autóparkunk és kollégáim segítségével megoldjuk az Ön problémáját! Darus technikánk alkalmas az összes helyzetre: feltört, bezárt, erősen sérült, megszorult futóművű autók, munkagép mentés, daruzás, szállítás különleges, speciális, extrém szállítások.


Feladva: 2017-09-08    [Autó - Motor - Jármű]

Címkék, kulcsszavak: daruzásautómentésBudapestszállításautószállításkollégáimextrémmegyeerősenMegmentjükAutóparkunkspeciálisPestbezártchriscarelinduláskülönlegesfeltört

Forrás: pepitahirdeto.multiapro.com

A vakbél gyulladása gyakori probléma, főként férfiaknál és fiatalabb korban jelentkezik. Tünete lehet a puffadás, étvágytalanság, rossz közérzet, a köldök és gyomortáji fájdalom, előrehaladott állapotban láz is jellemzi. A vakbél gyulladás kezelése kizárólag műtéttel történhet. Miután a betegséget diagnosztizálták, az orvos a lehető leghamarabb sort kerít a gyulladt szövetek eltávolítására a szövődmények - vakbél perforálódása - elkerülése érdekében. A vakbélgyulladás elleni terápiák a műtét ... további részletek >>

után magukban foglalják antibiotikum szedését a fertőzés megelőzéséhez, valamint az első néhány napban pépes ételek fogyasztását.


Feladva: 2016-10-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vakbélgyulladáskezelésenéhánykizárólagterápiákrosszkerítgyakorielsőelleniétvágytalanságsortKittivalamintvakbélgyulladáspuffadásleghamarabbKellér

Forrás: pepitahirdeto.multiapro.com

Statikus szakvélemény készítése: - ingatlan vásárlásnál - falkivételnél - átalakításnál - tetőtér beépítésnél - falak repedéseinél - süllyedésnél vagy csak azért, hogy nyugodt legyen ingatlana állapotára vonatkozóan.


Feladva: 2015-10-26    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: szakvéleményStatikusbeépítésnélingatlanatetőtérlegyenátalakításnálnyugodtfalkivételnélhogyvásárlásnálazértingatlancsakkészítésevagysüllyedésnélKft

Forrás: pepitahirdeto.multiapro.com

A Nash H-Gun botzsákban egyszerre 3 darab 360-as bojlis/pontyozó horgászbotot tárolhatunk. Az extrán párnázott belsőnek köszönhetően botjaink és orsóink is tökéletes biztonságban vannak. 12 hónap garancia, számlaadás. A kiszállítás ingyenes! Webshopunkban azonnal megrendelhető: www.globalstore.hu/shop/nash-h-gun-12ft-3-rod-holldal-botzsak/ További jellemzők: - Nagyméretű külső cipzáras zseb, mely merítőszák vagy ernyő tárolására alkalmas. - Külső cipzáras zseb, melyben például ... további részletek >>

leszúrók tárolhatók. - Erős anyagokból készült, megerősített dupla varrásokkal, megbízható hosszú életű cipzárakkal. - Párnázott fogantyú, állítható vállpánt. - Alumínium merevítő a megfelelő stabilitás miatt.


Feladva: 2017-10-04    [Sport - Kemping - Túra]

Címkék, kulcsszavak: zsebcipzárasKülsőgunPárnázottnashmerítőszákpontyozócipzárakkalshopHorgászbotleszúrókvannakmelybojliséletűglobalstorepéldáulbiztonságbanmiatt

Forrás: pepitahirdeto.multiapro.com

Álmait megvalósítjuk, otthonát hangulatosabbá tesszük, komplett szolgáltatást nyújtunk. Egyéni megrendelők és közületek számára egyaránt a klasszikus megoldásoktól a modern stílusig. Minőségi munkát, minőségi szolgáltatást végzünk, korrekt áron. Szolgáltatásaink: függönyvarrás, drapériák, ágytakarók készítése, római roló és lapfüggöny készítése, függönytisztítás. Varrodánkban textilválasztás is lehetséges!


Feladva: 2016-07-24    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: függönyvarráskészítéseszolgáltatástminőségistílusigtesszükágytakarókmodernhangulatosabbádrapériákmegoldásoktólotthonátklasszikuslehetségesmegvalósítjuk

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Kűl- és beltéri fagyálló kőedények minden évszakban kiváló díszítő eleme lehet kertjének és lakásának. Anyagának köszönhetően megvédi a beültetett növényeket a nagy hőingadozástól, kedvező körülményeket biztosítva a fejlődésükhöz.


Feladva: 2017-01-07    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: kőedényekfagyállóKűlbiztosítvakertjénekPécskörülményeketlehetMáriakedvezőelemeMolnárnéhőingadozástóldíszítőKésesnagykiválónövényeketévszakban

Forrás: pepitahirdeto.multiapro.com

Kárpitozás. Teljes vagy részleges kárpitozás autó utasterében. Bőr, műbőrbevonatokkal történő javítási munkák, ill. teljes belsőtér kárpitozás. Kormánybőrözés, műszerfalbőrözés, ajtókárpitbőrözés, tetőkárpitozás,ülés javítás, utastér kárpitbőrözés és műbőrkárpitozás. Lakóbusz kárpitozás. Lakóautó - lakókocsi kárpitozás, műbőrkárpitozás, bőrkárpitozás, kárpitjavítás. Helyszíni ki és visszaszereléssel is. Kéz és lábáploló szalonok pedikűrszékeinek újra kárpitozása. Kozmetikai, tetoválószék ... további részletek >>

kárpitozás. Fogászati székek újra kárpitozása. Konditermek kondigépeinek újrakárpitozása, továbbá pubok, éttermek boxainak újra kárpitozása, szivacsolása. Masszázságy, ill. sportklubok gyúrópadjainak újrakárpitozása. E mail: carleathering@gmail.com Tel.: +36209313164


Feladva: 2017-02-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: kárpitozáskárpitozásaújraújrakárpitozásaillbőrkárpitozásműbőrkárpitozásteljespedikűrszékeinekKárpitoscarleathering@gmailLakóbuszéttermekmunkákszalonok

Forrás: pepitahirdeto.multiapro.com

A stressz korunk népbetegsége, melyet a rohanó életformának köszönhetünk. Oldalunkkal segítséget szeretnénk nyújtani mindazoknak, akik felismerik, hogy legfőbb érték az egészség és ennek megőrzéséért tenni is akarnak valamit. Stresszoldó technikák: www.blog.topponleszel.com


Feladva: 2017-04-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: StresszoldótechnikáknépbetegségeakikkorunkvalamitmindazoknakstresszakarnaknyújtaniTrénertenniszeretnénkElmemegőrzéséértsegítségetennekOldalunkkal

Forrás: pepitahirdeto.multiapro.com

Három és négy napos jobb agyféltekés rajzolás ID módszerrel kurzusok akciósan 17500 Ft-ért eszközökkel együtt. Mindenkinek sikerül!


Feladva: 2017-04-30    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: rajzolásagyféltekésjobbeszközökkelHáromértBudapest17500DezsőakciósanImrekurzusokakciómódszerrelsikerülMindenkineknaposegyüttnégy

Forrás: pepitahirdeto.multiapro.com

Akciós AEG, Electrolux, Zanussi háztartási gépek - raktárról azonnal, akár 5 év kiterjesztett garancia - egyedülálló videó termékbemutatók - ha nem tudsz eljönni, nézd meg és rendelj online - országos házhoz szállítással!


Feladva: 2017-09-21    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: háztartásiZanussiElectroluxAEGgépektudsznemtermékbemutatókszállítássalvideóházhozegyedülállóAkciósországosgaranciaajánlóonlinekiterjesztettakár

Forrás: pepitahirdeto.multiapro.com

Az egészségjavító AJÁNDÉKUTALVÁNY a legjobb ajándék. Ön eldönti,mennyit szán rá,a megajándékozott eldönti,hogy mire alkalmazza. Választási lehetőségek: - látás-hallás vagy memóriafejlesztő gyakorlatok,gyógytorna,gyógymasszáz s - alakformáló,zsírégető masszázs - fogyás kicsiknek és nagyoknak - biorezonanciás dohányzásleszoktatás. Bővebb információért hívjon a 06 30 907 47 86 telefonon. eletmod-debrecen.hupont.hu Életmód Stúdió


Feladva: 2017-12-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: StúdióÉletmóddebreceneldöntigyakorlatokmegajándékozottdohányzásleszoktatásmemóriafejlesztőszánbiorezonanciásvagymennyitnagyoknakhalláshupontajándék

Forrás: pepitahirdeto.multiapro.com

Legújabb termék, mely egyben a kedvencünk is lett. Tejes-mogyorós krémmel töltött ostya. A női táskákba is könnyedén elfér. Vidd magaddal, hogy ne csábulj el a cukros változatoknak. MOST BEVEZETŐ ÁRON MEGKÓSTOLHATOD! www.bodyfit-hungary.hu/BodyandFit- Smart-Break-feherjevel-dusitott-tej es-mogyoros-ostyaszelet


Feladva: 2017-10-05    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: ostyaBudapestváltozatoknaktöltöttcsapatcukroskrémmelFitcsábuljmogyorósBodyhogyTejeskedvencmagaddallettViddkedvencünkelféregybenMEGKÓSTOLHATOD

Forrás: pepitahirdeto.multiapro.com

Eladó, megfelelő ajánlat esetén kiadó az egész évben nyitva tartó, 650 m²-es Pelcz Apartmanház! Befektetésre is ajánlott! A Balatontól 150, a városközponttól pedig mindössze 200 m-re fekszik. A házban 8 db apartman található, mindegyik külön bejárattal és fedett terasszal rendelkezik. Apartmanjainkban egy időben legfeljebb 38 vendég elszállásolására van lehetőség. Főszezonban csak egész hetekre, szombat délutáni érkezéssel és szombat reggeli távozással fogadunk vendéget.


Feladva: 2016-02-13    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kiadószombatApartmanházEladóPelczegészvankülöntávozássalBalatontólelszállásolásáraeseténmindegyikreggeliajánlottvendégajánlattalálhatólegfeljebb

Forrás: pepitahirdeto.multiapro.com

Meg Vagy Te Őrülve??? Kidobod a tintapatronodat ahelyett, hogy feltöltenéd??? Más emberek ezrei nyomtatnak ÖTÖD-, vagy akár TIZEDÁRON, egy teljesen biztonságos, egyszerű módszerrel, súlyos ezreket, tízezreket takarítva meg a tintapatronjaikon! Nyomtass Te is ÖTÖD-, vagy akár TIZEDÁRON! Kattints és tudd meg, hogy ez mennyire olcsó és egyszerű!


Feladva: 2015-09-06    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: megvagyhogyTIZEDÁRONŐrülveakárRefillParadiseÖTÖDegyszerűmennyiretakarítvaMártízezreketfeltöltenédezreketahelyetttuddsúlyostintapatronodategy

Forrás: pepitahirdeto.multiapro.com

A Wilson Burn széria a 2017. évi tavaszi szezonra teljesen megújult mind anyagában, mind külső megjelenésében. A széria három tagja (95 CV, 100 CV, 100S CV) új megerősítést kapott a Countervail technológia révén, amelyet félévvel korábban a Blade szériánál mutatott be először a Wilson. Az ütők megjelenése is harmonizál a Blade és Pro Staff ütők színvilágával, ami minimál dizájnt jelent, fekete alapszínnel, tiszta vonalakkal és matt festéssel. Az ütőket a szériákra jellemző szín teszi ... további részletek >>

megkülönböztethetővé a többitől, így a Burn ütők messziről felismerhetők a feketébe ágyazott narancsszínükkel. A Burn széria teniszütői az alapvonal játékosok számára készülnek, akik nagy erővel hátulról játszva ütik a labdát, s ezzel tartják ellenfelüket folyamatosan nyomás alatt a mérkőzés utolsó pillanatáig. www.lhsport-shop.hu/tenisz/teniszuto/wilson-burn-95-cv-teniszuto


Feladva: 2017-04-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: burnwilsonütőkszériateniszutomindBlade2017PepitaakikStaffmesszirőlrévénfolyamatosanmattkészülnekProtechnológiaanyagábanellenfelüketvonalakkal

Forrás: pepitahirdeto.multiapro.com

A Fürdődézsák 2x2.5-től-2x4.2m-ig bármilyen méretben elkészítjük. Kerek és ovális formában! Kedvező árak! e-mailben minden érdeklődőnek méret szerinti konkrét árat adunk. Ajándék sóval. A kályha anyaga ko36. Egyedi kívánságokat is teljesítünk értelmes határokon belül! Az árak nem akciósak, de az ár-érték arány átlagon felüli! A fürdő dézsa ma már nem azt jelenti mint akár 500 esztendővel ezelőtt! A kályhának köszönhetően minden évszakban használhatja. Extra méret, szuper ár, 4x2-es kettő ... további részletek >>

kályhával: 699.000 Ft! Extrákkal bővíthető! Más dézsák 309.000 Ft-tól! www.furdodezsak.com 06203979102 pollakferi@icloud.com Fűthető fürdődézsa. A parti dézsa, merülő dézsa, dézsa fürdő és kerti dézsa wellness élményeket ad (Hot Tub). Társasági élményfürdőzésnek kiváló módja. A dézsa felszereltsége: lépcső, pad, védőrács, italtartó, kályha, tető, kályhacső. Parajdi sót adhatunk hozzá.


Feladva: 2017-05-09    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: dézsafürdődézsaFűthetőfürdő000árakméretnemmindencomkályhaTubHotlépcső4x2sóvalkerti500Kerekfábólhozzátólakciósakfelszereltségeszuper

Forrás: pepitahirdeto.multiapro.com

Statikus szakértői vélemény CSOK igényléséhez. (családi otthonteremtési kedvezmény) Díja: 40.000 Ft.


Feladva: 2016-11-28    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: StatikusotthonteremtésicsaládiigényléséhezCSOKvéleményszakértőiZsuzsanna000JózsaDíjaSZAKVÉLEMÉNYkedvezmény

Forrás: pepitahirdeto.multiapro.com

Legyen igényes autójára, nem mindegy a megjelenés! Nézzen be hozzánk, minőségi munka, korrekt árak. Kérjen időpontot, hogy ne kelljen várakoznia. Kézi autómosó, Sárvár.(a régi Opel szervízben) www.tibronc.wixsite.com/kezi-autom oso-sarvar


Feladva: 2017-03-03    [Autó - Motor - Jármű]

Címkék, kulcsszavak: SárvárkeziNagyrégiminőségiSzombathelyihozzánksarvarautómosóNézzenautomosovárakozniamegjelenéskelljenmindegycomhogynemwixsiteidőpontotautójára

Forrás: pepitahirdeto.multiapro.com

Szépen kidolgozott, kecses 19 colos LCD az LG-től. Az elektronika egy része a talpban és a csatlakozó házában lett elhelyezve, így a monitor oldalról és hátulról is mutatós, nem bumszli. Bekapcsolt állapotban a talpban látható kör pirosan világít, ami nagyon mutatós. Külső tápot igényel, ezt természetesen adom hozzá. Csatlakozása DVI. Bővebben: www.sokcuc.com/list.php?id=29


Feladva: 2017-09-30    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: talpbanmutatósLCDmonitorkörelhelyezvetermészetesenkidolgozottláthatóphpletteztSzépenlistházábanigényelajánlásállapotbancomcsatlakozótápot

Forrás: pepitahirdeto.multiapro.com

Cégünk a szakszerű építési projektek kivitelezésére alakult. Családi házak, lakások, irodaházak, társasházak teljes körű generálkivitelezését, valamint felújítási munkákat vállalunk a Dunántúl szinte bármely pontján. Vállalunk mély és magasépítő munkákat, kézi - gépi földmunkákat, közműépítést, útépítést, tereprendezést, kertépítést, alakító földmunkákat, tereprendezést, ingatlanfelügyeletet, karbantartást, felújítási munkálatokat. Vállalatoknak, önkormányzatoknak, magánszemélyeknek is!


Feladva: 2015-11-06    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: vállalunkfelújításimunkákattereprendezéstföldmunkákatgenerálkivitelezésétmunkálatokatépítésikézikörűszakszerűteljeskarbantartástCégünkmagasépítőmély

Forrás: pepitahirdeto.multiapro.com

Velence-korzón Novotny Hajgyógyászat és Biofodrászat szépség szalon! Nemzetközi diplomával rendelkező hajgyógyászunk várja szeretettel. 20 éves tapasztalattal személyre szabottan analizáljuk és megoldjuk problémáját: - hajhullás - roncsolt haj Kezelés színenergiával és biológiailag aktív hatóanyagokkal. Tudományos, orvos-technikai módszerek, mikro-kamerás haj- és fejbőr vizsgálat. Vegyszermentes hajfestés, dauerolás. Kérjen időpontot!


Feladva: 2016-11-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: NovotnyhajVelenceHajgyógyászatbiológiailagévesfejbőrszínenergiávalszeretettelkorzónKezelésvárjakamerásroncsolthajgyógyászunkmikroGabriellahajhullás

Forrás: pepitahirdeto.multiapro.com

A bárányhimlő felnőttkorban súlyos szövődményeket okozhat, terhes nőkre nézve pedig különösen veszélyes, mert maradandó károsodást okozhat a magzatnak. A bárányhimlő lefolyása után a szervezet immunis lesz a vírusra, így aki egyszer már elkapta, többet nem fog szenvedni a betegségtől. Főként a téli és a tavaszi hónapokban terjed, lappangási ideje 2-3 hét, ezután jelentkeznek a bőrön a piros pöttyök. Mit tegyünk bárányhimlő ellen? Bárányhimlő ellen sokféle gyógymód létezik, általában csak a ... további részletek >>

tüneteket kell kezelni, azaz a viszketést csillapítani, mert az elvakart hólyagok heget hagyhatnak maguk után.


Feladva: 2016-10-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BárányhimlőutánmertellenokozhatterjedfelnőttkorbanazazmártegyünkkárosodásthónapokbanKittikezelniegyszerMitmaradandótavasziKellérkellakitéli

Forrás: pepitahirdeto.multiapro.com

KARIKATÚRA 1 NAP ALATT ESKÜVŐRE, ÜNNEPEKRE VAGY BÁRMELY ALKALOMRA! KÜLDJE EL A LERAJZOLANDÓ FOTÓJÁT, 1 NAP ALATT ELKÉSZÍTEM A PROFI RAJZOT, 1 NAP ALATT MEGKAPJA A KÉSZ MUNKÁT. EGYEDI AJÁNDÉK BÁRMIKORRA! KUSTANSTUDIO - TÖBBezer ELÉGEDETT ÜGYFÉL! 70 3347285 Lépj be a profi karikatúrák világába: www.77rolo.wixsite.com/kustanrolan d


Feladva: 2017-04-14    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ALATTNAPKARIKATÚRAprofiBÁRMIKORRALERAJZOLANDÓhttpsAJÁNDÉKKÜLDJEvilágábaEGYEDIALKALOMRAkarikatúrákMUNKÁTBÁRMELYKÉSZVAGYLépjMEGKAPJAÜNNEPEKRE

Forrás: pepitahirdeto.multiapro.com

Amennyiben Önnek, vagy a cégének jogi problémája az alábbiak valamelyikével összefügg, keressen bizalommal! Gazdasági jog: - gazdasági társaságok alapítása, működésükkel kapcsolatos ügyek, egyéb cégjogi kérdések - cégek szerződéses vitái, cégek közötti kártérítéses ügyek - csőd, felszámolás Munkajog: - munkaviszonnyal kapcsolatos ügyek Polgári jog: - szerződésekkel kapcsolatos ügyek - szerződéskötés, azok teljesítésével kapcsolatos problémák, szerződések megszüntetése stb... - ... további részletek >>

ingatlan adásvételi szerződések - öröklés - tulajdonjog - kártérítés - élettársi kapcsolatokkal összefüggő kérdések, vagyoni viszonyok Családjog: - válás - gyermek elhelyezés - házassági vagyonjog Büntetőjog: - gazdasági, illetve vagyon elleni bűncselekmények Sportjog: - átigazolási és fegyelmi ügyek, ezekhez kapcsolódó speciális munkajogi kérdések, hivatásos és amatőr szerződések - sportszervezetek alapításával, működésével kapcsolatos ügyek - szponzorálási és arculat-átviteli szerződések


Feladva: 2017-07-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ügyekkapcsolatosszerződésekkérdésekgazdaságijogbizalommalcégekszerződéseselhelyezésvalamelyikévelezekhezadásvételiHirdetőátviteliházasságialábbiak

Forrás: pepitahirdeto.multiapro.com

Berni, ez a 7 év körüli,puli nagyságú, egy kis kozmetika után minden bizonnyal nagyon széppé váló, kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a ... további részletek >>

jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagyutánSÜRGŐSgazdinakNAGYONkutyaegygazdaörökbeGYEPMESTERIkifizetniebizonnyalüzenetetnemsürgősenBekerülésükaltathatómindenhagyjeredeti

Forrás: pepitahirdeto.multiapro.com

Új Kocsik Érkeztek!!! Most Több Darabból Választhat! Téliesített, Kiváló Állapotban Lévő Büfékocsi Berendezéssel Együtt Kiadó! Rendelkezik a szükséges szakhatósági engedélyekkel, személyautóval, B-s jogosítvánnyal kényelmesen vontatható, azonnal munkára fogható! A bérléshez 1 havi bérleti díjnak megfelelő kaució szükséges! Külföldi használat esetén a bérleti díj havi 400,- Euró, a kaució pedig Magyarországtól való távolságtól függ! Egész Szezonra Történő Bérlés, és előre fizetés esetén ... további részletek >>

díjkedvezményt biztosítunk! Büfékocsi Kölcsönző Eger, A Legjobb Feltételekkel!!! Nyitva: H-P: 08-16:30; SZ: 08-12; V: Zárva Kérem a fenti időpontokban érdeklődjenek!!! Kérem tekintse meg honlapunkat!


Feladva: 2016-10-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BüfékocsibérletiKölcsönzőKéremszükségeseseténkaucióBérléshaviEgerEgészÁllapotbanmegkényelmesenfüggKiválótekintsehasználatjogosítvánnyalKülföldi

Forrás: pepitahirdeto.multiapro.com

Egy olyan rendkívüli fizetési mód kezdett elterjedni Magyarországról kiindulva a világon, amely a következő években, évtizedekben, teljesen átalakítja a fizetési szokásokat! Már elindult, legyen Ön is az elsők között. Minden embernek gyökeresen megváltoztathatja az életét, de az első pár millió embernek soha nem látott vagyont is jelenthet. Az eddig ismert összes fizetési mód együttesen nem tud annyi előnyt biztosítani, mint a cégünk által az egész világon levédett, egyedüli és rendkívül ... további részletek >>

egyszerű fizetési rendszerünk. Képzeljen el egy olyan fizetési módot, ahol Önnek szó szerint semmilyen fizetőeszközre nincs szüksége. Érdekesnek találja? Képzeljen el egy fizetési módot, melynek köszönhetően nemzetközi szinten is sok millió ember mindennapos vásárlása után, minden egyes másodpercben jövedelme keletkezik. Garantálom, hogy nem kell befektetnie, vagy befizetnie felesleges csomagokra, nem kell semmit sem eladnia MLM rendszerben, nincsenek kötelezettségei, és garantáltan több pénze lehet, kevesebb nem! Kizárólag a mindennapi megszokott vásárlásokból! Kérje e-mailen mindenre kiterjedő információs levelem. Email: rozsabusiness@gmail.com


Feladva: 2017-04-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemfizetésiegyKépzeljenolyanmillióembernekmódkellvilágonmindenmódotvagyontErrőlnincsenekbefektetnielegyenemberbiztosítaniMagyarországrólhogy

Forrás: pepitahirdeto.multiapro.com

Bedolgozást vállalok ipari gépekkel Tárnokon. Szállítani sajnos nem tudok. Folyamatos munkát keresek. Heti 1-szeri szállítással lenne a legjobb. A megbeszélt időpontot mindig tartom. Gépparkom: - 4 szálas Siruba interlock - Brother fedőző - Siruba és Textima gyorsvarrók - Elszívós vasalóasztal és gőzölős vasaló.


Feladva: 2018-01-19    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: BedolgozástSirubaTárnokonfedőzőszállítássalgépekkelBrotherszeriipariinterlokkHetivállalokszálaskeresekvasalóGépparkommunkátgőzölősIldikótartom

Forrás: pepitahirdeto.multiapro.com

A mai - sokak szerint torz - Alaptörvény is rögzíti, hogy Magyarországon a legfőbb döntéshozó a Parlament! 2018-ban választások lesznek... Nap mint nap látod a direkt és indirekt ajánlatokat arra, kire és melyik pártra szavazz. Hogy milyen sokat tett már érted az egyik és milyen sokat fog a másik... Szinte biztos, hogy ezek a kampányszövegek csak a fül simogatására szolgálnak! Válassz inkább olyan képviselőt, aki a környezetedet ismeri és képviselni akarja a Te gondjaidat. Ha pedig ... további részletek >>

nem jól teszi, nem képvisel Téged, akkor elérhető a számodra, hogy meg tudjad kérdezni, amikor csak akarod, hogy miért nem teszi! Egyet ne tegyél! Azt, hogy nem mész el szavazni! Azonnal be fog a kihagyott helyre türemkedni valami olyan erő, amely biztosan nem a Te érdekeidet fogja képviselni! A választás egy olyan alapjog, mint a levegővétel. Természetes és az élethez szükséges! A vezérek kora már rég elmúlt... Olyan Parlament kell(ene), ahol minden Magyarországon élő embert képviselnek az ország házában!


Feladva: 2017-02-06    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: jelentkezésétországgyűlésivárjukforinthogyjövőkapcsolatbadolgokegymillióbelőleLépjkezedbeösszegyűjtőkneklettképviselőjelöltjeicímresajátaláírást

Forrás: pepitahirdeto.multiapro.com

Továbbá gyártunk különböző méretű, huzalvastagságú horganyzott és műanyagos drótfonat, vadvédelmi háló, vadháló, tüskéshuzal, tüskésdrót, szögesdrót, vezérdrót, kerítés háló, kerítésháló, feszítőhuzal, feszítő huzal, kerítésdrót, tüskés szöges vezér drót, vadkerítés, kerítés építés, kerítésépítés, kerítésfonat ,kiskapu, nagykapu, huzalfeszítő csavar, vibropréselt zsalukő, lábazati elem, fémoszlop, faoszlop, natodrót nato drót, fém fa beton kerítés oszlop, kerítéspanel, kerítéselem, kutyakennel, ... további részletek >>

drótháló, drótkerítés, kis nagy vas kapu, kutya kennel, szőlőoszlop, kerítésoszlop, betonoszlop, kutya kenel, szőlőkaró, kutyakenel, szőlő oszlop karó. Vállalunk az ország egész területén vadhálóval, vagy dróthálóval komplett kerítésépítést 1000 Ft/m áron. (Csak drótkerítéseket és vadvédelmi kerítéseket építünk, fakerítést nem!!!)Rengeteg terméket gyártunk és forgalmazunk a kerítésdróton és betonoszlopokon kívül, amit egy hirdetésben nehéz lenne felsorolni, ezért kérem, látogasson el honlapunkra www.kerites.hupont.hu oldalra, vagy telephelyünkre, a KÓTAJI DRÓTFONAT, VADHÁLÓ és BETONOSZLOP CENTRUMBA ahol személyesen akár további kedvezményekre is van lehetőség.


Feladva: 2017-05-14    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: keriteswwwvadvédelmibetonBETONOSZLOPdrótVADHÁLÓDRÓTFONAToszlopgyártunkhálóvagyhupontkutyakerítéseketkerítéspaneltüskéshuzalaholegészkívülfém

Forrás: pepitahirdeto.multiapro.com

Vállalatunk sok éve foglalkozik duguláselhárítással, vízszereléssel, fűtésszereléssel. Vállalunk szervízelést, javítást, cserét, és karbantartást. Akár évi ellenőrzésre is hívhat minket. Foglalkozunk kazánokkal, gázkészülékekkel, cirkókkal, bojlerekkel, lapradiátorokkal. Ügyfélszolgálatunk éjjel-nappal működik, fix árakkal dolgozunk.


Feladva: 2017-11-22    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: javítástAttilagázkészülékekkelszervízeléstdolgozunkFarkaskazánokkalVállalunkárakkalMesterFoglalkozunkfűtésszerelésselfixFűtésszerelőminketműködikévi

Forrás: pepitahirdeto.multiapro.com

Klasszikus és modern olasz konyhabútorok nagy elemválasztékával várja Önt a Lineaflex Olasz Bútoráruház és Ágybetét Stúdió.


Feladva: 2016-09-02    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: OlaszBútoráruházLineaflexÖntvárjaelemválasztékávalnagykonyhabútorokmodernStúdióKlasszikusÁgybetétkerBudapestkonyhabútor

Forrás: pepitahirdeto.multiapro.com

Balatonfenyvesi kiadó vízparti nyaralók, apartmanok, szobák! Foglalja le időben balatoni nyaralóját! Ha a válság miatt nem tud külföldre utazni, válassza az olcsóbb hazait! Akció! Június 25-ig és augusztus 25 után -20%! SZÉP kártya elfogadóhelyek várják! Keressen bennünket bizalommal!


Feladva: 2016-09-18    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: BalatonfenyvesbalatonivízpartikiadóaugusztusválságJúniusnyaralójátnyaralóAkcióbizalommalhazaitidőbenbennünketolcsóbbFoglaljaKeressenválasszatud

Forrás: pepitahirdeto.multiapro.com

100 % Guido Maria Kretschmer két illatban. Egy neked és egy neki. A tervező végre valóra válthatta régi álmát, hiszen együttműködésben az LR-rel megalkothatta első saját parfümkollekcióját. A parfümök különlegessége, hogy az illatok Guido Maria Kretschmer személyiségéhez köthetők: mint divattervező, mint művész, mint ember. „Nem csak csábítani akarok, hanem megérinteni is“, ez a tervező vezérelve...


Feladva: 2016-04-23    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: GuidomintMariatervező8220egyKretschmeregyüttműködésbenkétcsakhiszen100NemillatokálmátPécs8222hogyrégiÉvaemberkülönlegességeválthattarel

Forrás: pepitahirdeto.multiapro.com

Lakberendezés Egyéni Igényekre Teljes körű Építészeti és Belsőépítészeti 3D Látványtervezést kínálunk: Tervezőknek · Gyártóknak · Beruházóknak · Magánszemélyeknek


Feladva: 2017-07-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 183MagánszemélyeknekIgényekreEgyéniBeruházóknakLakberendezésGyártóknakajánlóTervezőknekHirdetőkínálunkPepitaLátványtervezéstLátványtervezésValósághű

Forrás: pepitahirdeto.multiapro.com

Gyerekjáték webáruházunkban gyerek játék és bébi játékok egyaránt megtalálhatóak. Gyerek biciklik, társasjátékok, 3D puzzle, készségfejlesztő játékok és fajátékok is megtalálhatóak, de babaházakat és távirányítós játékokat és jelmezeket is kínálunk.


Feladva: 2016-08-29    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: GyerekjátékmegtalálhatóakjátékokwebáruházGyerekbabaházakatjátékwebáruházunkbanfajátékokCsávolykészségfejlesztőpuzzletársasjátékokkínálunkbiciklikbébi

Forrás: pepitahirdeto.multiapro.com

24 órás otthoni szakápolás, betegápolás! Otthonában ápolom kifejezetten szakápolást igénylő lábadozó, beteg, vagy idős hozzátartozóját, krónikus belgyógyászati, haematológiai és onkológiai tapasztalattal és több, mint 25 éves gyakorlattal. Szükség esetén 24 órában. Kórház, műtét utáni ápolás. Tumoros betegek otthoni ápolása. Megfelelő végzettséggel és referenciával rendelkezem. Bérezés megállapodástól függően. Tel: 06-30-8834252 kovacsbiren@gmail.com


Feladva: 2017-05-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: otthonibetegápolásMegfelelőszakápolásSzükségidőscomápolásaórásgyakorlattalvagykovacsbiren@gmailBudapestéves8834252betegekIrénmintlábadozóTel

Forrás: pepitahirdeto.multiapro.com

Ha Hévízre kíván jönni, nálunk kényelmes családias elhelyezésben részesül. Közel a belvároshoz, 500 m-re a tótól kínálunk kétágyas, fürdőszobás, erkélyes szobákat. Reggeli, kisebb étkezések elkészítésére lehetőség van, az udvarban pedig parkolási lehetőség. Részletesebben honlapunkon, illetve az elérhetőségeinken. Keressenek bennünket telefonon, vagy e-mailben, egész évben szeretettel várjuk vendégeinket!


Feladva: 2017-10-02    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: 245séglehetségeinkenkívánvanvendégeinkettótólHévízreelkészítésérevárjuk500elérhetHévizétkezésekszeretettelbelvároshozillZoltánnékisebbévben

Forrás: pepitahirdeto.multiapro.com

A kívánság lampion története: Ezeket a papírballonokat repülő lámpásnak, azaz Tiang Deng-nek nevezik, eredete a keleti világban több száz évre nyúlik vissza. Ázsiában a mai napig hagyományosan több ezer ilyen repülőlampiont, azaz kívánság lampiont engednek fel az emberek újév napján, vagy az ismert ”Fullmoon” ünnepeken. Annyi év elteltével még mindig él a szokás, hogy feleresztésekor a belesuttogott, ráírt kívánságok valóra vállnak. Megrendelhető - lásd Honlap alább!


Feladva: 2015-02-18    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: kívánságlampiontöbb8221azazhogykeletinapjánalábbszokáseredeteújévSzegedHonlaphagyományosanmindignevezikemberekLátványPontlásdnapigmégnek

Forrás: pepitahirdeto.multiapro.com

Motoros mintákkal - rendelés alapján pólónyomás! Kiváló ajándék minden alaklomra. Retro pannónia logós termékek, humoros feliratú felsőruházati termékek motoros hölgyeknek és uraknak. Motoros hátizsák. Ha nem találod amit keresel, vagy egyéni elképzelésed van, írj! Megoldjuk. www.rockpont.polomania.hu/termekek /reszletek/153622_danuvia_logos_mot oros_polo-_motoros_ajandek-polonyom as


Feladva: 2018-01-04    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: MotorostermékekalapjánvagyfeliratúrendeléskereselhumorosmintákkalamitlogósRockPonttalálodpannónianyomásanemRetropólókhátizsákalaklomraminden

Forrás: pepitahirdeto.multiapro.com

Taxi reptéri transzfer ajánlatok a tápióságból. Tápióság, Tápiószecső, Tápióbicske, Tápiószentmárton, Tápiószele, Tápiógyörgye...


Feladva: 2017-12-09    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: TaxiTápióságtápióságbólTápiógyörgyehathaziTápiószelereptérreTápiószentmártontranszferekTápióbicskeTápiószecsőajánlatoktranszferreptéri

Forrás: pepitahirdeto.multiapro.com

Személyesen szeretném bemutatni a következő, megbízható és német precizitással gyártott ALOE VERA termékeket: Sminkek, Babaápolási termékek, Parfümök, Vitaminok, Ivógélek, Hajkondicionálók, Terhességi csík elhalványító krémek és sok minden más hasonlót! Pécsi helyszínen várlak előzetes egyeztetés után tájékoztató .ahol minden terméket kipróbálhatsz, tesztelhetsz saját magad teljesen INGYEN! Ha kérdéseid lennének, keress bátran az alábbi elérhetőségeken!


Feladva: 2017-10-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: VERAALOEmindenelhalványítókérdéseidutánÉvacsíkINGYENegyeztetésPétermannTerhességiteljesengyártottelőzetesAjánlhatomHajkondicionálókmagadvárlak

Forrás: pepitahirdeto.multiapro.com

Forrasztóállomások, pákák egyéb kiegészítők nagy választéka kedvező áron. www.elektroexpressz.hu/spd/CZT_065 10010/ZD-99-analog-forrasztoallomas -150-450-C#page_artdet_tabs


Feladva: 2016-09-28    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: ForrasztóállomásáronkedvezőválasztékanagykiegészítőkegyébpákákForrasztóállomásokELEKTROEXPRESSZpáka

Forrás: pepitahirdeto.multiapro.com

Minden gépjárműre, személyautóra, kisteherautóra, kamionra traktorra, buszra készítünk méret pontos üléshuzatot. Legalább 100 fajta anyag minta közül választhat. UV álló anyagok, gyári kárpit anyagok, utángyártott anyagok, elasztikus anyagok, szövetek, között válogathat. A különböző színű, mintájú, vagy minőségű anyagok összevariálásának csak az ön fantáziája szabhat határt. Vásárolhat nálunk trikó üléshuzatokat, valamint univerzális üléshuzatokat is. Várjuk szeretettel. Tekintse ... további részletek >>

meg weboldalunkat: huzatkiraly.hu Bán&Vincze BT Kecskemét, Jókai utca 41 Telefon: 0630/911-1277 - 0630/4853749


Feladva: 2016-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: anyagokVinczeBán0630üléshuzatokatKecskemétkárpitvalamintpontosminőségűüléshuzatgyáritrikóméretvagyMéretpontoshuzatkiralyállónálunkkészítünk

Forrás: pepitahirdeto.multiapro.com

Ön kötött biztosítást a lakására, az autójára? Bizonyára igen a válasza. És arra, aki mindezt létrehozta, egy élet munkájával előteremtette, vagyis önmagára kötött-e biztosítást? Ne késlekedjen! Az UNIQA Puzzle balesetbiztosításával korszerű, sokoldalú és magas összegű szolgáltatásokat fizető biztosítással vértezheti fel magát, illetve családját. Tájékozódjon: nézzen bele a www.privatbiztositasok.nanoweb.hu< /a> honlapba, s keresse a Rizikókat.


Feladva: 2013-09-04    [
Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: igenegybiztosítástkötöttprivatbiztositasokválaszaszolgáltatásokatönmagárabeleösszegűvagyisBizonyáranézzenmagaselőteremtetteautójáraTájékozódjonélet

Forrás: pepitahirdeto.multiapro.com

Tradicionális thai masszázskezelés Budapesten a 13. kerület szívében. Az eredeti thai masszázs kezelés enyhíti fáradtságát, csillapítja fájdalmát és segít visszaszerezni frissességét. Serkenti, nyugtatja a lelket és a testet.


Feladva: 2017-03-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: BudapestthaiSmilekerületthgaitradicionálisMasszázsszalonMasszázsszívébenBudapestenmasszázskezelés

Forrás: pepitahirdeto.multiapro.com

Nyugtató-lazító hatás: a test átmelegszik, könnyeddé válik az idegek kisimulnak az izmok ellazulnak az idegrendszer megnyugszik a vér- és nyirokkeringés megélénkül javul a sejtek oxigén- és tápanyagellátása salak- és méreganyagok kiválasztása hormonális hatás (érintésre a szervezet endorfin és oxitocin hormont állít elő, amelyek a test saját stressz- és fájdalomcsillapító szerei).


Feladva: 2015-08-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatástestméreganyagokpozitívellazulnakelőNagysalakhogyizmokállítmasszástápanyagellátásacéljakisimulnakhormontrelaxációsoxigénvégzőidegekválik

Forrás: pepitahirdeto.multiapro.com

Az álmok jelentése a legtöbb embert érdekli. A tudomány sem cáfolja azt a nézőpontot, miszerint álmunkban legbensőbb világunk jelenik meg, félelmeink, vágyaink, reményeink vetülnek ki különböző fantáziákba szőve. Az álom működése azonban még ma sincs teljesen megfejtve. Hogy mit üzennek, gyakran csak találgatni tudjuk, máskor pedig egészen egyértelmű, hogy a napközben átélt helyzeteket dolgozzuk fel általuk. Az álmok megfejtése napjainkra egyfajta “tudományággá” vált, sokszor ... további részletek >>

segítségül hívhatjuk a különböző lelki problémák, konfliktus- és stresszhelyzetek feldolgozásához.


Feladva: 2016-11-08    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: jelentéseálomhogykülönbözőmégálmoktudjuksegítségülműködésefelálmunkbantalálgatniKittisokszordolgozzukmiszerintcsakKellérváltszővehelyzeteket

Forrás: pepitahirdeto.multiapro.com

Rajtad is múlik, hogy NE legyenek katasztrófák, NE pusztuljon ki a világ! www.onfejlesztes6.webnode.hu


Feladva: 2017-06-19    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: webnodeRamsbergonfejlesztes6ÉvahttpHalmaivilágNyárinépusztuljonDorfstrkatasztrófákOberelegyenekhogymúlikRajtadBayern

Forrás: pepitahirdeto.multiapro.com

Ha Ön és cége, vállalkozása > termékeinek, valamint szolgáltatásainak új piacot keres > szabad kapacitását szeretné lekötni > szellemi termékeit szeretné értékesíteni > Telephelyét, ingatlanát óhajtja eladni > együttműködésre törekszik külföldi cégekkel > képviseletet óhajt külföldön > reklámra, vagy telemarketingre van szüksége, akkor cégünkben megbízható partnerre talál!


Feladva: 2016-02-13    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: szeretnéképviseletettermékeitmegbízhatócégecégekkelszellemicégünkbenPartnerkülföldilekötniakkorBusinesstörekszikkapacitásátszükségeEuroszabadvan

Forrás: pepitahirdeto.multiapro.com

Méhészek F I G Y E L E M! Méhész huzal / keretdrót AKCIÓ! Akár INGYENES szállítással! Ø 0,4 és 0,5 mm-es lágy huzalok dobra csévélve: Horganyzott fényes: 1.250,-Ft/kg - Rozsdamentes/ inox: 2.500,-Ft/kg. Kiszerelés: 1, 2, 3, 4, 5 kg, igény szerint, de lehet nagyobb is- drótspecial.hu 1-2 kg. vásárlás esetén a szállítási díj: 1,270,-Ft/csomag 3-5 kg. vásárlás esetén a szállítási díj: 1,000,-Ft/csomag 5-9 kg. vásárlás esetén a szállítási díj: 500,-Ft/csomag 10 kg, és a fölötti ... további részletek >>

vásárlás esetén, a szállítás INGYENES! Utánvétes szállítás esetén, az utánvétkezelési díj 400,-Ft/csomag -Megrendelésre gyártunk más méreteket és termékeket is ! (acélhálók, méhész huzalok, vágott drótok drótspecial.hu) Kereskedőket, viszonteladókat is kiszolgálunk!


Feladva: 2016-11-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: huzaldobonszerinthorganyzottdrótkeretMÉHÉSZKereskedőketKfthuzalraPluszinoxdíjszabásDrótszálcsévéltROZSDAMENTESpostázásaAKCIÓdobra250termék

Forrás: pepitahirdeto.multiapro.com

Alsóörsi kiadó szálláshelyek fényképes gyűjtőoldala. Panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Több mint 100 fényképpel a szálláshelyekről és a településről! - SZÉP kártyát elfogadó szálláshelyek Alsóörsön - Egész évben nyitvatartó (kidó) szálláshelyek - Weboldal: www.zimmerinfo.hu/alsoors/hu.htm


Feladva: 2017-11-08    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekzimmerinfonélkülvillákAlsóörsöndíjhtmvendégházakelfogadóközvetítésialsoorsPanziókkártyátszálláshelynélgyűjtőoldalaSZÉPlehetőséghttp

Forrás: pepitahirdeto.multiapro.com

A Centrál Autószerviz márkától függetlenül vállalja gépjárműve karbantartását, javítását. Törekszünk arra, hogy ügyfeleinkkel közvetlen kapcsolatot alakítsunk ki és elnyerjük bizalmukat minőségi, gyors munkánkkal. Nagy figyelmet fordítunk ügyfeleink által észlelt hibák kielemzésére. Autószerelő műhely - Sopron.


Feladva: 2016-08-10    [Autó - Motor - Jármű]

Címkék, kulcsszavak: AutószervizCentrálSopronTörekszünkműhelygyorsjavításátAutószerelőminőségikarbantartásátkielemzésérebizalmukatgépjárművehibákelnyerjükvállaljaészlelt

Forrás: pepitahirdeto.multiapro.com

Ha kicsivel is, de meghaladja a háromszázezer forintot a bruttó átlagkereset Magyarországon, amiből kétszázezer forint körül visz haza egy átlagos magyar munkavállaló. Ha esetleg nem keresi meg ezt az összeget, akkor jelezze, megmutatom, hogy hogyan tudja egyszerűen kiegészíteni a jelenlegi jövedelmét. Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet! Email: ... további részletek >>


Feladva: 2017-03-01    [Pénzkeresés - MLM]

Címkék, kulcsszavak: magyarbruttóátlagosforintotegykeresezer305megTanácsadónakátlagkeresethogyanEmailVásárlásihogykerülhetlevéllelmegmutatomkategóriájábamotivációs

Forrás: pepitahirdeto.multiapro.com

A Bujdigép Kft. 2004-től biztosít nagyteljesítményű munkagépeket kis- és nagyberuházásokhoz Szegeden, Csongrád megyében és országosan. Béreljen földmunkagépeket, autódarukat, emelőgépeket a Bujdigép Kft.-től. Makó, Kiskunhalas, Baja, Mórahalom, Kistelek, Hódmezővásárhely térségében biztosítunk munkagépeket kis- és nagyberuházásokhoz.


Feladva: 2016-06-13    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: nagyberuházásokhoztőlkisKftmunkagépeketBujdigépMakóSzegedennagyteljesítményűbiztosít2004biztosítunkemelőgépeketSzegedtérségébenautódarukatAnderass

Forrás: pepitahirdeto.multiapro.com

Egy falat Székelyföld, egy falat hagyomány, egy falat egészség. Boltunkban megtalálják a legfinomabb székely kézműves élelmiszereket. A Székely Falat kiváló füstölt hústermékeit, a madarasi, székelyszentléleki és torockói sajtokat, házi vajat, Szász Illyés méhészetéből kikerülő havasi bio mézeket és egyéb mézkülönlegességeket, Gáll Erzsébet házi lekvárjait és szörpjeit, az Ábel székely mustárt, a Csíki áfonyát, a Hargita Gyöngyét és számtalan egyéb székelyföldi manufaktúrákból kikerülő terméket


Feladva: 2015-10-24    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: FalategyszékelyegyébházikikerülőÁbelLászlóIlyésmanufaktúrákbólélelmiszereketszörpjeitBagiSzászszékelyföldikézműveslekvárjaitboltvajatErdélyi

Forrás: pepitahirdeto.multiapro.com

Az MS-METAL KFT. tevékenysége közé tartozik különböző acéltermékek, fémtömegcikkek gyártása, valamint ezen termékek értékesítése. Megrendelőink igényei alapján gyártunk különböző stancolt, hajlított vagy görgőzött, hegesztett lemezalkatrészeket, különböző polcokat, polcszerkezeteket, állványszerkezeteket, fali síneket, fali tartókarokat, valamint raktártechnikai elemeket és egyedi acéltermékeket. A gyártott termékek vasfoszfátos alapozással, elektrosztatikus vagy tribosztatikus porlakk ... további részletek >>

bevonattal készülnek. Termékeink segítségével minden tárolási probléma gyorsan és egyénileg megoldható. Tevékenységünk közé tartozik az álmennyezeti elemek gyártása és értékesítése, mely mind beltéren, mind kültéren használható. A méretválasztékból a kombinációs lehetőségeket kihasználva minden igényt kielégítő polcrendszer állítható össze, legyen az irodában, lakószobában, gyerekszobában, kamrában, garázsban. Ha vásárolni szeretne, válasszon webshopjaink közül!


Feladva: 2016-12-31    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: mindenkülönbözőközévalamintvagymindfaliértékesítésetermékekgyártásatartozikelemeketpolcszerkezetméretválasztékbólhegesztettporlakktevékenységePolc

Forrás: pepitahirdeto.multiapro.com

A német tulajdonban lévő U&D Select Group Dél-Németországba keres: betanított és segédmunkásokat marhavágóhídra és tésztagyárba! Szállás igény esetén biztosított. Munkábajárásban tudunk segíteni. Német nyelvtudás nem feltétetel! Hosszútávú biztos munkalehetőség! Heti 5 munkanap, szombatonként túlórázási lehetőség Magyar nyelvű ügyintézés. Közvetítői díj nincs! Jelentkezni és, érdeklődni a delnemetmunka@gmail.com e-mail címen lehet. Telefon: +49151/26389661 és +3630/6485271


Feladva: 2017-10-19    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: NémetbetanítottDélnyelvűNémetmunkanemcímenmarhavágóhídraMagyarSegédmunkanyelvtudásmailsegédmunkásokatlehetőségcomtúlórázásisegítenikerestudunk

Forrás: pepitahirdeto.multiapro.com

Póló szitanyomás, póló nyomtatás cégeknek, iskoláknak. Egyedi póló kiváló minőségben! Tervezze meg kedvenc pólóját, küldje el nekünk mit szeretne és mi megszitázzuk az ön által kiválasztott színű méretű pólójára. Megrendelését akár személyes, akár postai utánvéttel veheti át. A megrendelt termékeket 5-10 munkanap alatt juttatjuk el önhöz. Nagyobb mennyiségű megrendelések esetében ez az idő akár 10-15 nap is lehet megegyezés szerint. További kérdésére szívesen válaszolunk ... további részletek >>

keressen minket élérhetőségeink egyikén. A Facebook-on is megtalál: www.facebook.com/poloranyomas.hu


Feladva: 2017-02-16    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: pólószitanyomásakárnyomtatáspoloranyomasNagyobbiskoláknakakkorutánvéttelTovábbimitönhözcégeknekpostaiszerintnekünkjuttatjukszemélyesmegegyezés

Forrás: pepitahirdeto.multiapro.com

Tudtad, hogy 2016-tól a Gördeszka Olimpiai sportág? Végre :) Most meg tudod mutatni, ki vagy. Tanulj a Legmagasabb szintű módszerrel. Kerüld az ”utcán haveroktól v. önállóan megtanulom” elvet. Hacsak nem akarod, hogy 30 éves korodra széthulljanak az ízületeid, ínszalagjaid, csontjaid. A sikered 100%-ig attól függ: - ki az oktatód - milyen a technikai-módszer Őrizd meg az egészséged. Legyél Pro deszkás. Tanulj a Legjobb módszerrel. Juss ki akár a 2020-as Olimpiára. ... további részletek >>

Teljesen kezdő vagy? Rémület fog el, ha az esésekre gondolsz? 1) 90 perc alatt 2) Teljesen a Nulláról 3) Alap szinten 4) Stabilan 5) Baleset nélkül, esés-mentesen megtanítunk gördeszkázni.


Feladva: 2017-07-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: 8221meg2020TeljesenakárJussGördeszkamódszerrelhogyTanuljvagyLegyéltudodsikeredPepitaszintenkezdőelvetegészségedMostcsontjaidOlimpiaAlap

Forrás: pepitahirdeto.multiapro.com

Szuper lehetőség! Otthonról végezhető internetes munkára keresem lelkes kollégáim. Ami szükséges hozzá: Internet, számítógép A legjobb, hogy bárhonnan végezhető munka, szuper termékek és segítőkész csapat vesz körül! Kitartó munkával elérheted a legnagyobb álmod is. Írjatok bővebb infóért.


Feladva: 2017-12-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: végezhetőOtthonrólszupermunkalegjobbkörülszámítógéplehetőségveszInternetSiófokcsapathozzáinfóértErzsébetsegítőkészszükségesbővebbHajdutermékek

Forrás: pepitahirdeto.multiapro.com

Az Erő forrás alternatív gyógyászatban Előző életes utaztatásra (Reinkarnációs utazás) lehet jelentkezni. Megtudhatja hogyan élt, viselkedett, mit gondolt és érzett dolgaival kapcsolatban. Felhozhat jelenleg elfeledett emlékeket, kapcsolat rendszereire is válaszokat kaphat...


Feladva: 2017-10-12    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: ErőéletesElőzőéltalternatívemlékekethogyanforráselfeledettMegtudhatjajelenlegjelentkezniSzigetszentmiklósFelhozhatlehetforraskapcsolatbanutazás

Forrás: pepitahirdeto.multiapro.com

Szünetmentes tápegység Kemot tiszta szinuszos Felhasználás terület: a teljesítmény figyelembevételével: - hűtők - hő központok - keringtető szivattyúk - búvárszivattyúk, villanymotorok www.elektroexpressz.hu/spl/499141/ UPS-SZUNETMENTES-TAPEGYSEG


Feladva: 2017-01-22    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: SZUNETMENTESelektroexpresszszinuszostisztatápegységteljesítménysplterületFelhasználáshttpsvillanymotorokbúvárszivattyúkKemotszivattyúkkeringtető300W

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! A Szuvorov Kft. édesipari termékek importálásával és forgalmazásával foglalkozik. Szeretnénk, hogy minél több helyen jelenjenek meg termékeink, ezért várjuk viszonteladók jelentkezését! Szerződött partnereinknek akár kizárólagos forgalmazási jogot tudunk biztosítani, terület megjelöléssel! Az ország távolabbi pontjain található kiskereskedelmi egységek számára, (megrendelt mennyiségtől függően) ingyenesen szállíttatjuk ki megrendeléseiket. Termékeink ... további részletek >>

megtekinthetőek a honlapunkon.


Feladva: 2016-10-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TermékeinkSzuvorovtalálhatóUramakárminélpontjainHölgyempartnereinknekhogymegrendeléseikettávolabbiTiszteltSzerződöttSzeretnénkszállíttatjukország

Forrás: pepitahirdeto.multiapro.com

Az EveNue a budapesti jelmezkölcsönző, ahol a változatos jelmezek között válogathatsz. Itt megtalálod a stílusodnak és alkalomnak megfelelő jelmezt! Farsangi jelmez, Halloween jelmez, party kellék, Star Wars jelmez, Darth Vader jelmez, kalóz jelmez, cica jelmez, boszorkány jelmez, pókember jelmez...


Feladva: 2016-10-05    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: jelmezjelmezkölcsönzőEveNuekellékpartycicamegfelelőbudapestikalózalkalomnakVaderstílusodnakVIIDarthmegtalálodBudapestWarsIttStarválogathatsz

Forrás: pepitahirdeto.multiapro.com

Lakásunk dekorálására rengeteg lehetőség áll rendelkezésünkre a különböző bútorok, berendezési tárgyak, függönyök, textíliák és növények mellett a falmatricák és dekor matricák is remek lehetőséget nyújthatnak ahhoz, hogy teljes mértékig személyre szabjuk otthonunkat. Számos lehetőség közül választhatunk, ha a falmatricák alkalmazása mellett döntünk. A különböző nonfiguratív, állatokat vagy képeket ábrázoló dekor matricáktól kezdve, az egész falat beterítő képekig bármi lehetséges ezzel a ... további részletek >>

felettébb egyszerű módszerrel. A falmatricák hatalmas előnye továbbá, hogy felhelyezésük nem igényel szaktudást és gyorsan elvégezhető, valamit hogy kedvünk szerint kombinálhatjuk őket, ha valami még egyedibbre vágyunk. A színesebbnél-színesebb virágminták, sorminták, egyedi nonfiguratív és állatokat ábrázoló falmatricák csak arra várnak, hogy kiéld velük kreativitásod otthonod falain! Vásárolj nálunk különböző dekor matricákat, és teremts olyan hangulatot lakásodban melyre mindig is vágytál!


Feladva: 2016-10-08    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falmatricákdekorlehetőségkülönbözőmellettahhozrendelkezésünkreválaszthatunkfeletnyújthatnakábrázolóállközülezzellehetőségetképeketrengetegremek

Forrás: pepitahirdeto.multiapro.com

Mire jó az aloe ital? Az ókorban is ismerték gyulladásokkal és fertőzésekkel szemben kifejtett jótékony hatásait. Napjainkban is használják a vírusok, baktériumok, gombák ellen, segítségével kezelhetünk bőrbetegségeket, influenzát, bélgyulladásokat. Az aloe vera ital más szempontból is nagyon egészséges. A kutatások megerősítették, hogy képes szabályozni a vércukorszintet és fokozni az inzulinérzékenységet. Aki rendszeresen fogyasztja, csökkentheti a cukorbetegség kialakulásának esélyét. ... további részletek >>

Közvetett módon a fogyást is támogatja. Aloe vera ital melletti érvek és rendelés weboldalunkon!


Feladva: 2017-08-22    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: italAloeveraMireKittiinzulinérzékenységetmásfogyástNapjainkbanKellérfokoznibélgyulladásokatmódonhatásaitvércukorszintetinfluenzátjótékonyKözvetett

Forrás: pepitahirdeto.multiapro.com

Családi ünneped tennéd színesebbé, emelnéd a fényét, díszítenéd szebbé? Szeretnéd, ha méltó, örök emlék lenne, hogy az érzéseid ragyogjanak benne? Írasd hát meg versben, legyen méltó hozzád, mintha az ünnepet be is aranyoznád! Fejezd ki az érzést, emeld tiszta fényét, tedd szebbé szeretted fontos eseményét. Rendelj verset Aranyosi Ervintől! Ára versszakonként (8 sor): 2.000 Ft


Feladva: 2015-09-08    [Vegyes hirdetések]

Címkék, kulcsszavak: szebbéméltófényétAranyosiversetszínesebbéFejezdcombenneRendeljtennédaranyoznádaranyosiervinragyogjanakeseményétünnepedünnepetversekérzéseidhttp

Forrás: pepitahirdeto.multiapro.com

Velence Korzón második referenciaszalonunkba kreatív, munkájára igényes munkatársat keresünk műkörmös és pedikűrös munkakörbe! Érdeklődj telefonon! - 20 323-7254 www.biohajklinika.hu/hu/dolgozz-ve lunk/cikkek/dolgozz-velunk


Feladva: 2016-08-30    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: VelencekeresünkmunkakörbepedikűrösGabriellaműkörmösNovotniPEDIKŰRÖSTmunkatársatMŰKÖRMÖSTigényesmunkájára7254kreatív323referenciaszalonunkbatelefonon

Forrás: pepitahirdeto.multiapro.com

HULLÁMOSÍTOTT ACÉLHÁLÓ (Heidekker háló) gyártása. Egyedi méretekre és különböző kivitelben gyártott hullámosított acélhálók (Heidekker háló) 18x18 mm-től - 115x115 mm-ig, többféle kockaméretekben: sima normál / álló, diagonál / átlós, valamint duplaszálas átlós kivitelben, 2330,-Ft/m²-től Megrendelhető: Nyíregyháza, Szarvas u 85 www.drotspecial.hu Tel: 06-70/453-8288


Feladva: 2016-10-04    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: HeidekkerhullámosítotthálóNyíregyházatőlACÉLHÁLÓkivitelbenátlósdrotspecialDrótszálvalamintacélhálókwwwdiagonálSzarvasállógyártottnormálkülönböző

Forrás: pepitahirdeto.multiapro.com

Hatékony folteltávolítás kedvező áron. Csepke folteltávolító spray www.mososzerbolt.hu/id/00207_Csepk e_folteltavolito_spray_500_ml__ - Hazai mosószer és tisztítószer webáruház.


Feladva: 2016-01-27    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: sprayfolteltávolítóCsepkeHazaiáronKftkedvezőFuturefolteltávolításCudyHatékonywebáruháztisztítószermosószer

Forrás: pepitahirdeto.multiapro.com

Munkalehetőséget kínálunk a City Cartel Országos ingatlaniroda hálózat nyíregyházi és debreceni irodájában. Feladat: - Kapcsolatfelvétel eladó ingatlanok tulajdonosaival, - Az eladó ingatlanoknak felvétele az iroda adatbázisába, - Az eladó ingatlanok bemutatása a vevőknek, - Adminisztráció vezetése az irodai adatbázisban - Tárgyalások levezetése Amit tőled várunk: - legalább középfokú végzettség - határozott, de rugalmas személyiség; - jól kommunikációs készség, mind személyesen, ... további részletek >>

mind telefonon; - felhasználói szintű számítógépes ismeret - sikerorientált, vállalkozó szellemű, teljesítmény centrikus személyiség - Pályakezdők és tapasztalt szakemberek jelentkezését is várjuk! Amit kínálunk: - megtanítunk az ingatlanközvetítésre - versenyképes jövedelem jutalékos rendszerben - rugalmas munkaidő, magunk osztjuk be az időnket, de teljes munkaidőben dolgozunk; - több mint 15 éves szakmai háttér - folyamatos támogatás, szakmai fejlődés, többszintű képzési program - teljes irodai infrastruktúra a feladatvégzéshez Ha úgy gondolod sikeres ingatlanközvetítő lehetsz, csatlakozz a City Cartel dinamikusan fejlődő csapatához! Pályázatod fényképes önéletrajz formájában küld az alábbi e-mail címekre: City Cartel Ingatlaniroda Debrecen, Miklós utca 45. Személyesen: Takács Tivadar Email: takacs.tivadar@citycartel.hu Mobil: +36 30 749-8828 Nyíregyháza, Szabadság tér 12. fszt.1. Személyesen: Legány András Email: legany.andras@citycartel.hu Mobil: +36 20 323 6459 City Cartel ”Az ingatlaniroda”


Feladva: 2017-09-11    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: CartelCityingatlanirodaeladóSzemélyesenkínálunkingatlanoknyíregyházi8221rugalmashálózatOrszágosirodaiMunkalehetőségetteljesszemélyiségDebrecenmind

Forrás: pepitahirdeto.multiapro.com

Bernát, ez a nagyon szép,7-8 hó körüli kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: 06 ... további részletek >>

70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221örökbevagymentsdgazdaGYEPMESTERIFogaddSÜRGŐSgazdinakNAGYONkutya325elaltathatóakmegegyMEGTELTáltallehetszerintkanTELEPÉrdeklődnikörüli

Forrás: pepitahirdeto.multiapro.com

Az Ozeki IoT szoftvereket és eszközöket gyárt, amely terület robbanásszerűen fejlődik napjainkban. Mit várunk az ideális jelölttõl: - Felsőfokú programozói vagy mérnök informatikus végzettség (Utolsó éves hallgatói státusz, amely nem igényel hallgatói jelenlétet.) - Java nyelvismeret Amiben többet nyújtunk, mint más cég: - Szakmai képzés IoT területen. - Legújabb technológiák és kutatási eredmények használata - Átlagon felüli fizetés az elért eredmények arányában. Jelentkezés ... további részletek >>

módja: A job@ozeki.hu email címünkre küldött önéletrajzzal és jelentkezési adatlappal, vagy a weboldalunkon - www.jobs.ozeki.hu/index.php?owpn=28 Folyamatosan várjuk a jelentkezőket!


Feladva: 2016-07-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: JavaIoTeredményekhallgatói245amelyOzekitechnológiákMitAmibenálláslehetőségmódjavégzettségLegújabbnapjainkbanjelentkezőketnyelvismeretfejlesztvagy

Forrás: pepitahirdeto.multiapro.com

Az immunrendszer erősítők átlagon felüli tápanyagtartalommal nyújtanak biztonságot a betegségekkel szemben. Nemcsak a nátha és az influenza fenyegetik szervezetünket! Az immunrendszer erősítő természetes vitaminok szedésére egész évben szükség van, hogy megelőzzük a gyulladásokat és a krónikus betegségeket. Gyenge ellenállóképességgel jóval nagyobb a veszélye a magas vérnyomás és a cukorbetegség kialakulásának is! Ha több energiához szeretne jutni és visszanyerné vitalitását, a természetes ... további részletek >>

immunrendszer erősítők - mint a méhpempő vagy az olajfalevél kivonat - abban is segítségére lesznek! www.immunrendszer.immunerositok.com/erositese


Feladva: 2018-01-10    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: immunrendszererősítőktermészetesabbanegészjutnibiztonságotellenállóképességgelkivonatszedéséreszeretnenyújtanakGyengeolajfalevélvitaminokenergiához

Forrás: pepitahirdeto.multiapro.com

Nem elég a keresete? Szeretne jobban élni. Akkor most ön jó helyen jár. Hiszen megfelelő időben jó helyen lenni az ami meghozhassa az ön számára is az üzleti életében a siker lehetőségét. Magyarországról nyitott Európa felé az Axxa So Plus termékével az Axxa Global cég. Terméke kiváló, rendkívül népszerű ázsiai országokban. Világ sikere elkerülhetetlen. Axxa Global termék tanácsadóként akár komolyabb plusz bevételi forrás elérése lehetséges. Ha érdekli a lehetőség, regisztráljon ... további részletek >>

Axxa global céghez, a www.axxasoplus.hu, vagy az axxasoplus.blog.hu segítségével, vagy keressen elérhetőségeimen. Kovács Zoltán www.axxasoplus.blog.hu www.axxasoplus.blog.hu infó: axxaglobal2017@gmal.com Tel:06-20/8012282


Feladva: 2017-10-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AxxaaxxasoplusblogglobalwwwtermékhttpZoltánPlushelyenvagyregisztráljonszámáraélnitermékévellehetőségmeghozhassaelkerülhetetlenjobbanérdekli

Forrás: pepitahirdeto.multiapro.com

Szakdolgozatok, házi dolgozatok, bemutatók megírását, tételek kidolgozását, kérdőívek összeállítását és megszerkesztését és egyéb szövegek legépelését vállaljuk. Természetesen formai követelményeknek megfelelően. Gyorsan, olcsón és nem utolsó sorban megbízhatóan dolgozunk! Bővebb részletekért nézd meg a honlapunkat! Ár megegyezés szerint, kérjen árajánlatot üzenetben!


Feladva: 2015-11-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: háziírásszakdogamegirasa@gmailkidolgozásátBővebbkövetkezőTermészetesenamelyettételekdolgozunkhogyvállaljukszerintmegírásátmegbízhatóanÉrtesítjükegyéb

Forrás: pepitahirdeto.multiapro.com

A máj tisztítás csak egészséges felnőtteknek ajánlott, mivel igen igénybe veszi a szervezetet. Azok, akiknek fizikai és lelki állapotuk is megfelelő ahhoz, hogy belevágjanak a kúrába, rengeteg előnyét fogják tapasztalni. A májtisztító kúra hatékonysága megmutatkozik az emésztés javulásában, az allergiás tünetek enyhítésében, az energiaszint növekedésében. Sok egészségi problémán segíthetünk ezzel a természetes módszerrel, hiszen a toxikus anyagok a szervezetben számtalan betegségnek adnak kiváló ... további részletek >>

táptalajt. A máj méregtelenítés, azaz máj tisztítás otthon, egyszerű hozzávalókkal is elvégezhető.


Feladva: 2017-03-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: májtisztításhatékonyságakúramájtisztítófogjáktoxikusakiknekenyhítésébenKittielőnyéthiszenAzoktünetekKellérazazrengetegmódszerrelszervezetethogy

Forrás: pepitahirdeto.multiapro.com

Kézzel készített férfi és gyermek csokornyakkendők nagy választékban. Fényes, matt, virágos, kockás, pöttyös, vintázs kivitelben.


Feladva: 2017-08-20    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: kivitelbenférfivintázskészítettpöttyösKézzelkockásajánlóvirágosHirdetőmattPepitaFényesCsokornyakkendőboltválasztékbannagycsokornyakkendőkgyermek

Forrás: pepitahirdeto.multiapro.com

Betonozható nyers kavics, osztályozott kavics értékesítés féláron! Nyers kavics 700 Ft/tonna. Osztályozott kavics: megrendeléstől függően 1650 Ft/tonna nettó áron. Szemcseméretek: 4-8 mm 8-16 mm és 16-24 mm. Nyers kavics esetében, kitermeléstől függően akár évi 1-2 millió tonna eladása is lehetséges jól szervezett logisztika esetén. Azon cégek jelentkezését várjuk akik nagyobb mennyiséget rendelnek.


Feladva: 2017-06-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: NyerskavicstonnafüggőenféláronkavicsOsztályozott700eseténÚtépítőkkitermeléstőllogisztikaesetébenértékesítésszervezettrendelnekBetonozhatójólIlona

Forrás: pepitahirdeto.multiapro.com

Bruce Willis egyike a legsikeresebb és legkedveltebb világhírességeknek. Számtalan arcát ismerjük, egyszerre változékony és hiteles. A világsztár az LR-rel közösen fejlesztette ki első saját illatát, amely kifejezi személyiségét, és összeköti karakterét egy illattal. Már kapható a második Bruce Willis-illat: a Bruce Willis Personal Edition. Ismerje meg az illatok világát velünk! www.pepitahirdeto.blogspot.com/201 7/07/a-kozmetikumok-vilaga-ismeri-m ar.html


Feladva: 2016-03-26    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: WillisBruceillatmásodikkaphatóelsővilághírességeknekMárfejlesztettelegkedveltebbillattalközösenlegsikeresebbegyrelegyikekarakterétvilágsztárPécs

Forrás: pepitahirdeto.multiapro.com

Látogasson el hozzánk, ha különleges alkalomra való gyertyát keres! Akár belföldről, akár külföldről érkező igény esetén -nagy volumenű munkák tekintetében - alvállalkozóként is szívesen közreműködünk! Legyen szó akár rusztikus, akár adventi gyertya, vagy egyéb más gyertya készítésről, szívesen várjuk megkeresését! Örömünkre szolgál, hogy olyan termékek, gyertyák gyártását végezzük, melyek a hangulatteremtés szimbólumai!


Feladva: 2017-03-28    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: adventigyertyaBarbaraKismindenes

Forrás: pepitahirdeto.multiapro.com

Festmény a léleknek, a lélek festőjétől. Tisza-Kalmár György festménye A festmény címe: Távolban Méret: 18 x 24 cm Anyag: olaj vásznon A ragyogó fehér gyöngyház és a kék különböző árnyalatai adnak erős expresszív hatást a képnek. A festék néhol vastagon került a vászonra, a felületnek gazdag képi struktúrát kölcsönözve. Amennyiben különleges alkotást szeretne, ez a festmény kis mérete ellenére a részletek gazdagságával nagy élményt nyújt. ... további részletek >>

www.tisza-kalmar.hu/index.php/galeria/40-kis-festmenyek/113-olaj-festmeny-1 A festményt személyesen át lehet venni Egyházashetyén (Vas megye, Sárvár közelében), vagy futárszolgálat kézbesíti a megadott címre.


Feladva: 2016-09-15    [Régiség - Művészet]

Címkék, kulcsszavak: festmenyolajkisfestményeGyörgyKalmártiszawwwragyogófutárszolgálatAmennyibenléleknekképneknyújtvásznonvagykölcsönözveEgyházashetyehatástélményt

Forrás: pepitahirdeto.multiapro.com

Számlaképes cégünk vállalja lakások, házak, irodák, komplett költöztetését, lomtalanítását, épületen belüli átrendezését. Igény szerint csomagolunk vagy csomagolóanyagot kiszállítunk, rakodási, szerelési feladatokat is végzünk. Minőségi, gyors munka több éves tapasztalattal, referenciával, hétvégén is hétköznapi árakon! Akár lakáscsere lebonyolítását is vállaljuk. T: +36 (70)23 53 403, +36 (1) 787 0230


Feladva: 2017-05-22    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: csomagolunkvállaljuklakásokmunkaszerintlebonyolításátvállaljagyorsIgénylakáscserecégünkMinőségiátrendezésétAkárSzámlaképesvégzünkbelüliárakon0230

Forrás: pepitahirdeto.multiapro.com

Alan speciális mentőként dolgozik, amíg egy nap egy bányaszerencsétlenségnél elveszti a látását. Úgy érzi, kicsúszik lába alól a talaj. Már-már teljesen belesüllyed az önsajnálatba, amikor összeismerkedik egy fiatal tanárnővel, aki képes őt pocsék állapotából kirángatni. A nőnek sem könnyű, hiszen ő meg egy autóbalesetben sérült meg. Kapcsolatuk hát nem mindennapi, de újabb fordulat történik: találnak egy donort, így a férfi visszanyeri látását. Vajon kapcsolatuk az újabb fordulat ellenére ... további részletek >>

megmarad olyannak, mint a kezdetekkor? http://adamobooks.com/termek-Vakon-szeretni-87.html


Feladva: 2016-09-30    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: egykapcsolatukmárcomadamobookslátásátmegszeretnifordulatVakonújabbamígmindennapitermekállapotábóldolgoziknempocsékVajontalajmentőkénthát

Forrás: pepitahirdeto.multiapro.com

Bécsi úti referenciaszalonba felelősségteljes, munkájára igényes lelkes és kreatív, a szakma iránt elkötelezett fodrász munkatársat keresünk! Ha érdekelnek a vegyszermentes csúcs technológiák, és a környezet tudatos anyagok, és szeretnéd a legjobbat ajánlani vendégeidnek, nálunk a helyed! Elérhetőség: 20/ 323-7254-s számon!


Feladva: 2017-05-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkanyagokirántBudapestszámontudatosszakmaGabriella7254környezetkreatívNovotni323technológiáklelkesFodrásztElérhetőségcsúcsigényeshelyed

Forrás: pepitahirdeto.multiapro.com

Elégedetlen a könyvelőjével? Új vállalkozást tervez? Adótanácsadásra van szüksége? Ne késlekedjen, keressen bennünket! Szombathely belvárosában több mint 15 éves szakmai tapasztalattal, valamint ügyvédi és könyvvizsgálói háttér biztosításával várjuk leendő megrendelőink jelentkezését Szombathely agglomerációs körzetéből is. Ügyfeleink igénye esetén a könyvelési anyagok a vállalkozás telephelyén történő átadása lehetséges. Teljes körű számviteli szolgáltatás ellátását vállaljuk egyéni ... további részletek >>

vállalkozók, Kkt-k, Bt-k, Kft-k, Rt-k, részére.


Feladva: 2016-10-05    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzombathelyszolgáltatásszámvitelikörűTeljesKftegyénimintkönyvelőjévelvállalkozásleendőtöbbvállaljukElégedetlenanyagokvárjukbelvárosábanellátását

Forrás: pepitahirdeto.multiapro.com

Dolgozzon Amerikában! Házvezetőnői, szállodai munkák (szobák takarítására, párok jelentkezését is várjuk). Nyári tábori munkák. Jelentkezés e -mailben, vagy telefonon itt: www.amerikabandolgozni.hu Telefon:70 401 0882 Víberen is


Feladva: 2017-02-03    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: AmerikábandolgoznimunkákVíberen0882táboriBudapest401NyáriTelefonvárjukamerikabandolgoznijelentkezéséthttppárokitttakarításáratelefononszobák

Forrás: pepitahirdeto.multiapro.com

Alumínium zsalugáterek készítését vállaljuk — A FEMARKZSALU Kft új szolgáltatása: ajtó- és ablakzsaluk készítése alumíniumból. A számos variáció közül ajánljuk a védő zsalugátereket (biztonsági és nem biztonsági) típusban. Kérje ajánlatunkat méret szerint! www.femarkzsalu.hupont.hu/9/alumin ium-zsaluk-keszitese


Feladva: 2017-04-04    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: biztonságiKftFEMARKZSALU8212közülvállaljukszerintvariációkészítésétméretszámoszsalugáterekajánlatunkatalumíniumbólAlumíniumKérjekészítésetípusban

Forrás: pepitahirdeto.multiapro.com

Horvát Tengerpart Zadar! Kiadó Tengerparti Apartmanok! Kedvezményes apartman kínálatok! Már most foglalja le Álmai apartmanját Nyári Tengerparti nyaralásához! Akciók már 39 Euro/4 fő/apartman/nap! Felejtse el a Booking.com-ot! Nálunk minősegi garancia van és olcsóbbak vagyunk min. 30%-al mint a Booking. Személyesen adunk át minden apartmant a vendégeinknek és bármikor ott a magyar kolléga Zadarban, ha segítség, vagy információ kell. Alkudni lehet! Ne felejtse el, spórolhat ... további részletek >>

idejekorán megkötött előfoglalásával és a legjobb tengerparti apartmanjaink közül választhat! Közvetlen információs profilunk ajánlatokkal: www.facebook.com/zadarkiadoapartmanokraczattila Ha szeretné hogy a barátai is lássák a hirdetést, ossza meg az idővonalán is. Kiadó Tengerparti Apartmanok Már 10 Euró/fő-től! Nyaralást, vagy örök tengeri hajóvezetői jogosítványt szeretnének? Akár Egy nap alatt? Esetleg Tengerparti Ingatlant Vásárolnának Magyar zadari ügyintézéssel? Keressen! Ha tetszik a Horvát Tengerpart, Hirekért, kedvezményes Szállás ajánlatokért, ingatlanvásárlásért-tanácsadásért jelöljön ismerősnek bennünket, vagy a honlapon az információs profilunk linkje: www.facebook.com/zadarkiadoapartmanokraczattila Honlapunk: www.horvatapartman.eu Ha szeretné hogy a barátai is lássák a hirdetést, lájkolja és ossza meg az idővonalán is!


Feladva: 2016-10-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: TengerparticomvagywwwApartmanokKiadófelejtseosszaMagyarfacebookhirdetéstlássákprofilunkkedvezményesbarátaiZadarbookinghogyTengerpartszeretné

Forrás: pepitahirdeto.multiapro.com

Falmatrica, faltetoválás, faldekoráció webáruház. Olcsó falmatricák, óriási választék! Ha unod otthonod egyszínű, fantáziátlan falait...


Feladva: 2016-10-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falmatricashopwwwwebáruházfaldekorációfaltetoválásFalmatricaválasztékóriásifalmatricákOlcsó

Forrás: pepitahirdeto.multiapro.com

Személyre szabott gyógynövény teák tanácsadással. Minőségi szálas teák, gyógynövényes teakeverékek, tearendelés a termelőtől! Rigó teák Vegyszermentes kistermelés, gyűjtés, gondos válogatás. Íz-illat-harmónia.


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teákgyógynövényszálasMinőségiVegyszermentesszabottSzemélyreRigóteakeverékektanulóillatgyógynövényesIstvánválogatásgondosgyűjtéstanácsadássalEger

Forrás: pepitahirdeto.multiapro.com

Könyv kínálatunkban leginkább gyerek és ifjúsági könyvek szerepelnek, de a felnőttek számára is vannak ajánlataink. Nagy figyelmet fektetünk a tanulást segítő könyvek terjesztésére is, ezért azokat egy külön kategóriába gyűjtöttük össze. A gyermekek számára foglalkoztató könyvek és füzetek is nagy választékban elérhetőek. Minden könyv 20 % kedvezménnyel kapható! A könyveken túl plüssök, fiús és lányos játékok, gyermekruhák, gyermekágyneműk, párnák és sok más ajándékötlet szerepel a ... további részletek >>

palettánkon. Mi abban szeretnénk segítséget nyújtani mindenkinek, hogy a szívéhez közelálló ajándékot megtalálja. Ha ajándékot adsz másnak - azzal magadat is megajándékozod mert, bármi válhat ajándékká - egy ölelés, egy boldog mosoly… Nézz be webáruházunkba és szerezz örömöt szeretteidnek a honlapunk kínálatából!


Feladva: 2016-10-19    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: egykönyveknagyajándékotszámárakönyvazzalválasztékbanszeretnénkazokatmosolylányosifjúságimásnakabbanezértboldogfiúsgyerekadszfüzetekplüssök

Forrás: pepitahirdeto.multiapro.com

Logisztikai és szállítási munkára keresünk Munkatársakat Németországba akár AZONNALI kezdéssel BRUTTO 8,91 EURO / ora kezdō fizetéssel Amit kinalunk: -europai szintu fizetes BRUTTO 8,91 EURO / ora + 1,7 EURO NETTO ejszakai potlek orankent -a szallas a ceg altal biztositva lesz -a bejelentes minden esetben Nemetorszagban a kinti jogviszonyoknak megfeleloen fog megtortenni Amit elvarunk: -MINIMUM tarsalgasi szintu angol vagy nemet nyelvtudas -erkolcsi bizonyitvany (postan vagy ... további részletek >>

ugyfelkapun keresztul ingyenesen kikerheto) -terhelhetoseg Regisztráljon ingyenesen a www.nrgkulfoldimunka.hu oldalon es mi felvesszük Önnel a kapcsolatot, vagy hívjon bizalommal az alábbi telefonszámokon: +3670/627-5010 +3670/908-5010


Feladva: 2017-10-24    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: EUROvagy3670szállításiLogisztikaiingyenesenszintuoraBRUTTOAmit5010bizonyitvanyeuropai908fogmunkáraoldaloncegerkolcsikinalunkmegfeleloen627

Forrás: pepitahirdeto.multiapro.com

Ingatlant kínál, keres, cserélne, bérelne? Nézze meg a mi kínálatunkat! Eladó házak, lakások, irodák, nyaralók, telkek, panziók, üzletek, villák és sok más ingatlan a weboldalon. Országos hirdetési lehetőség, miután regisztrált nálunk, az oldal kezelése és a hirdetések feladása nagyon egyszerű - és ingyenes. Látogasson el Ön is az oldalunkra, és nézze meg a kínálatunkat!


Feladva: 2018-01-04    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kínálatunkatmegnézzenyaralókingyenesIstvánhirdetésiirodákegyszerűTormaOrszágoslakásoknagyontólweboldalonházakfeladásaIngatlanokingatlanEladó

Forrás: pepitahirdeto.multiapro.com

Biokandalló gyártás, BIOKANDALLÓ forgalmazás. BIO KANDALLÓ AKCIÓ! BIOKANDALLÓ VÁSÁR! Falra szerelhető BIOKANDALLÓ, Falba építhető BIOKANDALLÓ, Körbeépíthető BIOKANDALLÓ. Sarokba szerelhető BIO KANDALLÓ Asztali BIOKANDALLÓ. BIO ETANOL, BIOETANOL forgalmazás. A BIOKANDALLÓK bio ETANOLLAL üzemeltethetőek. A rozsdamentes anyagból készült BIOKANDALLÓ égők hosszú élettartamot biztosítanak BIO KANDALLÓINKNAK. Minden biokandalló égő szabályozható teljesítményű, így az égési idő széles ... további részletek >>

tartományban változtatható. A biokandallók az égés folyamán csak vízpárát és egy nagyon kevés szén dioxidot termelnek, ami teljesen veszélytelen a szervezetre. A BIOKANDALLÓNAK NEM KELL kéményt építeni! Nincs CO MÉRGEZÉS VESZÉLY! A biokandalló használatánál csak szellőztetni kell, így pótolva a friss levegő utánpótlást. www.biokandalló.com


Feladva: 2016-11-11    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: biokandallóBIObiokandallókAKCIÓgyártásKANDALLÓszerelhetőígykellcsakforgalmazásVÁSÁRcomhasználatánálamiBIOETANOLváltoztathatóVESZÉLYbiztosítanak

Forrás: pepitahirdeto.multiapro.com

Értékesítésben jártas munkatársat keresek. Egészségtudatos, kitartó, célorientált, magáért tenni akaró személyt keresek, számítógépes ismeret előnyt jelent, mivel profi online eszközökkel dolgozunk.


Feladva: 2017-08-22    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekjártasÉrtékesítésbenmunkatársatszámítógépesArankaszemélytdolgozunkakaróeszközökkeltennionlinemagáértproficélorientáltmivelkitartójelent

Forrás: pepitahirdeto.multiapro.com

Egyedi tervezésű, fából, kézzel készült, pirográffal (fába égetési módszerrel) gravírozott, tollak, tolltartók, ékszerek, táblák, fali órák, és egyéb kis fa csodák... A termékeket a saját elképzelésed szerinti szöveggel, grafikával és névre szólóan is elkészítjük számodra. Sokféle alkalomra ötletes, és igazán személyhez szóló ajándék.


Feladva: 2017-09-21    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ajándékelkészítjükKedvesegyébpirográffalszólóanórákkészültnévrefalikézzelgrafikávaltáblákszólófábólszöveggelékszerekszemélyheztervezésűszerinti

Forrás: pepitahirdeto.multiapro.com

Balatonlellén családi ház már 5 személytől max 16 főre kiadó. Családoknak ideális. Ingyenes wifi, biztonságos parkolás zárt udvarban. Ár megegyezés szerint.


Feladva: 2015-10-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: családiBalatonlellénkiadóházudvarbanzártparkolásBalatonlellebiztonságosJánoswifiSzabóIngyenesideálisCsaládoknakszerintfőremegegyezés

Forrás: pepitahirdeto.multiapro.com

Szeretnéd meglátogatni Peru legismertebb nevezetességeit mint Machu Picchu romjai, a Titicaca-tó vagy a Colca-kanyon? Esetleg olyan látnivalók érdekelnek, amikről olvastál de nem szerepelnek az utazási irodák ajánlataiban? Jelenlegi perui lakosként több éves latin-amerikai barangolásaim tapasztalatával vállalom személyre szabott nyaralások megszervezését és lebonyolítását magyar nyelvű utaskísérőként kedvező áron. Info: www.facebook.com/peruinyaralas és www.payasyougoholidayperu.com


Feladva: 2016-08-24    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: peruiáronnyaraláscomwwwPeruajánlataibankanyonInfomeglátogatnivállalomirodákColcaSzeretnédtapasztalatávalutazásivagykedvezőLimabarangolásaim

Forrás: pepitahirdeto.multiapro.com

A DXN-nél semmi... Átáll a cég egy másik, mobil barát kinézetre. Hát abba már nem fér bele az a fajta blogolás, amit néhányan annak tartottak. Feltételezhető azonban, hogy van rengeteg normális DXN üzletépítő, akik azért még folytatnák... Nekik fenntartunk egy lehetőséget, amivel a saját DXN oldalukra tudnak látogatókat szerezni. Titok nincs, kereshetőnek kell lenni! (Persze csak annak, aki kereshető akar lenni...) ... további részletek >>


Feladva: 2017-08-16    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: DXNlenniannakblogolásegyhogyajánlófenntartunkwwwazonbanabbaTitokHirdetőNekikFeltételezhetőHátszerezniPepitahtmlfolytatnákakartartottakmég

Forrás: pepitahirdeto.multiapro.com

Olcsó új gyerekruhák és játékok! Gyerekruhák bébi, gyerek és kamasz méretekben, bébi kiegészítők nagy választékban. Több mint 10.000 gyerekjáték a bébitől egészen 12 éves korig. Személyes átvétel Budapesten, házhoz szállítás az ország egész területén.


Feladva: 2016-03-27    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: GyerekruhákbébijátékokOlcsóJátékBudapestenválasztékbanátvételnagySzemélyeskiegészítőkkorigkpjatekévesméretekbenwwwegészenkamaszterületénbébitől

Forrás: pepitahirdeto.multiapro.com

Az iratcsipesz, vagy Binder csipesz iratok, papírlapok gyors és sérülésmentes összefogására alkalmas. Az iratcsipesz rozsdamentes acélból készül, rugalmasságát nagyon hosszú ideig megőrzi. Az iratcsipesz nyom nélkül eltávolítható majd újra felhasználható. 10 ötlet az iratcsipesz használatára: www.youtube.com/watch?v=prG3qWjp4N k


Feladva: 2016-07-14    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: iratcsipeszcsipeszBinderötletrugalmasságátfelhasználhatókészülvagyújraacélbólBudapestmajdrozsdamentesprG3qWjp4Nkwtseltávolíthatóalkalmaswatchcom

Forrás: pepitahirdeto.multiapro.com

”B” kategóriás jogosítvánnyal vezethető kisteherautók bérbeadása Budapesten és környékén rövid távra, vagy hosszú távra is tartós bérlettel, akár külföldre is. www.teherautorent.hu +3630/298-4353


Feladva: 2017-04-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: távra8221rövidbérlés3630környékénTeherautóteherautorentBudapestenwwwbérbeadásakülföldrekisteherautókakárvezethetőbérletteljogosítvánnyaltartós298

Forrás: pepitahirdeto.multiapro.com

Kényeztető kozmetikai kezelések, masszázs és alakformálás Budán a Mechwart ligetnél. · Kozmetikai kezelések · Masszázs · Sminktetoválás · Manikűr - Pedikűr Kozmetikai webshopunk: www.algothermshop.hu


Feladva: 2017-10-02    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: 183KozmetikaiMasszázskezelésekligetnélEsztétikaalgothermshopMechwartAlgothermwwwBudánwebshopunkalakformálásKényeztetőPedikűrkerManikűrBudapest

Forrás: pepitahirdeto.multiapro.com

A bélflóra egészségünk szempontjából hasznos és káros baktériumokat is tartalmaz. Több száz mikroorganizmus él itt, alapvetően egyensúlyban. Ám számos tényező van, ami ezt az egészséges egyensúlyt felboríthatja, pl. a stressz, a dohányzás, az alkoholfogyasztás és az antibiotikumok. Miért fontos a bélflóra helyreállítása? A károsodott bélflóra nem tud kellő támogatást nyújtani az immunrendszernek, így ha nem gondoskodunk a regenerálásáról, hosszútávon egészségünk romlani kezd, akárcsak a ... további részletek >>

közérzetünk, vitalitásunk. Ha gyakran kapunk el fertőzéseket, gyanakodhatunk! A bélflóra helyreállítása probiotikummal 100%-ban természetes módon történhet.


Feladva: 2017-04-21    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: bélflórahelyreállításaegészségünkfontosMiértnemkellőprobiotikummalegészségesTöbbromlanitudezttartalmazkárosodottamibaktériumokathosszútávonvan

Forrás: pepitahirdeto.multiapro.com

Vállalom: - Kft-k, Bt-k, kis- és közép vállalkozások teljes körű munkavédelmi, tűzvédelmi képviseletét - Oktatásokat, kötelező munkavédelmi kockázatértékeléseket - Új típusú Tűzvédelmi Szabályzatok készítését, zaj, fény, hő, pára mérések elvégzését Természetesen számlával. Bővebb információ, referenciák, megjelent publikációim a honlapomon megtalálhatóak: www.munkaszabo.5mp.eu


Feladva: 2016-05-08    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: munkavédelmiTűzvédelmiközépBővebbtípusúkisszámlávaléttékelések5mpKftTermészetesenkockázatmunkaszaboVállalomelvégzésétwwwZoltánmérésekkötelező

Forrás: pepitahirdeto.multiapro.com

Kizárta magát? Nem nyílik az ajtó? Akad, szorul a zár? Hívjon és megoldjuk! Minden jellegű zár probléma gyors megoldása Budapest és Pest megye területén. Díjtalan kiszállás Budapest területén. www.zarcsere.eu Zárcsere - Zárcsere gyors szerviz éjjel-nappal.


Feladva: 2017-05-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: ZárcsereBudapestzarcserezárterületénnyílikgyorsNemproblémamagátwwwKizártahttpjellegűZárnyitásMindenZárszervizmegoldjukkiszállásHívjonDíjtalan

Forrás: pepitahirdeto.multiapro.com

Motormentés, motorszállítás. Budapest területén átalánydíj 6000.- Budapesten kívül 6000.- + Budapest határától, Budapest határáig 100.-/km.


Feladva: 2017-08-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BudapestMotormentés6000határátólkívülBudapestenátalánydíjterületénmotorszállítás100határáig

Forrás: pepitahirdeto.multiapro.com

Megújult műsorral, új felállásban vállalunk fellépéseket: - falunapokon - céges rendezvényeken, bálokon. Hívjanak bizalommal. Élőzenés előadás, nem playback! Elérhetőségek és ízelítő a műsorokból a honlapon hallgatható formában. CD rendelést felveszünk Ének: Lehoczky Judit - retró - örökzöldek (angol, német, olasz nyelven) - magyar nóta - csárdások - cigány dalok - mulatós - operett német nyelven - német slágerek (német nyelven)


Feladva: 2017-04-04    [Zene - Hangszer]

Címkék, kulcsszavak: németnyelvenhonlaponJuditLehoczkyÉneklehoczkyjuditBennünketolaszkezdjükhttpBizalommalangolfelállásbanhallgathatóhívjanakörökzöldekműsorralbálokon

Forrás: pepitahirdeto.multiapro.com

Költöztetéssel, szállítással, megrendelőink nagy megelégedettségére! Tevékenységünk köré tartozik a Pianínó és Zongora szállítás is. Bízunk benne hogy minket választ. Kérem tekintse meg a költöztetés kalkulátorunkat, amivel ön előre ki tudja számítani a költöztetés árát! Nem csak Budapesten, hanem Vidéken is költöztetünk.A Költöztetés Budapest oldalon, További Információ: www.koltoztetesbudapest.eu vagy www.pianinoszallitas.eu Főbb tevékenységi területeink: Budapest, Budaörs, Budakalász, ... további részletek >>

Budakeszi, Dunakeszi, Dunaharaszti, Érd, Fót, Göd, Gödöllő, Gyál, Halásztelek, Kistarcsa, Mogyoród, Nagytarcsa, Őrbottyán, Pécel, Pilisvörösvár, Pomáz, Ráckeve, Szentendre, Szigethalom, Szigetmonostor, Szigetszentmiklós, Tököl, Törökbálint, Üllő, Vác, Vecsés, Veresegyház.


Feladva: 2017-02-26    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KöltöztetésBudapestwwwVácTevékenységünkPécelcsakDunaharasztiválasztÜllővagymegelégedettségéreŐrbottyánNemDunakesziminketTörökbálintnagyNagytarcsa

Forrás: pepitahirdeto.multiapro.com

A méh pempő nemcsak étrendkiegészítőnek kiváló, de a bőr- és hajápoláshoz is az egyik legjobb termék. A méhek állítják elő, hogy ezzel a sűrű, ragacsos anyaggal táplálják királynőjüket. A méh pempő áldásos hatásait az ember már korán felfedezte és alkalmazza ma is szinte valamennyi betegség ellen sikeresen. Hatásait annak köszönhetjük, hogy benne rendkívül sok hasznos anyag található. A létfontosságú tápanyagok mellett számos más értékes összetevőt tartalmaz, többek közt acetilkolint és 10-HDA ... további részletek >>

savat is. Ezek adják intenzív gyulladásgátló antivirális és az agyműködést elősegítő hatásait.


Feladva: 2017-07-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásaithogypempőméhkiválóértékessűrűbenneétrendkiegészítőnekintenzívkoránmásezzelnemcsakadjákmárszámoselőköszönhetjükKittiEzekemberannak

Forrás: pepitahirdeto.multiapro.com

BURKOLÓi állásunk Mannheim közelében2 http://www.nemetmunka.hu/allasaink.html Németországi állásainknál mindig direkt a német cég a munkaadó! -4 fő BURKOLÓ (hideg) Fix állás, ill. cég jelentkezése esetén a burkoló cég alvállalkozóként. -A munka a Mannhein-Heidelberg-Landau háromszögben van, 16 éve működő stabil hátterű német cégnél. -Az egyénileg jelentkezőket felveszi a cég 14€ Bruttó kezdő órabérrel, ami 19,-€-ig emelkedhet. Szállás az első 3 hónapban ingyenesen ... további részletek >>

megoldott, utána 150,-€/hó. A munkábajárás céges kocsival történik. Baustelle némettudás kell! (melós német) Hosszútávú munkát keresők jelentkezését várjuk. A cégként vagy vállalkozóként jelentkezőkkel a német cég vállalkozási szerződést köt, egyéni megállapodás szerint (magyar Bt, Kft is jó). 3-4 fős csapat esetében 1fő beszéljen németül. Jelentkezni lehet: (e-mailben, regisztrálással, telefonon) 1.) E-mailben, német nyelvű fényképes önéletrajzzal és telefonszámmal. info@nemetmunka.hu 2.) Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3.) Telefonon munkaidőben a magyar 06 1 920 3433 ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9.00-17.00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-09-10    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: németcégburkolóMunkanemetmunkawww8364TeamVárjukillhtmlállásmagyarhttpmailbenTelefononjelentkezésétvagy8641németülhónapbanNémetországirégi

Forrás: pepitahirdeto.multiapro.com

Zeneszolgáltatás! Mulatós < Vendéglátós < Örökzöld zenék. Balatonlelle és távolabbi környékén, megfizethetően árazva. Hívjanak bizalommal! id.Bertalan József + egy fő hölgy hegedűs!


Feladva: 2017-11-18    [Zene - Hangszer]

Címkék, kulcsszavak: ZeneszolgáltatásBalatonlelleJózsefBertalanbizalommalhivjanakárazvamegfizethetöenkörnyékéntávolabbihegedüshölgyzenékegyÖrökzöldVendéglátosMulatós

Forrás: pepitahirdeto.multiapro.com

Sziasztok vonósok! BEIRATKOZÁS MOST!!! Egyéni módszeremmel, könnyedén, jó hangulatú hegedű órákkal várom a tanulni vágyókat Budapesten!!! Nálam nincs botkezű, botfülű ember, csak hegedülni szerető és tanulni vágyó emberkék vannak, akik szeretnek nálam tanulni és örömmel vesznek részt az órákon!!! Nincs korhatár, lehetsz 5, vagy 60 éves, egy a fő! Akarj és szeress hegedülni tanulni, mert az csodálatos! MINDEN HEGEDÜLNI VÁGYÓT SZERETETTEL VÁROK!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: tanulniHEGEDÜLNINincsnálamBudapestvagyvannakórákkalVÁGYÓTOroszlánlehetszemberkékhegedűÁRONkorhatárvágyóhangulatúMINDENAKCIÓSszeretőkönnyedén

Forrás: pepitahirdeto.multiapro.com

Magyar termék, közvetlenül a gyártótól. 5 év garancia! Új ZS-Therm vegyes-tüzelésű kazánok: 15,22,27,35kw teljesítményben már 71.500 Ft + áfától. Kizárólag nyitott rendszerre (próbanyomás: 0,8 bar), vagy akár zárt rendszerre (próbanyomás: 3 bar) is szerelhetők. A kazánokhoz tartozékok megvásárolhatók 8000 Ft + áfás áron. Kazánjaink VM MGI vizsgálatával, TÜV Tanúsítvánnyal és CE Megfelelőségi jellel rendelkeznek. A kazánok mellett fűtési puffertartályok, gabonakanalak, pótkocsi ... további részletek >>

felépítményekhez hajlított trapézlemezek gyártásával is foglalkozunk. Ezúton szeretnénk felhívni figyelmüket a puffertartály akciónkra! Pl: 1000 literes puffertartály 69000 Ft + áfa! Termékeink értékesítéséhez hazai és külföldi (szlovák, román) viszonteladókat keresünk. Bővebb információért forduljon hozzánk bizalommal!


Feladva: 2017-10-02    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: barpróbanyomásrendszerretüzelésűvegyeskazánokpuffertartályhajlított500keresünkTanúsítvánnyalMagyarliteresszerelhetőkfelépítményekhezmárTÜVajánlás

Forrás: pepitahirdeto.multiapro.com

A Lada Vesta stílusos, merész és ragyogó – pont, mint amilyennek egy új generációs Ladának lennie kell. A szedán sziluettje korszerű és harmonikus, az X forma egységként kíséri végig a karosszériát. Az új, bátor stílus könnyen felismerhető a részleteiben: a fekete színnel kiemelt radiátor borításban, a lenyomatokban az oldalakon, a hátsó fényszórók fényvisszaverőin. A megemelt öv vonalának, meghosszabbított motorháztetőnek illetve lejtős tetőnek köszönhetően a Vesta külsőre is sportos és ... további részletek >>

dinamikus. Egy ilyen autóval nehéz észrevétlennek maradni az utakon. Vesta. A LADA új arca. www.ladaszolnok.hu/vesta_sedan_ismerteto


Feladva: 2017-04-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: vestaLADAEgymeghosszabbítottmintsedanszínnelilyenformavonalánakpontfeketeharmonikusmegemelt8211ladaszolnokrészleteibendinamikuskorszerűragyogó

Forrás: pepitahirdeto.multiapro.com

Zalakarosi kiadó szálláshelyek fényképes gyűjtőoldala. Hotelek, panziók, vendégházak, apartmanok, magánszálláshelyek, kiadó szobák, fényképekkel, árajánlatokkal, elérhetőségükkel. - Közvetlen (Online) foglalási lehetőség a szálláshelynél. - Közvetítési díj nélkül, a legolcsóbb áron. - Egész évben nyitva tartó, kiadó szállások. - SZÉP kártya, (Széchenyi Pihenőkártya), elfogadó szállások - Kedvező árak! - Több száz fényképpel a szálláshelyekről és a településről! - Weblap: ... további részletek >>


Feladva: 2017-12-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kiadószállásokzalakaroszimmerinfohtmKözvetlenárakfényképesEgészelérhetőségükkelKedvezőszálláshelyekáronárajánlatokkalZalakarosilegolcsóbbwwwnélkül

Forrás: pepitahirdeto.multiapro.com

Angol nyelvtanítás, korrepetálás, felkészítés nyelvvizsgára, állásinterjúra, közép és emelt szintű érettségire Szolnok belvárosában diplomás nyelvtanárral.


Feladva: 2017-09-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nyelvtanításAngolSzolnokbelvárosábanbarnaérettségireszintűemeltközépállásinterjúranyelvvizsgárafelkészítésnyelvtanárralkorrepetálásdiplomás

Forrás: pepitahirdeto.multiapro.com

A BlackStyles webshop egyedi mintás és feliratos pólók, illetve pulóverek színes választékával és igen kedvező árakkal várja a kedves vásárlókat!


Feladva: 2017-07-31    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: webshopBlackStylesTamásválasztékávalOrbánszínesPólópulóverekOnlineilletvepólókvásárlókatfeliratoskedvesmintásvárjaegyediárakkalkedvezőigen

Forrás: pepitahirdeto.multiapro.com

Nyíregyházán két utcával határolt 4650 m2 telephely, építési teleknek is, az ukrán, román, szlovák határokhoz vezető 41-es főút 6-os km-nél eladó. A városközpont 4 km, az M3-as autópálya 1 km, a határok 50-100 km távolságra vannak. Sok célra alkalmasan, lekövezve, bekerítve, közművesítve, tetszés szerint oszthatóan. 63 m széles. A telek előtt 23 ezer gépjármű megy el naponta.


Feladva: 2017-05-03    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 245251bekerítvenélgépjármutcávallekövezvevezetezerkétalkalmasanhatárokhozNyíregyházáncélraszlováktelekNyíregyházaSokrománszélesJános100

Forrás: pepitahirdeto.multiapro.com

A Tilta Gravity G1 egy rendkívül könnyű, egyszerűen kezelhető, csúcsminőségű egykezes gimbal, professzionális használatra. Köszönhetően a 0-tól 3 kg-ig terjedő terhelhetőségének, kompatibilitása egyedülálló: a nehezebb DSLR konfigurációtól, a MILC és GoPro kamerákon át az okostelefonig szinte bármivel használható. Ezt nem csak a kifinomult vezérlésnek és a páratlanul erős motoroknak, hanem az egyedülálló váz-kialakításnak köszönheti, amely hosszabb és erősebb, mint bármely más egykezes ... további részletek >>

gimbalnál. Kiterjeszti az alkalmazhatóságát a gimbal markolat felett elhelyezkedő jobb és baloldali rozetta, amelyre monitor, mobil telefon (élőképhez), follow focus vagy más kiegészítő csatlakoztatható. A Gravity G1 markolata egy mozdulattal eltávolítható és a rozetták segítségével egyszerűen kétkezes gimballá alakítható. A működés finomhangolása bluetooth kapcsolaton keresztül a TILTA Assistant App (Androidra és iPhone-ra) segítségével történik. Bővebben: www.gaia.hu/tilta-gravity-g1-gimbal-stabilizator-grt02g1.html


Feladva: 2017-09-04    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: gimbalgravitytiltamássegítségévelegyszerűenegyedülállóegyegykezesbármelyKöszönhetőenfinomhangolásaerőskameracsatlakoztathatókamerákonBővebbenmint

Forrás: pepitahirdeto.multiapro.com

Kedvező áron vállalom I. osztályú kerítés lécek készítését kemény fából, légszáraz anyagból. A kerítéslécek 22 mm vastagságban, bármely marásmintával, gyalulva és csiszolva készülnek, igényes minőségben. Dísz- és élberakott kerítésléceket, lapkerítéseket, kutyaházakat készítek, a vásárló igényének megfelelően. Akár saját tervezés alapján is. Szállítás megegyezés szerint az egész országban. Hívjon bátran, vagy írjon!


Feladva: 2017-08-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: lécekkerítésosztályúmegegyezéslapkerítéseketvastagságbanlenadebora@gmailvállalomSzállításkerítésléceket22mmírjonáronalapjánÉlberakottkerítéslécekvagy

Forrás: pepitahirdeto.multiapro.com

Kútfúrás. Engedélyes kutak fúrása. Víznyelők fúrása kedvező áron! Bízza szakemberre! Tökölön, Dunaharasztiban, Soroksáron. Kézi és gépi kútfúrás. Csepel-szigeten és környékén. Budapesten és környékén. Szentendrei szigeten, Pest megyében. Minőségi anyagokkal és szűrőkkel. SZAKMUNKA, precíz kivitelezés, megfizethető árak. Cső átmérő: 40 mm-től 125 mm-ig. Hívjon bizalommal!


Feladva: 2014-09-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kútfúrásfúrásamegyébenPestszigetenMegfizethetőkörnyékénáronkedvező9642PrecízCsepelbizalommalSZAKMUNKAVíznyelőkHívjonszűrőkkelgépikutak125mm

Forrás: pepitahirdeto.multiapro.com

Adatrögzítést, gépelést vállalok. Jegyzőkönyv készítését értekezletről, közgyűlésről, konferenciáról, gyorsírással, hanganyag készítésével. Gépelést, szövegszerkesztést, hanganyagok leírását, adatfeldolgozást, adatbázis feltöltést. Szakdolgozatok, fordítások, könyvek, használati útmutatók, diplomamunkák, kéziratok, életrajzok, önéletrajzok leírását. Interjúk, cikkek, háttéranyagok leírását diktálással is.


Feladva: 2018-01-12    [Vegyes hirdetések]

Címkék, kulcsszavak: leírásátkészítésétJegyzőkönyvGépelésthasználatihanganyagdiktálássalkönyvekgyorsírássalfordításokkonferenciárólháttéranyagokSzakdolgozatokközgyűlésről

Forrás: pepitahirdeto.multiapro.com

A Puli sétányon, Csepel kiemelt zöldövezetében, néhány lépésre a Katalin horgásztótól és az Akácfa utcai kiserdőtől egy pompás lakás eladó. A lakás felújított, 70 nm-es, 2+2 szobás, 1. emeleti, loggiás, csendes, világos, cirko fűtésű, jó beosztású, tiszta levegőjű. A lakáshoz egy pince is tartozik. A beépített konyhabútor és a háztartási gépek a vételár részét képezik. Ne az árat nézze, hanem a lakást! Hívjon még ma! Fotókat tudok még küldeni.


Feladva: 2017-07-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: PuliegylakásmégHívjonAkácfabeépítettAndrascsendeslakásthorgásztótóltartoziksétányloggiáshanemKatalinpinceemeletinézzelépésreszobásárat

Forrás: pepitahirdeto.multiapro.com

Ha nem tudjuk pontosan hol és hogyan jelenik meg a hirdetésünk, akkor valójában csak hisszük, hogy hirdetünk! A PEPITA HIRDETŐ is weboldal, éppen ugyan úgy látja a legtöbb internetes kereső, mint minden más weboldalt... Sajnálatos, de a legtöbb hirdetni szándékozó nem is tudja, hogy mit is kellene tennie hirdetése kereshetővé tételéhez, megtalálhatóságához. Vélhetően azért kívánnak hirdetni is, mert saját weboldalaikkal nem tudják a kívánt webforgalmat elérni! Prémium kiemelést kérő ... további részletek >>

hirdetőink számára ezt a problémát megoldjuk! Minden Pepita oldalunkon megtalálható Google keresőnkben a hirdetése mellett az összes weboldalrészletét is megjelenítjük önálló keresési találatként. További részleteket ezen az oldalunkon talál: www.pepitahirdeto.multiapro.com/apro.php?page_id=60547 Megjelenési, kereshetőségi garanciát kizárólag kért hirdetésekre és megbeszélés alapján vállalunk!


Feladva: 2015-12-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: PepitaHirdetőakikmegjelenéstbeállításukkalrendelkeznekKiemeltHatékonyabbSpeciálishirdetésseltulajdonosnakérdeklődőketaktívwebáruházmegfogadniirányítják

Forrás: pepitahirdeto.multiapro.com

Születésnap? Évforduló? Esküvő? Sütiben, tortában a Várfok Cuki a nyerő! Sütemények, torták, sós és édes finomságok, fagylaltok, jégkása, üdítő, tea és kávé különlegességek! Előrendelést telefonon is felveszünk!


Feladva: 2017-07-11    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: VárfokjégkásaSütibenfagylaltokEsküvőfinomságokÉvfordulóédesSzületésnapfelveszünksósBudapesttelefonontortákajánlóElőrendeléstSüteményekHirdetőkávé

Forrás: pepitahirdeto.multiapro.com

A fitt emberek webáruháza. Eredeti Body&Fit termékek Magyarországon. Étrend kiegészítő, sporttáplálkozási, diétás termékek. Fehérjék, aminosavak, protein szeletek, diétás édességek. Nézze meg weboldalunkat és adja le megrendelését.


Feladva: 2017-07-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: termékekFitBodydiétáshungaryproteinwebáruházabodyfitaminosavakemberekwwwFehérjékfittmegrendelésétBudapestadjasporttáplálkozásiweboldalunkatmeg

Forrás: pepitahirdeto.multiapro.com

Gordiusz zárvédő pajzs. Saját szabadalom. Amikor az interneten megvehető, majdnem minden zártípushoz a nyitó szerszám, ez a pajzs megbízhatóan véd minden nyitási módszer ellen. Külön zárszerkezet, az ajtó külső oldalára szerelve a zár kulcsnyílásának védelmére szolgál. Variációk száma 6000000. Nem kell pénzt költenie, drága betétekre, amiket utólag kívülről könnyű megrongálni. Házilag is felszerelhető, ha van korszerűtlen, vagy gyenge minőségű hevederzára, páncélajtója.


Feladva: 2015-10-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: pajzsGordiuszmindenzárvédőkellkülsőHázilagszerszámBudapestNemajtómegrongálninyitóPéter6000000zárszerkezetkönnyűzártípushozKnappszámaKülön

Forrás: pepitahirdeto.multiapro.com

Sírkő és sírkő kellék webáruház. Kizárólag hazai gyártású sírkövek az ország első webáruházában.


Feladva: 2017-07-14    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: sírkőwebáruházwebáruházábanHirdetőelsőPepitaországsírkövekgyártásúhazaiKizárólagkellékajánló

Forrás: pepitahirdeto.multiapro.com

Tavaszi selyemvirág csokrok közül válogasson a Zöldvilág Webáruházban! www.selyemviragok.hu/index.php?id= 2004


Feladva: 2018-01-13    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ZöldvilágcsokrokselyemvirágTavasziGyőrWebáruházNagykereskedésWebáruházbanválogassonközül

Forrás: pepitahirdeto.multiapro.com

Friss, folyamatosan megújuló állás ajánlatok! Magyarországi és külföldi munkalehetőségek pontos hely és feladat meghatározással.


Feladva: 2017-10-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: ÁllásokállásmegújulófolyamatosanmeghatározássalFrissfeladatajánláshelyHirdetőpontosPepitamunkalehetőségekkülföldönkülföldiMagyarországonMagyarországi

Forrás: pepitahirdeto.multiapro.com

Háromgenerációs, 266 m2 nettó alapterületű, 3 szintes, csodálatos panorámájú családi ház Solymár csendes, forgalommentes zsákutcájában eladó. 5 szoba + 34 m2-es nappali, 2 fürdőszoba + zuhanyozó + WC, 30 m2-es garázs, 2 erkély, 46 m2-es terasz + 1 külön bejáratú lakás (szoba, konyha, étkező, fürdőszoba, tároló). A telek 742 m2, termő gyümölcsfákkal. Irányár: 55 millió Ft


Feladva: 2015-09-28    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: fürdőszobaHáromgenerációsszobaSolymárházcsaládi411alapterületűeladó3138nettóétkezőzsákutcájában927266konyhaforgalommentesÉrdeklődnicsendesPéter

Forrás: pepitahirdeto.multiapro.com

Divatos női karkötők karperecek óriási árkedvezménnyel a Lili Ékszer webáruházban akár ingyenes házhoz szállítással. www.liliekszer.viltor.hu/tcslista/ karkotok


Feladva: 2018-01-11    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÉkszerLilikarkötőkházhozDivatosingyenesWEBÁRUHÁZakárAkcióswebáruházbanárkedvezménnyelóriásikarperecekszállítássalnői

Forrás: pepitahirdeto.multiapro.com

Dunai görgeteg kövek, úgy ahogyan a természet megalkotta őket és megmunkálva...


Feladva: 2015-11-24    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: görgetegDunaikövekBudapestViktormegmunkálvaőketmegalkottatermészetahogyanúgy

Forrás: pepitahirdeto.multiapro.com

Szerelmes akarsz lenni? Akkor tedd meg az első lépést! Új esélyek szingliknek! Teljesen ingyenes a társkereső oldal, ahol csak 10 másodperc a regisztrálás és bármi elképzelhető. INGYENES!!!


Feladva: 2016-01-04    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: INGYENEStárskeresőfelszedleklennioldalakarszSzerelmesTeljesenDianawwwszingliknekelképzelhetőesélyekbármilépéstregisztráláselsőmásodpercmegegy

Forrás: pepitahirdeto.multiapro.com

Solnhofeni német mészkő kiválóan alkalmas kültéri és beltéri burkolásra. Kültérben lábazatok, kerítések, támfalak. Beltérben falra kandalló mögé, konyhába, fürdőben aljzatra egyaránt alkalmas, fagyálló burkolókő. Kültérben kizárólag csak függőleges felületre ajánlott, csak zárt, illetve fedett terasznál! Ajánlott még a 6-7 mm-es vastagság. Nyitott terasz és járda burkolás esetén 8-12 mm-es vastagság az alkalmazandó. Az ár az Áfa-t nem tartalmazza. Országos házhoz szállítás ... további részletek >>

kedvezményesen. www.kocenter.hu


Feladva: 2017-03-30    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: németKültérbenSolnhoffeniajánlottalkalmasvastagságcsakmészkőnyitotttartalmazzatérben7mmburkolókőnemBelkövesfagyállóÁfatámfalakterasználfedet

Forrás: pepitahirdeto.multiapro.com

Víz, gáz és duguláselhárítás Budapest és környékén. Mi a Fűtésszerelő Mesternél úgy kívánjuk végezni tevékenységünket, hogy boldogan és büszkén tekinthessünk vissza elégedet ügyfeleink hosszú sorára. Több, mint 20 éve a szakmában vagyunk és már mindenféle meghibásodással találkoztunk ennyi idő alatt. Tudjuk honnan szerezzük be a legjobb alkatrészeket, tudjuk milyen típushibákkal találkozhatunk. Egy szóval: fel vagyunk készülve mindenre. Szakembereinktől ugyanezt várjuk el. Kizárólag magasan ... további részletek >>

képzett, sok éves tapasztalattal rendelkezdő munkatársakkal dolgozunk és felkutattuk a legjobb minőségű alkatrészeket, hogy a piacon elérhető legjobb minőségű szolgáltatást tudjuk biztosítani. Ennek köszönhetjük, hogy több tízezer elégedett ügyfelet tudhatunk ma magunk mögött. Ha elvégeztük a munkát, akkor bátran biztosítjuk a garanciát, mert tudjuk, hogy nem lehet semmi baja. Ha ön is szeretné biztonságba érezni magát nincs más dolga, mint tárcsázni a +36 (20) 238 57 20 telefonszámot és segítséget kérni. Akár azonnali kiszállással megoldjuk bármilyen meghibásodást is tapasztalt.


Feladva: 2017-07-23    [Lakossági szolgáltatás]

Címkék, kulcsszavak: hogytudjuklegjobbgázVízalkatrészekettöbbvagyunkBudapestmintminőségűduguláselhárításképzettbüszkénmegoldjuktudhatunkEgymáselérhetőmindenféle

Forrás: pepitahirdeto.multiapro.com

Az isiász gyógyítása általában teljes sikerrel jár, hiszen nem rosszindulatú betegségről van szó. Ez sokkal inkább egy tünetegyüttes, melyet az ülőideg összenyomódása okoz. Rendszeres testmozgással, a gerinc és a hátizmok ülés közben történő megtámasztásával, a helyes ülésmód elsajátításával megelőzhető a kialakulása és a kiújulása is. Az isiász lelki okai a túlterhelés érzésében gyökereznek. Ha valakin túl nagy a nyomás, a felelősség, túl sokat vállal magára pl anyagi gondok miatt, nagy ... további részletek >>

eséllyel alakul ki nála ez a probléma. Az idegbecsípődés és isiász kezelése történhet gyógyszerekkel és megfelelő tornával is.


Feladva: 2017-01-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: isiászidegbecsípődéstúlnagykezelésevállalsokkalkiújulásagyógyításagerincsokatszókialakulásaKittiproblématestmozgássalvanmegelőzhetőKellérnála

Forrás: pepitahirdeto.multiapro.com

Fashion Plus divatos női ruha webáruház, naponta bővülő divatos női ruha kínálattal, és akciókkal ajándékozza meg látogatóit. Napi Fashion Plus divat tippek a divatos női ruha webáruház kínálatát felsorakoztatva kiegészítőkkel és szép divatfotókkal, a legjobb divat tippeket nyújtja a divat és női ruhák szerelmeseinek. Női ruhák és alap darabok, pulóverek, pólók, divatos nadrágok, divatos szoknyák, kabátok és kiegészítők bő választéka!


Feladva: 2016-10-29    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: NőidivatosruhadivatPlusFashionruhákwebáruházdarabokkiegészítőkkelajándékozzaalapfelsorakoztatvaakciókkalkínálatátválasztékakínálattalkiegészítők

Forrás: pepitahirdeto.multiapro.com

A Piccolo Café Itália kávézóinak hangulatát hozza el Budapestre. Espresso alapú kávéinkhoz Caffé Danesit, egy méltán híres római kávé különlegességet használunk. Konyhánkat az egyszerűség, az egészséges táplálkozás és az olaszos ízek jellemzik. Paninit, szendvicseket szolgálunk fel kedves vendégeinknek, illetve igen népszerű nálunk az igazi olasz street food, az Emilia-Romagna tartományból származó Piadina (olasz lepénykenyér) is. Kávézónkban a hagyományos és paleo sütemények is kaphatók.


Feladva: 2016-01-02    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: olaszCaféPiccoloBudapestPaninithagyományosrómaiigazihangulatátjellemzikKávézónkbanhíresnálunkkávézóinakízeklepénykenyérméltánnépszerűItáliaegy

Forrás: pepitahirdeto.multiapro.com

Igényes megjelenésű klímás autók sofőrrel kérhetőek. Kiállás Budapesten díjtalan. Autóink rendelhetők már 6.000.-/óra díjtól. Számoljon velünk, részletekért klikkeljen a www.szepauto.5mp.eu oldalra.


Feladva: 2017-03-20    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: KiállásCsaládivelünkkérhetőekpartiSzámoljonsofőrrelCégesdíjtólautókRendezvényóraklímásAutó000megjelenésűoldalraEsküvőmárIgényes5mpRichárd

Forrás: pepitahirdeto.multiapro.com

Karcher HDS655 SX 220-as ipari gőzborotva vegyszeradagoló vizlágyító garanciával.


Feladva: 2017-10-29    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: Karchergőzborotvaipari220hds655zolt65506309126148hdsgaranciávalvizlágyítóvegyszeradagoló

Forrás: pepitahirdeto.multiapro.com

A GaBChat egy kifejezetten mobiltelefonra készített chat. Nem számítógépes chatből lett lekonvertálva, ezért nem tartalmaz semmilyen felesleges multimédiás elemet. Úgy lett megtervezve, hogy minimális adatforgalmat generáljon, sőt még adattakarékos felülettel is rendelkezik, így nálunk még 100 Mb-os internettel is túlzás nélkül napi több órát chatelhetsz. Sajnos egy oldal csak komprumisszumok árán lehet számítógép és mobiloptimalizált egyben. Szinte mindenhol ilyen komprumisszumok árán lehet ... további részletek >>

csak mobilról chatelni, ezért a GaBChat nélkülözi a számítógépes felületet. Nálunk nincs komprumisszum a telefonoddal! Ez nem azt jelenti, hogy számítógépről nem fog működni a chat, természetesen PC-ről is az összes szolgáltatás használható, viszont semmilyen fölösleges dizájn nincs benne, így a kinézete a végletekig egyszerű. Bár a felülete spórol az interneteden és a telefon memóriáján, de rengeteg beállítási lehetőség és szolgáltatás van a chaten, így mobilon nagyon kényelmes és egyszerű, természetesen gyors a használata. Lehetőség van a háttérszín a betűméret, a frissítési idő és a szoba hozzászólás szám beállítására, így úgy állíthatod be a chatet, hogy biztosan kényelmesen olvasható legyen a számodra. Várunk mindenkit szeretettel: www.gabchat.hu


Feladva: 2017-06-15    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: gabchatnemígyhogychatkomprumisszumokNálunkszámítógépesszolgáltatásvanezértúgynincsLehetőséglettmégcsaksemmilyenegytermészetesenlehetárán

Forrás: pepitahirdeto.multiapro.com

Figyelmedbe ajánlom, ha passzív jövedelem forrást keresel!


Feladva: 2017-10-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: firstcoinforrástjövedelempasszívajánlomFigyelmedbeCsabanhelyvalutájadigitáliswwwjövőhttpkeresel

Forrás: pepitahirdeto.multiapro.com

Építőipari kivitelezéseket vállalunk: - kőműves - ács - festő - vasbeton szerelő - kézi földmunka - kisgépes földmunka (minikotró, mini homlokrakodó) - nagygépes földmunka (JCB univerzális árokásó, homlokrakodó) munkákban. Munkákat főképpen Veszprém, Vas, Gy-M-S, Zala, Somogy, és Fejér megyékben vállalunk. Nagyobb volumen esetén a földrajzi távolság nem akadály!


Feladva: 2015-10-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: földmunkahomlokrakodóVeszprémkisgépesTeljesfőképpenkéziBorszörcsökMunkáinkatszerelőKftvasbetonMŰVEKárokásófestővállaljukBARANTAuniverzálisács

Forrás: pepitahirdeto.multiapro.com

CNC állásuk van Németországban! Szerződött német partnerünk (NEM Zeitfirma) részére Mannheim közelében keresünk CNC-st aki CNC Abkanter (élhajlítógép) gépen szakrajzról tud nagyon precízen dolgozni. A feladat a CNC élhajlítógép (Trumpf) beállítása és kezelése. A munkához legalább A2-B1 némettudás szükséges. Hosszú távú munkalehetőség! (A család pár hónap utáni kiköltözését a munkáltató segíti és támogatja.) Próbamunka ideje alatt a szállás ingyen van. Sikeres próbamunka után szerződés a ... további részletek >>

céggel, szállás megoldott, kb. 300€/hó. Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1.) E-mailben: info@nemetmunka.hu 2.) Ingyenes regisztrációval a következő linkre kattintva: http://www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3.) Telefonon munkaidőben a magyar 06 1 920 3433, ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9.00-17.00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs) www.nemetmunka.hu


Feladva: 2017-10-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: CNCnémetvagyszállásTeamMunkamailbenpróbamunkanemetmunkavanwwwélhajlítógépTelefononmegoldottdolgozni000támogatjarészéreújbólikövetkezőPersonal

Forrás: pepitahirdeto.multiapro.com

Elöfordul, hogy minden ok nélkül szorong, ideges, meggondolatlan, bizonytalan, félénk, rosszkedvü vagy szomorú? A Dianetika adja meg erre a magyarázatot!


Feladva: 2017-12-10    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: adjamindenDianetikahogyszomorúElöfordulvagyXIIIrosszkedvüBudapestfélénkMarcsibizonytalanajánlommeggondolatlanszivvelmagyarázatotidegeserremeg

Forrás: pepitahirdeto.multiapro.com

Cégünk a szakszerű takarítási szolgáltatásra alakult, mind vállalatoknak mind magánszemélyek számára. Tevékenységi körünkbe tartozik a lakás-, ház-, épület, lépcsőház és irodatakarítás, amelyet napi, heti, havi rendszerességgel végzünk, vagy egyszeri alkalommal, -igény szerint. Cégünk építkezés vagy felújítás utáni nagytakarítást is vállal. Vállaljuk extrém takarítási helyszíneken a munkavégzést, pl. Elhagyott ipari területek, Erőművek, koncertek utáni nagytakarítás. Kiégett lakások, ... további részletek >>

épületek takarítása, és bármely extrém szennyeződés eltávolítása profilunkba tartozik. Igényelje szakszerű Ipari Alpinista munkáinkat: Homlokzat takarítás, Ablak pucolás, Fakivágás. Profilunkba tartozik továbbá, kertek rendezése, kertek fenntartása, sziklakertek, csobogók építése. Ingyenes felmérést vállalunk a helyszínen, valamint tanácsadással szolgálunk takarítási technikákkal kapcsolatban.


Feladva: 2016-09-11    [Lakossági szolgáltatás]

Címkék, kulcsszavak: takarításitartozikCompanytakarításCleanerskertekIpariszakszerűutánivagymindProfilunkbaCégünkextrémépületkapcsolatbanbármelymunkavégzéstcsobogók

Forrás: pepitahirdeto.multiapro.com

Szeretne könnyedén bevételre szert tenni Facebook oldala, vagy weboldala segítségével? ITT A MEGOLDÁS!!! Legyen üzleti partnerünk! Ne hagyja ki! www.multiapro.com/online-penzkeres et.php?ref=PA211


Feladva: 2016-09-30    [Pénzkeresés - MLM]

Címkék, kulcsszavak: partnerünküzletiLegyenkönnyedénFacebookpénztnagyjatenniKeressenszertbevételrePA211refMEGOLDÁSSzeretnephpITTOrszágosanpenzkeresetsegítségével

Forrás: pepitahirdeto.multiapro.com

Asztalos munkát, egyedi bútorok készítést, ajtó-ablakszigetelést, ablakfelújítást, mázolást, üvegezést, zár javítást vállalunk Pest megyében! Munkáink: - galériaépítés, beltéri tolóajtó készítés - gardrób szekrény gyártás, beépítés - lambériázás - szalagparkettázás - laminált burkolatok - zár javítás - egyedi bútorok készítése (konyha-, szoba-, irodabútorok) - nyílászárók gyártása, cseréje, mázolása, javítása és hőszigetelt üveg berakása - ajtó-, ablakszigetelés (hő-, por-, hang ... további részletek >>

ellen) A szigetelés svéd bemarásos technológiával, szilikon gumi felhasználásával történik. Előnyei: huzatmentesség, hőmérséklet emelkedés, porzárás. Bejárati beltéri-, kültéri ajtók javítása passzítása, pótlását, festése, záraik cseréje. Foglalkozunk műanyag ablakok (hagyományos nyíló-bukó és amerikai toló- és emelőpaneles), bejárati ajtók és erkélyajtók, beépítésével, cseréjével. Az ablakcsere utáni helyreállítást is vállaljuk, így Önnek nem kell külön kőműves szakembert megbíznia a régi ablakok bontása során - a falon - keletkezett sérülések javítása miatt. Rövid határidő, ingyenes kiszállás.


Feladva: 2017-02-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: javításaegyedibeltérizárablakokAsztalosajtókcseréjebejáratiajtóbútorokgumigardróbsoránhelyreállítástberakásaablakfelújítástbukóígyszilikonnem

Forrás: pepitahirdeto.multiapro.com

Első mini gurtni csere ára 6000 Ft, a többi 3000 Ft/db. Első maxi gurtni csere ára 7000 Ft, a többi 4000 Ft/db áron tudjuk vállalni. Pest megye egész területén ingyenes kiszállással. Munkáinkra garanciát vállalunk! A szolgáltatás megrendeléséhez hívja a 061 445 11 81 telefonszámot. Adja meg ügyfélszolgálatunknak nevét, címét, elérhetőségét és egyeztessen egy időpontot, amikor szakembereink kicserélhetik a gurtnit. Telefonszám: 061 445 11 81 Email: ajanlatkeres@redony-szereles.org ... további részletek >>


Feladva: 2017-01-05    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megcsereszerelesgurtniElső445061többiáraorgredonyidőpontotmegrendeléséhezWebvállalniegy3000Ftszolgáltatásajanlatkeres@redonytudjukegyeztesen

Forrás: pepitahirdeto.multiapro.com

ÜZLET AHOL SENKI NEM VESZÍTHET! SunMoney az első világot behálózó KÖZÖSSÉGI NAPERŐMŰ PROGRAM - Az üzletet építheted online is - Itt nincs havi kötelező befizetés - Itt nem terméket kell venni, hanem egy termelő eszközt vásárolunk


Feladva: 2016-09-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemIttsunmoneywebofficeSENKIegyonlinehttpsAHOLhanemépíthetedRegisztrációÜZLETvenniüzletetcomTiborkellPROGRAMsunmoneyonlineNaperőművedbotibi

Forrás: pepitahirdeto.multiapro.com

Daruzással kapcsolatos munkák végzése. Gép, konténer, építőanyag szállítása, daruzása! Kis helyekre 1 tonnás mini darus autónk van!


Feladva: 2017-01-02    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: darusmunkákminikapcsolatostonnásDaruzássalhelyekreDebrecenKisIstvándaruzásaTóthszállításaKCRépítőanyagDaruzáskonténervanGépautónkvégzése

Forrás: pepitahirdeto.multiapro.com

150% nyereség 10 napon belül. Hogyan működik? Regisztrálj most és kapj 100 $ bónuszt azonnal. Az ajánlat csak az újonnan regisztrált tagok számára érhető el.


Feladva: 2017-11-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: ajánlatHogyanújonnanbelülcsaknaponnyereségazonnal150bónusztElvira100KedvezőkapjérhetőmostszámáraRegisztráljtagokműködikregisztrált

Forrás: pepitahirdeto.multiapro.com

Érettségizzen Ebesen, a Báthori István Gimnáziumban! Kiváló tanári kar, diákigazolvány, családi pótlék, minimális díj, előzetes tanulmányok beszámítása, ingyenes tankönyvek, jó közlekedés! Indult Vámospércsen is, ne hagyja ki!


Feladva: 2016-11-12    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: IstvánBáthoriminimálisÉrettségizzenhagyjapótlékEbesVámospércsencsaládiGimnáziumIndultdiákigazolványfelnőtteknekközlekedéskarÉrettségitankönyvekdíj

Forrás: pepitahirdeto.multiapro.com

Tessék már belegondolni! Mi szüksége van a Google-nak egy MLM cégre? Ha pedig mégis lenne, pont olyan emberekre bízná a toborzást, akik nem, vagy alig értenek valamit az internetes megjelenéshez? Értem én hogy nagy a szükség és meg kell ragadni - főként - a kínálkozó online lehetőségeket! De... 1. Rendkívül etikátlan valamit álláshirdetésként hirdetni, ami nem az! 2. Az MLM (Multi Level Marketing) értékesítési szisztéma jó dolog. Pont ilyen megtévesztésekkel kell elijeszteni tőle jó ... további részletek >>

sok mindenkit, hiszen sokakban úgy csapódik le, mintha az összes MLM erről szólna. 3. Legyen már legalább annyi igénye végre az internet használóknak, hogy bármi, amit olvasnak a neten, annak utána néznek előbb a jellemző szavakat keresve! A XXI. századi ember attól lesz valaki, ha tudja és akarja használni az eszközeit! www.pepitahirdeto.multiapro.com/apro.php?page_id=60546


Feladva: 2016-11-01    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: MLMPontvalamitmárGooglehogynemkellbíznájellemzőmegtévesztésekkelszükségeinternethirdetniakarjaminthaszükségemberekreelőbbilyenbelegondolni

Forrás: pepitahirdeto.multiapro.com

Építőioarban jártas embereket keresek. Segédmunkást, festőt, burkolót. Csapatok, brigádok ne jelentkezzenek! Csak egy-egy embert keresek mindegyik szakmában! Heti fizetéssel. Azonnali munka. Teljes munkaidőben. További részletekért hívja : Tel :06203535081 vagy 06209674893


Feladva: 2017-08-21    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresekburkolótfestőtSegédmunkástegyCsakBernátTeljesjelentkezzenekKissmunkabrigádokAzonnaliCsapatok06209674893fizetésselvagyHeti06203535081Tel

Forrás: pepitahirdeto.multiapro.com

Kompresszor, vákuumszivattyú, javítás, felújítás, szerviz, sűrítőegység, mechanika, pneumatika, vezérlés, szabályozás, hajtás motor, elektromosság ... MINDEN EGY HELYEN! 06-30-243-4771 Márkafüggetlenül, minden típus javítása.


Feladva: 2016-10-19    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: javításmindenKompresszorfelújításEGYMárkafüggetlenülelektromosságvákuumszivattyú4771motor243hajtáskerhtmszabályozásXVIItartalomjavitasvezérlésRak

Forrás: pepitahirdeto.multiapro.com

Autómentés a nap 24 órájában az év minden napján belföldön minden gépjármű-kategóriában. • Rendelkezésre állás: 0-24 óráig! • Autómentő kiállási ideje Budapesten: 30-40 perc • Autómentő kiállási ideje vidékre/külföldre: azonnali indulással, a lehető legrövidebb időn belül!


Feladva: 2016-01-23    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 8226Autómentés6499188TelIstvánMészárosmindenidejekiállásiAutómentőnapbelülidőnpercDunakeszilegrövidebbBudapestenautószállításlehetőóráigNon

Forrás: pepitahirdeto.multiapro.com

Elhunyt szerettei fotóját megörökítő porcelánképek rendelhetők. Fénykép alapján porcelánfestékkel készülnek, 800 °C felett beégetve, kopásálló felülettel és fotó minőségben. Plakettek nagy forma és méretválasztékban! Mindenszentekre felújíthatja a síremléket egy egyedi porcelánképpel. www.dekormania.hu vagy www.sirkokep.hu


Feladva: 2016-08-29    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: wwwfotójátsíremléketbeégetveszeretteifelújíthatjafelettElhunytMindenszentekre800kerméretválasztékbankészülneksirkokepXIVformaporcelánfestékkelnagy

Forrás: pepitahirdeto.multiapro.com

Parkolási megoldás, Parkolóházi parkolás, az Erzsébet krt, József krt, Rákóczi út találkozásánál, a Blahánál, az Akácfa utcában 1072. Budapest, Akácfa utca 12-14 EZ Akácfa Parkolóházban Parkolásért már nem érdemes aggódni. Alkalmi óradíjas parkolás 220 Ft/ fél óránként, Napidíjas Parkolás kedvezményesen, 24 órára elővételben. Parkolóházi havi bérletek 15 960 Ft-tól www.ezpark.hu/parkolohazak/akacfa- parkolo


Feladva: 2017-01-08    [Lakossági szolgáltatás]

Címkék, kulcsszavak: AkácfaParkoláskrtBudapestParkolóházParkolóházióráranemRákóczikedvezményesenmárParkolásértJózsefNapidíjasParkolóházbanErzsébetóránkénttólmegoldás

Forrás: pepitahirdeto.multiapro.com

Német piacra gyártott I. osztályú, prémium minőségű franciaágy, az ottani Deutsch Qualität elvének megfelelő minőségben, akár felső közép-kategóriás aloe vera-s extra szivacsos, rugós és memory-réteges NASA matracokkal, különböző színnel és mérettel(160/180) P1-es minőségű anyagokból a forgalmi értékük 50%-áért. Ágykeret ácsráccsal már 119.000 Ft-ért. Az ár az ágy méretének, funkciójának és anyagának függvényében változik. www.franciaagy.net/franciaagyak/florida-franciaagy Aktuális és ... további részletek >>

tényleges árukészletünkről érdeklődjön személyesen vagy telefonon üzletünkben, ahol állunk szíves rendelkezésére. Jelen hirdetés nem minősül ajánlatnak, a változtatás jogát a hirdető fenntartja.


Feladva: 2017-04-13    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: minőségűfranciaagyfloridahirdetőfranciaágyszínneltelefononkategóriáswwwácsráccsalprémiumajánlatnakkülönbözővagyváltozikközépÁgykeretosztályúfelső

Forrás: pepitahirdeto.multiapro.com

Magyarországon a TOTEL a legjobban felszerelt és legfelkészültebb szervizek közé tartozik. Tektronix, Rhode-Schwarz, Brül-Kjaer Clio Audiomatica és hasonló precíziós műszereket és tesztkészülékeket alkalmazunk. Rendelkezünk A-BEX, Denon, Nakamichi és Sony tesztanyagokkal, süketszobai hangnyomásmérővel és számítógépes spektrum-analizátorral is. Az elvégzett munka minőségére magasan kvalifikált mérnök-szakember gárdánk a garancia. Több tízezer (!) audiofil minőségű készülék megjavításával a TOTEL ... további részletek >>

vitathatatlanul a legtöbb tapasztalattal és legjobb referenciákkal rendelkező hifi és high end szakszerviz az országban. Márkaszervizünk magas színvonalon látja el az alábbi márkák GARANCIÁLIS javítását A javítás feltételeiről honlapunkon tájékozódhat. DENON, TIVOLI, ONKYO, TEAC, WHARFEDALE, GROUND ZERO, MARANTZ, MISSION, NAD, MORDAUNT-SHORT, KEF, POLK AUDIO, ALPINE, AUDIOLAB, DALI, MYRYAD, ACOUSTIC, ENERGY, CAMBRIDGE, PROJECT, PRIMARE, HEGEL, CANTON, MUSIC HALL, FATMAN, ROTH, SONOS, Q ACOUSTICS, TANGENT, ELTAX, EXPOSURE


Feladva: 2016-10-05    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: TOTELDENONhifiHEGELalábbianalizátorralPOLKreferenciákkaltesztkészülékeketEXPOSUREONKYOTöbbtartozikPRIMARElátjaspektrumKEFlegjobbműszereketELTAX

Forrás: pepitahirdeto.multiapro.com

A mosott kavics 16-32 ára bruttó 4200 Ft/m3. A folyami kavics 16-32 ára bruttó 4200 Ft/m3. A dunai kavics 16-32 ára bruttó 4200 Ft/m3. A dísz kavics ára bruttó 5842 Ft/m3. A gyöngy kavics ára bruttó 5842 Ft/m3. Az osztályozott kavics ára bruttó 5842 Ft/m3. A rostált kavics ára bruttó 5842 Ft/m3. A bánya kavics ára bruttó 3500 Ft/m3. A töltő kavics ára bruttó 3000 Ft/m3. A mosott dunai folyami kavics 24-40 kerti utak, parkok lefedésére, a rostált osztályozott dísz kavics 16-32 ... további részletek >>

lábazatok díszítéséhez, szikkasztóhoz, a gyöngy kavics 4-8 és a gyöngy kavics 8-16 parkok, játszóterek lefedésére, a bánya és a töltő kavics terület feltöltésre, szerelő beton alá használható. A mosott kavics, osztályozott kavics, dísz kavics, gyöngy kavics, kulé kavics, rostált kavics, töltő kavics kapcsán felmerülő kérdéseikre szívesen válaszolunk, e-mail címünk és telefonszámaink honlapunkon megtalálhatóak.


Feladva: 2016-10-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kavicsbruttóáragyöngydíszosztályozottmosott5842rostált4200töltőfolyamidunaikulébányalefedéséreparkokfeltöltésrehonlapunkonszállításterület

Forrás: pepitahirdeto.multiapro.com

AcPumPa azonnali országos kiszállítással, Budapesten 1-2 órán belül, vidéken 24 órán belül átvehető. AC pumpa tankon belül, AC pumpa tankon kívül, elektromos üzemanyag szivattyú 5200 autóhoz, és munkagéphez, raktárról non-stop működő webshopunkból. Telefonos érdeklődés napközben 8-18 óra között. „Velünk biztosan újra indul”


Feladva: 2015-05-04    [Autó - Motor - Jármű]

Címkék, kulcsszavak: acpumpabelülAzonnaltankonóránüzemanyagszívattyúbiztosanOrszágosacpumpawebshopelektromosVelünkwwwkívül8222kerwebshopunkbólközöttXVIIImüködő18h

Forrás: pepitahirdeto.multiapro.com

Olyan kereskedelmi szakmát akarsz tanulni, amivel könnyedén indíthatsz egy saját vállalkozást? Szeretnél online reklámozással is foglalkozni és szívesen tanulnál a különféle marketing eszközökről? Eladó szakképesítéssel rendelkezel és szeretnéd fejleszteni a tudásodat? Jelentkezz Budapesten induló Boltvezető OKJ-s tanfolyamunkra! A tanfolyam árát részletekben is fizetheted. A Boltvezető tanfolyam rövid időtartalommal fut, így néhány hónap alatt már a kezedben lehet az OKJ-s bizonyítvány. A ... további részletek >>

tanfolyamhoz szükséges szakmai előképzettség: 34 341 01 Eladó szakképesítés. Ha bármi kérdésed lenne vagy érdeklődni szeretnél, kattints a weboldalunkra és töltsd ki az egyik űrlapot: www.tanfolyamokj.hu/boltvezeto-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: tanfolyamokjboltvezetobudapestentanfolyamokjEladószeretnéllehetindíthatszrészletekbenmarketingkérdésedkezedbenkönnyedénáráthttpsbármikülönfélemár

Forrás: pepitahirdeto.multiapro.com

Hiába panaszkodsz nekem, hogy itt fáj-ott fáj, fáradt vagy... Sajnos interneten keresztül nem tudlak megmasszírozni! EL KELL JÖNNÖD! www.egeszseg-megorzes.com/masszazs


Feladva: 2017-04-20    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fájszenvedjJÖNNÖDottKELLittmegmasszíroznihogytudlaknekemnempanaszkodszkeresztülHiábainternetenBudapestsajnosTímeavagytovábbfáradt

Forrás: pepitahirdeto.multiapro.com

Eladó gondola és végzáró. Gondola: 32.000.-/fm (nettó) oldalanként 4 sor polccal Végzáró: 23.000.-/fm (nettó) 4 sor polccal Könnyen szerelhető, tisztítható. További információ: www.polcozzunk.eu


Feladva: 2016-10-10    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: VégzáróGondola000polcozzunkpolccalsornettówwwoldalankéntinformációTovábbiEladótisztíthatóSzigetszentmiklósszerelhetőpolcrendszerKönnyenfém

Forrás: pepitahirdeto.multiapro.com

A FÉRFI DIVATNAK NINCS TÖBBÉ TITKA A SPARTOO ELŐTT! 2006-ban elindulva, a Spartoo először is cipőkre specializálódott. Az éves alatt kiszélesítettük kínálatunkat, számos divatos táskával valamint egy szuper elegáns ruhakollekcióval Mottónk: a divat. Ennek köszönhető, hogy jelenleg széles választékban megtalálhatja férfiaknak kínált modelljeinket, melyek természetesen a 100% divatot képviselik! NÉZZE MEG ONLINE FÉRFIAK SZÁMÁRA KÍNÁLT SZÉLES CIPŐ-, TÁSKA- ÉS RUHAVÁLASZTÉKUNKAT! ... további részletek >>

Bármilyen legyen is a stílusa: rocker, laza vagy inkább divatos, a SPARTOO.HU-n biztosan megtalálja az Önnek tetsző darabot. Férficipő kínálatunkban több száz tornacipőt, bakancsot, sportcipőt, városi- vagy deszkás cipőt ajánlunk figyelmébe. Továbbá rendelkezésére bocsájtunk egy teljes kollekciót férfiruházatból (farmerek, nadrágok, pulóverek, ingek...). valamint a legutóbbi divattrendeknek megfelelő táskákat is. TALÁLJA MEG HONLAPUNKON A LEGJOBB MÁRKÁKAT! Nike, Converse, Pataugas, Birkenstock, Vans... A Spartoo a legjobb márkákat sorakoztatja fel férfidivat világából. Nézze át újdonságok rovatunkat és felfedezze a divat legújabb trendjeit, melyekre mindenki ráharap. Ne felejtse el átnézni tippjeinket sem, ahol találhat cipőket olcsón, melyek a 100%-os divatot képviselik. www.spartoo.hu/ferfi.php


Feladva: 2017-07-15    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: spartoo100férfidivatdivatotMEGvagymelyekmárkákategySZÉLESlegjobbdivatosdivatKÍNÁLTvalamintNézzeképviselikvilágábólcipőtmodelljeinketTÁSKÁK

Forrás: pepitahirdeto.multiapro.com

Label automata ajtó, tolóajtók, nyílóajtó automatikák, kapu automatikák, üvegvasalatok, mobil üvegfalak A LABEL automata ajtókban és nyílóajtó automatikákban a LABEL spa. cég évtizedek óta felhalmozódó technikai fejlesztésének eredménye mutatkozik meg. Az olasz design és a német precizitás ötvöződik a meghajtásokban. Típusválasztékunk lehetővé teszi, hogy minden helyre a leghatékonyabb megoldást ajánljuk. Az új szabályozások, az akadálymentesítés szükségessége, a jobb ... további részletek >>

megközelíthetoség következtében a nagyobb forgalmú, vagy egyéb hivatali helyiségek bejáratát célszerű automatizálni. Ezekre a feladatokra kínálunk költségtakarékos, energiahatékony megoldásokat. Igény szerint partnereinkkel együtt, akár a teljes akadálymentesítési feladatot megoldjuk a meghajtásokban. Cégünk munkatársai díjmentes szaktanácsadással segítenek a legoptimálisabb megoldás kialakításában.


Feladva: 2016-08-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: LABELautomataautomatikákmeghajtásokbannyílóajtóüvegfalakmobilszerintötvöződikhelyiségekótamunkatársaiszabályozásoküvegvasalatokIgényprecizitásCégünk

Forrás: pepitahirdeto.multiapro.com

Quartz Wrist Watch női karóra, fém szíjjal, 2999 ,- Ft Ezüst színű, téglalap, fém óraházzal, 4 db kristállyal, fekete számlappal, elegáns divatos kivitelben. Rozsdamentes acél, fém szíjjal. Quartz szerkezettel, elemmel. Rose gold színű pontjelzéssel és mutatókkal. Méretek : Téglalap számlap 40 x 28 mm, teljes hossz 22.5 cm Érd: 001 6ado@gmail.com Tel.: 70/209-4260


Feladva: 2017-11-01    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: fémszíjjalQuartzTéglalap2999comkaróra0016ado@gmailnőiÉrdWatchszínűWristEzüstMéretekacélmutatókkalRozsdamentespontjelzésselkivitelben4260209

Forrás: pepitahirdeto.multiapro.com

Teleszkópos, Légkeveréses Normál szélesség: 60 cm Főzőzónák 4 Anyag kerámiaműködési elem Touch Control Maradékhő kijelzés Tervezési keret nélküli, süllyesztett Fogyasztás 7000 watt... www.muszakiguru.hu/shop/index.php?center=uj_termek&term_id=6307 Üzletünkben outlet áron kaphatók szépséghibás új és felújított használt műszaki cikkek, háztartási kis- és nagygépek. Cím: 1134 Budapest Lehel utca 14 (Lehel - Dózsa György saroktól 50 m a Lehel piac felé) Nyitva tartás: ... további részletek >>

Hétfőtől - péntekig 10 órától 19 óráig Szombaton is nyitva, 10 órától 16 óráig Tekintse meg teljes árukészletünket honlapunkon! www.muszakiguru.hu Termékeinkre 1 év garanciát adunk. További információk: Telefonszám: +36 30 591-7000 E-mail: muszakiguru@muszakiguru.hu


Feladva: 2017-04-13    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: LehelóráigórátólnyitvaBudapestmuszakiguruwww70006307teljeskeretpiacháztartásiNormálTelefonszámtermmegTervezésicikkekLégkeverésesinformációk

Forrás: pepitahirdeto.multiapro.com

ALOE VERA BABAÁPOLÁS! A szett tartalma: - Aloe Vera baba arc és testápoló érzékeny bőrre - 100 ml - Aloe Vera habfürdő és sampon érzékeny bőrre - 250 ml - Aloe Vera baba krém érzékeny bőrre - 100 ml A három termék együtt: 7990 Ft A babák és a gyerekek gyengéd bőre nagyon érzékeny, hiszen még fejlődik! Ahhoz, hogy megfelelően védjük, fontos az alapos ápolás. A termékcsalád ápoló termékei 40%, a tisztító termékei pedig 30% aloe verát tartalmaznak. Kíméletesen ápolják az érzékeny ... további részletek >>

bőrt. A bio calendula kivonat regenerálja és védi a bőrt. A bőrbarát termékek nem tartalmaznak parabént és ásványi olajokat. Védik a bőrt a kiszáradással szemben, hiszen elegendő nedvességgel látják el. A mamák teljes körű ápolására is gondolva: a termékcsalád egy masszázs balzsamot is tartalmaz, melyet az anyukák terhességtől megviselt bőrére lett kifejlesztetve. A balzsam ideálisan ápol és támogatja a bőr rugalmasságát. A babák bőrén is használható!


Feladva: 2017-11-22    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: aloeveraérzékenybabacalendulaBABAÁPOLÁStermékcsaládbőrrebőrtbabáktartalmaznakmelyetbőrmártermékeihiszen100ápolókrémelterjedtfejlesztettünk

Forrás: pepitahirdeto.multiapro.com

Szakkísérői vizsga túlméretes szállítmányokhoz! 138.000 Ft/fő teljes áron, részletfizetési lehetőséggel! Jelentkezési feltételek: ”C” kategóriára érvényes vezetői engedély valamint legalább 5 év gépjármű vezetési gyakorlat, bármely nemzetközi kategóriában. Várjuk jelentkezését! Tel: 0620-248-4700; 0620-248-68-18; www.fuvinfoiroda.hu/tanfolyamok/eg yeb-kepzesek/szakkiseroi-tulmeretes -szallitmanyokhoz


Feladva: 2017-04-03    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: május8221túlméretesvizsgaJelentkezésiSzakkísérői2480000620jelentkezésétextranemzetköziVárjukmostbármelyfeltételekhétfőszállítmányokhozgyakorlat

Forrás: pepitahirdeto.multiapro.com

Ha ön egy sok éven át használható és kényelmes garnitúrát szeretne prémium minőségben, jó helyen keresi! Egy szék ára 8000 Ft. Bármennyi készíthető és az asztal mérete és formája is változhat igény szerint, ha egy más garnitúrát szeretne. Új állapotban 2 év garanciát adok rá. Könnyen szállítható, mert egyszerűen szétszerelhető. A garnitúra ára lecsiszolt állapotban, festésre készen értendő, mindenki igényei szerint festheti akár, de megegyezés szerint le is festhetem. Kiszállítás is ... további részletek >>

megoldható.


Feladva: 2017-07-16    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: szerintegyállapotbanszeretnegarnitúrátáragarnitúramegoldhatókészíthetőfestésresokgaranciátKiszállításBármennyiprolignumfesthetem8000lecsiszoltmás

Forrás: pepitahirdeto.multiapro.com

Minden típusú hőlégfúvó, bármilyen gyártmányú hőlégfúvó és mindenfajta fűtőanyagú hőlégfúvó javítása. Olcsó hőlégfúvót keres? www.olcso.holegfuvok.com


Feladva: 2015-05-06    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: hőlégfúvómindenfajtacomgyártmányúholegfuvokbármilyenolcsotípusúwwwMindenkeresHalásztelekhőlégfúvótszervizOlcsójavításafűtőanyagú

Forrás: pepitahirdeto.multiapro.com

Kiváló ipari minőségű forrasztottlapkás és váltólapkás / cserelapkás kontraprofil, keretösszeépítő szerszám HSS gyorsacél és HM vídiás kivitelben. A szerszámba különböző profilú lapkák is befoghatóak, így különféle mintázatú bútorajtó keretet készíthetünk. Szállítás másnap!


Feladva: 2017-11-27    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: woodmasterwwwvídiásKiválóbútorajtógyorsacélVeszprémmintázatúHSSkülönféleszerszámígykeretösszeépítőbefoghatóakkontraprofillapkákcserelapkásprofilú

Forrás: pepitahirdeto.multiapro.com

Az aki 40 évesen 123 kg-ot nyomott a mérlegen, így számos gyógyíthatatlan egészségügyi probléma küszöbén állt, most elárulja hogy mi indította be nála a fogyást.


Feladva: 2017-09-17    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: httpgyógyíthatatlanegyfogyástszámosátólnálaígytesttömegemindítottamérlegenmeghogynyomottszabadultamelárulja123Hogyanmostévesenálltakibit

Forrás: pepitahirdeto.multiapro.com

A fogszabályozás kiváló lehetőséget jelent Önnek fogai megszépítésére. Jöjjön el rendelőnkbe és ismerje meg a személyre szabott lehetőségeit egy térítésmentes konzultáció keretében. A konzultációra a +36 30 853 1903 -as számon tud jelentkezni.


Feladva: 2017-02-24    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogszabályozásfogszabalyozascentrumegylehetőségethttplehetőségeitkiválójelentkezniszemélyreszabotttudmegBudapestszámonismerjeBudán1903rendelőnkbe

Forrás: pepitahirdeto.multiapro.com

Mezőgazdasági szaküzleteknek, iparcikk boltoknak, virágüzleteknek és még sok hasonló kiskereskedőnek ajánljuk közel 5.000 termékünket. Saját gyártmányaink is vannak, mint pl. a képen látható temetői szett. Látogasson el raktárunkba Halásztelekre, ahol minden termékünket megtekintheti, kipróbálhatja. Támogassa a magyar gyártókat és gyártmányokat!


Feladva: 2016-10-08    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: termékünketboltoknakiparcikk000MezőgazdaságiraktárunkbaközelgyártmányokatHalásztelekLátogassonajánljukgyártókatgeogallszettkiskereskedőnekmagyarsok

Forrás: pepitahirdeto.multiapro.com

Minőségi Ablakcsere akció ELŐLEG NÉLKÜL is! Műanyag nyílászárók 6-7 és 8 légkamrás kivitelben kiváló gyári minőségű alapanyagból, garanciával! Ezen túlmenően kínálunk még szintén gyári minőségben redőnyt, rovarhálót és reluxát is bontással-beszereléssel és az esetleges javítási munkálatokkal együtt.


Feladva: 2016-09-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: gyárinyílászárókNÉLKÜLELŐLEGminőségűBudaörsredőnytkiválóZoltánminőségbenkivitelbenMártonlégkamrásegyüttáronszinténmunkálatokkalkedvezőmégEzen

Forrás: pepitahirdeto.multiapro.com

Egyedi női felkar ékszer a Lili Ékszer webáruházban. www.liliekszer.viltor.hu/termeklap /karkotok/fem-karkotok/felkar-eksze r-level


Feladva: 2018-01-19    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÉkszerLilifelkarwebáruházbannőiEgyediWEBÁRUHÁZ

Forrás: pepitahirdeto.multiapro.com

Pályázatírás másképpen Biztosan sok helyen olvashatja, hogy ingyenes pályázatírás, ingyenes tanácsadás stb. …. de elege van, hogy a végén MINDIG MINDENT ÖNNEK KELL KITALÁLNIA???? Ráadásul a számla kiállítása után a lehető leghamarabb el is feledkeznek Önről? Ha szeretné, hogy…. - 15 perc „ingyenes tanácsadás” helyett tényleg EGYÜTT GONDOLKOZZANAK ÖNNEL - egyetlen gépbeszerzés helyett KOMPLETTEN, egyben vizsgálnák cégének valódi szükségeit - valóban ... további részletek >>

TEHERMENTESÍTSÉK az összes pályázatírással kapcsolatos papírmunkától - VÉGIGKÍSÉRJÉK az egész pályázati folyamatot az előlegtől a záró-ellenőrzésig - KAPCSOLATI TŐKÉT is kapjon pályázatához, ne csak egy számlát a pályázat megnyerésekor Akkor kérjen időpontot a +36 30 928 3621 telefonszámon (vagy montaltechkft@gmail.com e-mail-en) Zakor Beátától és várjuk Önt budaörsi irodánkban.


Feladva: 2016-09-29    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ingyeneshogytanácsadáshelyettpályázatírás8230zárószeretnéZakorvalóbanÖNNEKmegnyerésekorGONDOLKOZZANAKBiztosanelőlegtőlÖnrőlmailszükségeitMINDENT

Forrás: pepitahirdeto.multiapro.com

Comac Hungary - Comac Márkakereskedés Nem akar sok pénzt egyszerre elkölteni? Nem akarja, hogy a cége likvid tőkéje csökkenjen? Akkor érdemes hosszútávra, azonos havi költséggel járó fix összegű bérlésben gondolkodni! Nincsenek szervíz költségek, nincsenek rejtett költségek, nincsenek apró betűs részek! Bővebben honlapunkon olvashat erről!


Feladva: 2017-09-18    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: nincsenekComacNemköltségeklikvidBővebbenfixcégeHungaryrészekjáróhogyajánlóbetűsköltséggelakarjaHirdetőapróhaviPepitaazonoselkölteniáron

Forrás: pepitahirdeto.multiapro.com

Minőségi instant kávé, Ganoderma lucidum kivonat és az erdei mogyoró ínycsiklandó ízvilága keveredik ebben az ellenállhatatlanul finom italban. E kombinációnak köszönhetően a kávé íze krémes, intenzív, kellemes aromájú. Ez a GanoCafé Hazelnut Coffee.


Feladva: 2016-08-29    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: kávékivonatGanodermáskombinációnaklucidumCoffeeitalbanGanodermaHazelnutfinominstantGanoCaféellenállhatatlanulMinőségiaromájúebbenBudapestkellemes

Forrás: pepitahirdeto.multiapro.com

Eladó szamurájkard, katana, wakizashi, tanto! Minőségi acél, választható markolat és sok minden más... Aktuális árukészlet és akciók a honlapunkon!


Feladva: 2017-04-28    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szamurájkardEladóKardokSzamurájtantowakizashikatana

Forrás: pepitahirdeto.multiapro.com

Elérhető árú olcsó mobilok a TechButikban! Mobiltelefonok azoknak, akik az értéket és nem a márkát keresik. Meizu m3 ár, már 51980Ft-tól. Xiaomi redmi ár, már 59890Ft-tól. Lenovo Vibe ár már 23790Ft-tól. Asus Zenfone ár már 40290Ft-tól. Vernee ár, már 43190Ft-tól. LeTv ár, már 50690Ft-tól. Keresd kínálatunkat honlapunkon a TtechBbutik-ban!


Feladva: 2017-12-18    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: tólmárKeresdMindenVibeakikLenovoazoknak50690Ft59890FtMobiltelefonokredmiTechButikbanLeTvXiaomimobilok43190Ft51980FtolcsóVerneeMeizubanárú

Forrás: pepitahirdeto.multiapro.com

Túl lassú, vagy költséges szállítási megoldást javasoltak mások? Kérje ajánlatunkat és legközelebb is hozzánk fog fordulni! Európán belül széles kapcsolati rendszerrel dolgozunk, egy feladatra több alternatíva közül tudjuk kiválasztani az Önnek legideálisabb megoldást.


Feladva: 2017-07-11    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: SzállítmányozásmegoldástbelülEurópánTúltöbbhozzánkajánlófeladatralegközelebbHirdetőegyajánlatunkatPepitadolgozunkKérjerendszerrelmásokszállítás

Forrás: pepitahirdeto.multiapro.com

Tekintse meg jelenleg bérelhető flipper automatáinkat! Bérelhető flippereink abból az időszakból származnak, amikor a játéktermek fénykorukat élték, a valaha gyártott legjobb flipperek készültek, mint a Terminator 2, az Indiana Jones: The Pinball Adventure, vagy akár az Addams Family. A legnagyobb flippergyártó 2000-ben befejezte működését, azonban a gépek a retro hullámnak is köszönhetően visszatértek a köztudatba. Mára ezek a gépek igen keresettek, azonban szerviz igényességük miatt kevesen ... további részletek >>

foglalkoznak a bérbeadásukkal. Flippereink egytől-egyig tökéletes műszaki állapotban vannak (ez nem zárja ki a meghibásodást, de ennek esélyét töredékére csökkenti), esztétikailag is igényesen felújítva kerülnek kihelyezésre. www.automataberles.hu/hu/flipper-berles További szolgéltatásaink: - Játékterem telepítés - Retró játékok bérbeadása - Klasszikus és retró játékok családi napokra, céges rendezvényekre - Csocsó, darts kölcsönzés - Box gép bérlés - Prémium katergóriás játékautomaták kölcsönzése - Videójáték bérlés


Feladva: 2016-10-10    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: bérlésflippergépekFlippereinkautomataberlesjátékokretróBérelhetőazonbanegyigTheCsocsószolgéltatásainkigenfénykorukattöredékérebenBudakalászegytől

Forrás: pepitahirdeto.multiapro.com

Online vállalkozásom bővítésére keresek kreatív gondolkodású, pozitív embereket! HA Szeretnél az otthonod kényelmében dolgozni. 🙂 Emellett a befektetett munkának megfelelően szép jövedelemre szert tenni! 🙂 JÓ HELYEN VAGY‼️ Amire a munkához szükséged van: 🔸okostelefon/ számítógép 🔸internet Ìrj ha úgy érzed, hogy EZ a neked való❗️🙂


Feladva: 2017-12-11    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 128578Online12831265039224érzedvállalkozásom8252dolgozniúgyVAGYkényelmében204SiófokHELYENotthonodinternetErzsébettenniSzeretnélHajduszert

Forrás: pepitahirdeto.multiapro.com

Értékesítőket keresünk PC játékok, szoftverek eladásához. Jutalék alapú fizetés. Kötetlen munkaidő, magas jutalék! Nem szükséges végzettség, tapasztalat. Bővebb infó a linken: https://goo.gl/TbG2mW


Feladva: 2017-08-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: jutalékhttpsKötetlenlinkenfizetésinfóalapúBővebbeladásáhoztapasztalatszoftverekvégzettségjátékokszükségeskeresünkNemÉrtékesítőketSuhancTbG2mW

Forrás: pepitahirdeto.multiapro.com

Turkálósok, piacosok, magánvállalkozók figyelmébe ajánlom cégünket, amely több éves tapasztalattal kínálja Önnek használtruha termékeinket. 20 kg-os kiszereléstől az 500 kg-os kiszerelésig biztosítjuk a szezonális ruházatot. I. osztálytól a cream minőségig megtalál nálunk mindent egy helyen. Minden megrendelést ingyenesen kiszállítunk garancia vállalással. Kínálunk gyerek ruházatot, felnőtt használt ruházatot, bálás ruhákat, válogatott extra használt ruházatot, pólós bálákat, melegítős - ... további részletek >>

jogging használt ruha bálákat, lakástextilt, fajtára válogatott extra minőségű ruházatot. Kérje részletes ajánlatunkat!


Feladva: 2017-08-02    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: 224232236zatotruhextra242kathasznhasználttunkcégünketminőségűcreamOrigin20kgkisznlommelegkeinketingyenesenfigyelmválogatottosztályt

Forrás: pepitahirdeto.multiapro.com

Sportszerek nyári és téli sportokhoz, kerékpározáshoz, felnőttek és gyermekek részére. Kínálatunk több sportszermárkát tartalmaz: WORKER, Fila, Galaxy, DHS, 4EVER, Kellys. Választhat széles sportszer kínálatunkból gyermekek részére is: rollerek, futóbiciklik, gyermekbiciklik, korcsolyák.


Feladva: 2017-07-11    [Sport - Kemping - Túra]

Címkék, kulcsszavak: részéregyermekekPepitasportszertöbbáltalszélesKínálatunkgyártóVálaszthatfelnőttekOlcsóbbKellyskerékpározáshozSportboltkorcsolyák4EVERsportokhoz

Forrás: pepitahirdeto.multiapro.com

KRESZ által előírt közúti elsősegély doboz, A mentőláda, B egészségügyi csomag és C buszos mentődoboz értékesítése. Házhoz szállítással is megrendelheti webáruházunkban!


Feladva: 2014-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: KreszelsősegélyértékesítésementődobozHajdúböszörménybuszosmentőládákcsomagfelszerelésekegészségügyimentőládadobozwebáruházunkbanmegrendelhetiközúti

Forrás: pepitahirdeto.multiapro.com

Cégünk széleskörű költöztetési illetve áruszállítási szolgáltatásokat kínál Szegeden és vidéken is. Ha nem talál igényeinek megfelelő szolgáltatást, kérjük lépjen kapcsolatba velünk, hiszen minden ügyfél fontos számunkra és igyekszünk minden elvárásnak megfelelni. Áru, bútorszállítás Nehéz tárgyak szállítása Házhozszállítás Költöztetés Szegeden és az ország bármely területén (magánszemélyek illetve cégek részére) www.ruzsatrans.hu +3630/799-0512


Feladva: 2016-11-06    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: illetvemindenSzegedenszegedKöltöztetésRúzsacégekkínálNehézTransvelünkszolgáltatásokatbútorszállításkapcsolatbamagánszemélyekáruszállításiÁrulépjen

Forrás: pepitahirdeto.multiapro.com

A Balaton-felvidéken, Badacsonyhoz 5 km távolságra káptalantótii szálláshelyek fényképes gyüjtőoldala. Kiadó panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Sok fényképpel a szálláshelyekről és a faluról. - Weblap: www.zimmerinfo.hu/kaptalantoti/hu. htm


Feladva: 2017-05-10    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: zimmerinfoszálláshelyekközvetítésipanziókszálláshelynélKiadówwwlehetőséggyüjtőoldalahttpfoglalásifényképesWeblapközvetlenfalurólelérhetőségükkelSok

Forrás: pepitahirdeto.multiapro.com

Könyvelés és bérszámfejtés kedvező áron Angyalföldön a Full Active Bt. könyvelőirodában. Egyéni vállalkozások és társas vállalkozások könyvelése kedvező áron. SZJA bevallás magánszemélyeknek kedvező áron. Könyvelését bízza hozzáértőkre! Visszamenőleges könyvelést is vállalunk. Ha bármilyen kérdése lenne könyvelés ügyben, keressen minket bizalommal. Tel: 412-08-06, Fax: 412-08-07


Feladva: 2015-01-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: áronkedvezőkönyvelésActiveFullAngyalföldönbérszámfejtés412vállalkozásokhozzáértőkreEgyéniminketbízzakönyvelőirodábankeressenKönyvelésétügybenlenne

Forrás: pepitahirdeto.multiapro.com

Cégem utak, úthálózatok, kerékpárutak aszfaltozásával, tereprendezéssel foglalkozik. Aszfaltozásban és az építőiparban jártas, kiváló szakembereink garantálják a magas minőségű, gyors, pontos és precíz munkavégzést. Cégeknek, önkormányzatoknak és magánszemélyeknek is mindenütt az országban, kézzel és gépel a legkedvezőbb áron! Akár azonnali kezdéssel! Átlag áraink 5 cm AC 11 Kopóréteg 2650 Ft/m2 Mart aszfaltozás 8-10 cm 1400 Ft/m2 Komplett kivitelezéssel. Áraink tájékoztató ... további részletek >>

jellegűek. Referenciáink: Kohinor Építőipari Kft: Penta Kft Alpin Kft Pallér Csarnok Sade Számos önkormányzat és magánszemély. Pontos árainkért érdeklődjön elérhetőségeinket. Várom megtisztelő bizalmukat! T-06/20-282-76-22 T-06/30-831-7457


Feladva: 2017-05-16    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: KftaszfaltozásPontosÁrainkelérhetőségeinketgépelAlpinmagasúthálózatokérdeklődjönkézzelPentagarantáljákutakMartárainkértországbanÉpítőipariCégem

Forrás: pepitahirdeto.multiapro.com

Hajcica Agency oldalán minden egy helyen! Nézzen be hozzánk, fantasztikus kínálat hostess, táncos hölgyekből, chippendale fiúkból, show műsorokból. Megszervezzük esküvőjét, szülinapi meglepetés buliját, vagy bármilyen céges rendezvényét teljes szervizeléssel! Rendeljen tőlünk! Kedvezményeink egyediek, az Ön igényeinek megfelelően. Rugalmasak vagyunk, hiszen a legfontosabb dolog: A MEGRENDELŐ-nek megfelelni, hogy visszajöjjön!


Feladva: 2014-12-24    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hajcicaagencymegfelelnihostesskedvezményeinkProdukciósmeglepetésnekkínálatfolyamatosanszervezéseszülinapiMEGRENDELŐfantasztikustőlünkrendezvényekcom

Forrás: pepitahirdeto.multiapro.com

Akuna Alveo gyógynövények kombinációja, mely több évtizedes kutatómunka eredményeként született meg. Összetett hatásaival bárki egészségi állapotán képes javítani, hiszen kizárólag értékes hatóanyagok találhatók benne. A méregtelenítő Alveo ital fokozza a kiválasztószervek működését, így segíti a szervezet megtisztulását. Hatására a bevitt tápanyagok jobban felszívódnak és intenzívebben érvényesíthetik előnyeiket. Mivel a benne lévő növényi összetevők fokozatosan és kíméletesen hatnak, ... további részletek >>

fogyasztása nem okoz kellemetlen mellékhatásokat a méregtelenítés során. Méregtelenítés Akuna Alveo itallal - rendelés webshopunkban! www.gyogynovenyek.megoldascsomagok.com/akuna-alveo-szolos-950ml


Feladva: 2017-02-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: AlveoAkunaitalméregtelenítőMéregtelenítésbennewebshopunkbanműködésétképesfogyasztásatöbbintenzívebbenrendeléskiválasztószervekállapotánhatnakmely

Forrás: pepitahirdeto.multiapro.com

Legjobb Replica Tökéletes 1: 1 Clone iPhone X Tartalmazza a iphone X Earpods az USB kábellel és USB tápegységgel. Támogatás: GSM, UMTS, TD - SCDMA és LTE (FDD és TD) mobil technológiák Wi-Fi, Bluetooth, NFC Real 4G LTE arcazonosítóval A hardveres elemeken nem spóroltak, hiszen szuper dolgok kerültek bele, mint a dupla előlapi kamera, vagy a 64 GB memória és 256 GB háttértár. iPhone X Clone-t, hogy ellenőrizze, minden esztétikája tökéletesen illeszkedik és nagyon közel van az UI-hoz az ... további részletek >>

iOS 11-hez képest. Ez az iPhone X 256 GB-os modellje Garancia nélkül! +3620/3266764


Feladva: 2017-12-13    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: iPhone256LTEUSBCloneesztétikájaTámogatásmintEladómindentápegységgelbeleKinábólképestRealellenőrizzekerültekKlónhezNFChogykábelleldolgok

Forrás: pepitahirdeto.multiapro.com

Vásároljon első kézből a Devon fürdőszobabútorok magyarországi forgalmazójától, nagy és kiskereskedelmi kiszolgálás, kedvező ár! Fürdőszobabútoraink széles választékával várjuk önöket csepeli raktár áruházunkban. Bútoraink festett fényes fehér MDF előlappal rendelkeznek, lapraszerelt állapotban, karton dobozban kerülnek átadásra. www.majerszerviz.hu/furdoszobabuto r.html


Feladva: 2017-09-19    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: furdoszobabutorDevonválasztékávalkézbőlMDFszélesmajerszervizelsőfehérFürdőszobabútorainkwwwVásároljonfényeskedvezőátadásraajánlófestettkiszolgálás

Forrás: pepitahirdeto.multiapro.com

Mérleges adagoló gép eladó, az Ön igényei szerint! Poros, szemcsés vagy kisebb darabos áru (morzsa, száraztészta, magvak, stb.) adagolására, csomagolására alkalmas adagoló gép eladó. www.gepetgyartok.hu/adagolo1.htm Írja meg igényeit, és kérjen árajánlatot e-mailben! Elérhetőség: Kálmán László 6791 Szeged, Negyvennyolcas u. 49. Tel.: 30/604-5453 www.gepetgyartok.hu


Feladva: 2016-07-11    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: gépadagolóSzegedLászlóeladóKálmángepetgyartokwwwhtmmorzsa6791adagolo1árudaraboskisebbElérhetőségvagymailbenalkalmasszemcsésárajánlatot5453

Forrás: pepitahirdeto.multiapro.com

Sport HD kamera nem csak mindenféle sport események rögzítésére alkalmas, de lehet csatlakoztatni egy autóba, egy motorra, stb tartalmaz a sokféle tartót a csomag, hogy csatolja a kamerát könnyen mindenféle helyre. Tartalmaz egy vízálló tokot is a csomag. Kamera kijelzője 2” és a tömege a kamerának akkumulátor nélkül csak 46 gramm. www.elektronikai-webshop.hu/hu/spo rt-akcio-kamerak/30-sport-kamera-er intokepernyos-hd-720p.html


Feladva: 2017-10-14    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: sportkameraegycsakTartalmaz720perintokepernyosmindenfélecsomaghtmlmotorraautóbanélkülhelyrecsatlakoztatniakkumulátorlehetkameránakkönnyentömege

Forrás: pepitahirdeto.multiapro.com

Festmény a léleknek, a lélek festőjétől. A festmény címe: Átjáró (Tisza-Kalmár György) Méret: 50x50 cm Anyag: olaj rétegelt falemezen A gyönyörű meleg barna színek kavalkádja és az arany lemez tompa csillogása átjárót nyit egy másik világba. Megnyitva az elmét a szellem szabad szárnyalását segíti elő. A fénykép nem tudja visszaadni azt a finom felületi gazdaságot, az árnyalatok sokszínűségét, ahogy egymást fedik a lazúr színek. A festmény érdekessége a kézzel festett fakeret, amely ... további részletek >>

önmagában is egy művészi alkotás, tovább emelve a festmény értékét. www.tisza-kalmar.hu/index.php/galeria/26-absztrakt-festmenyek/27-gallery-3 A festményt személyesen át lehet venni Egyházashetyén (Vas megye, Sárvár közelében), vagy futárszolgálat kézbesíti a megadott címre.


Feladva: 2016-09-14    [Régiség - Művészet]

Címkék, kulcsszavak: KalmárfestményeolajfestőKortársfestőjétőllélekléleknekFestményEgyházashetyeGyörgy

Forrás: pepitahirdeto.multiapro.com

Fűtsön hagyományosan fával, szénnel vagy vegyesen. Elégetheti a papír hulladékot, reklámújságokat és a kartondobozokat is. Magyarországon az egyik legolcsóbb áron. Hagyományos fűtéshez és gázhoz kályhacső, füstcső és kiegészítők. Webáruházunkból országosan kiszállítunk!


Feladva: 2015-11-13    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: fustcsokályhacsőkiegészítőkpapírKergázhozElégethetifűtéshezvegyesengazhozHagyományosvagyaluminiumboláronszénnellegolcsóbbfávalkinalategyikfjs

Forrás: pepitahirdeto.multiapro.com

..udvarból a Balatonba léphet... BALATONFENYVESEN közvetlen a Balaton-partján, családias, gyermekbarát környezetben üdülhet, helyben strandolhat, horgászhat. Ingyenes csónak, vízibicikli használat, kényelmes szállás, elegáns környezet. www.balaton-fenyves.hu 305918036 83-318-839


Feladva: 2014-07-16    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: léphetBalatonbabalatonudvarbólBALATONFENYVESfenyveshorgászhatstrandolhatwwwhelybenkörnyezetüdülhetÜDÜLŐPARADICSOMelegánskörnyezetbenszálláskényelmes

Forrás: pepitahirdeto.multiapro.com

2000-es évjáratú Twingo eladó. Műszaki érvényessége: 2019. 06.19. Elektromos ablak, tükör beállítás, légzsák, szervókormány HIBÁI: sajnos a jobboldali ablak elektromossága hibás, nehéz felhúzni, a fényszórók rossz bekötés miatt nem megfelelően működnek. Mivel már nem fiatal, természetesen van rajta mit csinálni, igény szerint... Ára: 170.000,- Ft Alkuképes!


Feladva: 2017-10-05    [Autó - Motor - Jármű]

Címkék, kulcsszavak: ablakeladóTwingonemMivelszerintMűszakiműködnekjobboldaliigénymegfelelőensajnoscsinálnimiattHIBÁImitévjáratúbekötésszervókormányrajta2000van

Forrás: pepitahirdeto.multiapro.com

Alumínium profilok porfestése. Például: Ablakok és ajtók, kapuk, zsaluk, medencefedő szerkezetek, kerítések elektrosztatikus felületi kezelése porszórással. Kérje árajánlatunkat! Szeretettel várjuk!


Feladva: 2016-07-21    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: AlumíniumvállalunkSzeretettelkapukporfestéstárajánlatunkatajtókKérjeAblakokporszórássalPéldáulkezeléseporfestésefelületiprofilokelektrosztatikusKft

Forrás: pepitahirdeto.multiapro.com

HONDA GL 1500 GOLD WING - 1989-07 HAVI 74 KW 101 LE 154.982 KM !! 2018-05-ig érvényes MŰSZAKIVAL, 2 GYÁRI kulccsal,Jó állapotú első- hátsó gumikkal és féktárcsákkal, Barna BŐR ÜLÉSEK, AM/FM RÁDIÓ, TOLATÁS FUNKCIÓ, Elöl-hátul kiépített 12V rendszer, Kéz és Térdfűtés, MAGYARORSZÁGI RENDSZÁMOS!!!!!! Rendezett MAGYAR okmányokkal, azonnal megvásárolható!!!!! Eladó: 1.199.000.- Ft (Csereár 1.299.000 .-Ft) Akár hétvégén is megtekinthető, előzetes egyeztetés alapján! További képekért és ... további részletek >>

járművekért kérem keresse fel honlapunkat! www.markamotor.hu/magyar/motorok/gl-1500-gold-wing/legujabbak/osszes Teljes körű ügyintézés, Magyar rendszámos motorok névre írása, igény esetén friss Szerviz! Házhoz szállításban tudunk segíteni!


Feladva: 2017-11-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: WINGGOLDMAGYAR1500000RENDSZÁMOSHONDAmotorokHirdetőTovábbiféktárcsákkalrendszerosszes154199szállításbanPepitaképekértgumikkalKézTeljes101

Forrás: pepitahirdeto.multiapro.com

Valósítsd meg a saját projectedet szerezz támogatási összeget magán, üzleti, vagy szociális terved megvalósításához. www.youtube.com/watch?v=F4cwkaunLJ k www.bit.ly/2mZHw3Q


Feladva: 2017-05-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: httpssajátmegvalósításáhozmegtervedValósítsdszociálisNoémivagyKáldorüzletipénzrendszer2mZHw3QmagánkizártbitösszegetLehetőséghttptámogatási

Forrás: pepitahirdeto.multiapro.com

Kutyakozmetika, kutyakozmetikus. Szeretettel várjuk Önt és kedves kutyáját kozmetikánkban. Kedvence részese lehet az Ön igénye szerint egy fürdetésben és egy nyírásban. Telefonos időpont egyeztetéssel.


Feladva: 2015-08-25    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: XIIIegyKutyakozmetikakerületegyeztetésselrészesekutyájátidőpontKedvencekedvesTelefonoskozmetikánkbanönttartástalálhatóvárjukNyitvaalattnyírásban

Forrás: pepitahirdeto.multiapro.com

A fogyókúrák ideje alatt szigorú diétát kell betartani. Korlátozottan fogyaszthatók a gabonafélék, a fehérliszt, a cukor, a zsírok fogyasztása még kis mértékben is keresztbe húzhatja terveinket. A természetes fogyókúrák segítségével biztonságosan szabadulhatunk meg a felesleges kilóktól, sok gyógynövényt felhasználhatunk a méregtelenítéshez, az anyagcsere serkentéséhez, zsírégetéshez. Ha ránk törne a nassolási vágy, igyunk jó sok vizet vagy egy csésze borsmenta teát, ami kitűnő éhségűző. A jól ... további részletek >>

megtervezett, egészséges fogyókúrák mindenkinek segítenek minőségibb életet élni.


Feladva: 2016-11-10    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogyókúráksokmegKellérzsírégetéshezsegíteneksegítségévelgabonafélékcsészeházilagserkentéséhezmindenkinektermészetesfogyaszthatókegyFogyókúravagyjól

Forrás: pepitahirdeto.multiapro.com

A sárga barack mag B17 vitaminban, azaz amigdalinban gazdag. Sokak számára ellenmondásos ez az összetevő, mivel toxikus anyagot is tartalmaz. Ez igaz, ám ennek a toxikus anyagnak a kötése olyan típusú, ami ártalmatlanná teszi azt az emberi szervezetre nézve. A sárga barack mag kifejezetten egészséges étrendkiegészítő, mely természetes formában tartalmaz számos értékes összetevőt. Ilyenek a vitaminok, antioxidánsok, ásványi anyagok, rostok és egészséges zsírsavak. Ezek pozitívan hatnak az ... további részletek >>

immunrendszerre, a keringésre, az emésztésre és a közérzetet is javítják. Miért tartsunk sárgabarackmag kúrát évente többször? Tudjon meg még többet itt: www.sarga.barackmag.com/sargabarackmag


Feladva: 2017-09-18    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: baracksárgakúráttoxikustartalmazegészségesBarackmagmégmagimmunrendszerreolyanIlyenekSokaktöbbszörhatnakkötéseösszetevőtgazdagéventepozitívan

Forrás: pepitahirdeto.multiapro.com

Zenerajongó vagy? A SoundCloud, a hang YouTube-ja. Adj hangot magadnak! Akár zenész vagy, akár amatőr rajongó, tudunk Neked segíteni. Válassz SoundCloud csomagjaink közül, akár zenehallgatást, akár követői csomagot, mind a kettőt olcsó árakon megteheted. www.likebolt.com/?product=1000-sou ndcloud-lejatszas


Feladva: 2016-07-09    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: akárSoundCloudhangvagyYouTubesegítenikettőtNekedZenerajongómindtudunkIldikocsomagotrajongókövetőiamatőrcomzenehallgatástzenészlikeboltközül

Forrás: pepitahirdeto.multiapro.com

Ruhajavító üzletbe képzett varrónőt keresünk, felsőruházat és általános varrási munkák elvégzésére. Érdeklődni a 06 30 222 2912 vagy a 06 30 222 2912 -es telefonon lehet Munkaidő: Kedd - Péntek -ig Web: www.altalanosruhaszerviz.freewb.hu


Feladva: 2017-10-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkvarrónőt2912222üzletbeRuhajavítótelefononképzettfreewbvagyaltalanosruhaszervizÉrdeklődniLaszlohttpelvégzéséreBerkesWebmunkáksürgősen

Forrás: pepitahirdeto.multiapro.com

A vörös szőlőlevél magas antioxidáns tartalmáról ismert keringésfokozó hatású. Az Ultra Weich vörösszőlő levél krém enyhíti a fájdalmas feszülő érzetet a bőrfelületen és frissíti a fáradt, elnehezedett igénybe vett végtagok vérkeringését, ezzel kellemes, hidratált érzést biztosít. Minden bőrtípusra alkalmazható. Külsőleg, a bőr felületén alkalmazandó. Ingyenes szállítási lehetőséggel! www.mososzerbolt.hu/id/00245_UW_Vo rosszolo_level_krem_100_ml_


Feladva: 2016-01-27    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: hatássalbőrfelületetfokozóhidratáljaKeringésNyugtatjaKftsejtregenerációtFutureFokozzaCudywebáruházesetérekrémmosószertüneteklevélHazailábNehéz

Forrás: pepitahirdeto.multiapro.com

Clímatrend termékeinket továbbra is ClimaGuard™ Premium üveggel (Ug=0,6 W/m2K), és extraként Swisspacer™ távtartó profillal (meleg perem) gyártjuk. Mindezek ellenére árainkat nem emeljük! Vásároljon extra hőszigetelésű üveggel készült ablakot, erkélyajtót és bejárati ajtót régi áron! Minőségi termékek elérhető áron, Schumacher™ nyílászárók! Kérjen ingyenes árajánlatot! Tel:06-79/478-405 E-mail: info@schumacherajto.hu www.schumacherajto.hu


Feladva: 2016-01-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: SchumacherüveggeláronbejáratiellenéreingyenesClimaGuarderkélyajtótMindezekKérjentovábbraablakotgyártjuknyílászáróktermékeinketkészültschumacherajto

Forrás: pepitahirdeto.multiapro.com

A bagoly mintás zokni a szürke őszi-téli napokba egy kis pajkosságot varázsol színes mintájával és érdekesen kialakított felső részével. Kiknek ajánljuk ajándékba? - akik szeretik a különleges zoknikat - bagoly fanoknak - vidám minták kedvelőinek - akiknek mindig eltűnik a zokni egyik párja a mosógépben Méretei - egy méretben kapható: talpa 18-19 cm hosszú (nem nyújtott állapotban) - ez egy átlagos méretű női lábnak felel meg (35-39) szélessége: 8 cm Színe: több színkombinációban ... további részletek >>

kapható Anyaga: pamut, poliészter, spandex Itt található: www.atomzsir.hu/bagoly-mintas-szines-noi-zokni


Feladva: 2017-10-12    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: zoknibagolyegyszinestéliőszinoikaphatószínkombinációbanajánljuknyújtottakiknektöbbKikneknematomzsirkedvelőinekSzínerészévelhosszúszürkewww

Forrás: pepitahirdeto.multiapro.com

A jó weboldal olyan mint maga a cég, első ránézésre a minőséget és magát a minőségi márkát adja vissza a látogatónak. És ezt mi pontosan tudjuk! Weboldal készítés 2 év garanciával! Olvasd el, hogyan dolgozunk, és kérj tőlünk konzultációs időpontot!


Feladva: 2016-09-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: WeboldalgaranciávalkészítésWebstartconsultinghogyanmárkátOlvasdminőségimagátminőségetránézésretudjukelsőidőpontotpontosancégkonzultációseztmaga

Forrás: pepitahirdeto.multiapro.com

Egyedi ajándék a legjobb áron‎ Rendeld meg a legszebb névre szóló ajándékot szerettednek!


Feladva: 2017-09-24    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: szólónévreáronlegjobbajándékszerettednekEgyediajándékotajánlóHirdetőPepitalegszebbékszerekmegRendeld8206

Forrás: pepitahirdeto.multiapro.com

Eladó tulajdonostól Bpest. Rákoshegy - Nagyhangácson az Orgoványi utcában 620,2 nm-es, külterületen lévő bekerített kertgazdasági, szántó, gazdasági épület, kivett lakóház, udvar megjelölésű ingatlan és a hozzá tartózó 44,8 nm szolgalmi út. A telken villany és a vezetékes víz bekötve a házba, gáz az utcában, gyűrűs kút, bontandó vagy erősen felújításra szoruló 36 nm-es faház (2 helység, külön WC, tusolós mosdó, veranda és 26 nm-es fedett tároló) van. Csatorna, szennyvíztároló nincs. ... további részletek >>

Személygépkocsi tárolás kerítésen belül megoldható. Utca fronti személykapu, oldalsó gk. bejárat. A terület átminősítése gazdasági területté a Fővárosnál folyamatban van. Befektetésnek is ajánljuk. BKV busszal 10 perc a KöKi . Tájékoztatás csak telefonon! Az ár alkuképes irányár.


Feladva: 2017-10-16    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vanEladógazdaságiutcábanirányárfedettkivettRákoshegyerősenUtcavillanyépületalkuképes26nmBpestfolyamatbanvagymegoldhatótelkenszántótelefonon

Forrás: pepitahirdeto.multiapro.com

Minőségi fa beltéri ajtók közvetlenül a Schumacher™ Ajtóüzemtől! Natúr és felületkezelt beltéri ajtók kedvező áron Nemesnádudvaron és Budapesten. Szuper kedvezményekkel várjuk kedves vásárlóinkat! Elérhető áron, korrekt ügyintézéssel, kiváló minőséget kínálunk. Kérjen ingyenes árajánlatot és mi segítünk megvalósítani álmai otthonát. Tel:06/79-478-093 Web.: www.schumacherajto.hu


Feladva: 2016-01-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: beltériSchumacherajtókáronMinőségimegvalósítaniElérhetőfelületkezeltsegítünkvásárlóinkatNatúrárajánlatotkedvesschumacherajtoAjtóüzemtőlingyenesvárjuk

Forrás: pepitahirdeto.multiapro.com

Szívből - Jövő című könyvem szívből ajánlom a szépirodalmat, verseket kedvelő kedves olvasóknak. Megrendelni a webáruházban lehet: www.verses.boltaneten.hu/kinalat/1 __aranyosi_ervin_versei


Feladva: 2015-09-19    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: ervinaranyosiszívbőlverseikedvesmegjelentkedvelőversesköteteverseketlegújabbkinalatszépirodalmatboltanetenajánlomverseshttpkönyvemlehetcíműJövő

Forrás: pepitahirdeto.multiapro.com

”JAVÍTÁSBAN AZ ELSŐ” Szépen, gyorsan, kedvező áron! Cipőjavítás, táskajavítás, kulcsmásolás, köszörülés, zipzárcsere bármibe, nadrágfelhajtás és egyéb ruhajavítások. Minőségi talpbetétek, cipőkellékek és cipőápolók webáruháza!


Feladva: 2017-07-13    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 8221JAVÍTÓKLINIKAruhajavításokgyorsanANTONIOegyébSzépennadrágfelhajtásbármibeELSŐzipzárcsereJAVÍTÁSBANköszörülésVIIIwebáruházakulcsmásolásBudapest

Forrás: pepitahirdeto.multiapro.com

Ponyvák széles választéka! Cégünk napellenző termékekre szakosodott weboldalt hozott létre, melyen különböző napellenző terméket töltöttünk fel. Megtalálható könyökkaros napellenző, állványos napellenző, illetve számos napellenző ponyva közül választhat. Budapest és környékén ingyenes kiszállással vállaljuk munkáinkat. Elrepedt vagy eltört? Nem gond megjavítjuk- Hívja a 061 445 42 31


Feladva: 2017-06-27    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: napellenzőBudapestbeépítésElrepedtszámoshozottszerelésmunkáinkatilletveweboldaltjavításvállaljukállványosszakosodott445kiszállássalkönyökkaros061

Forrás: pepitahirdeto.multiapro.com

Kitartó, lelkes embereket keresek Bio termékek katalógusból történő árusításához. A munka teljes mértékben otthon végezhető, és nagyon egyszerű, mivel AUTOMATIZÁLT WEBOLDAL segítségével történik, költség és kötelezettségmentesen. Gyes mellett, nyugdíj mellett, de akár munka mellett is, minimális időráfordítással növelheted a bevételed. MUNKATÁRSKÉNT stabil jövedelem lehetősége egy nemzetközi üzlet partnereként - Nincs felső korlát. Annyit kereshetsz, amennyit csak szeretnél. - Az EU ... további részletek >>

országaiban is nyitott a lehetőség! Válassz most BIO készítményeket a mesterséges szemét helyett! Nézd meg a KÍNÁLATOT: www.egeszsegbomba.mylifecare.hu 100% elégedettségi garancia! Regisztrációs és tagsági díj helyett ajándékokkal és folyamatos akciókkal várunk Téged: + AJÁNDÉK utalvány + AJÁNDÉK VIP hűségkártya + AJÁNDÉK katalógus + AJÁNDÉK magazin + AJÁNDÉK termék Hozd létre ingyenesen felhasználói Partner fiókodat és rakd kosárba meglepetéseinket! Ha kedvet érzel hozzá, és szívesen keresnél pénzt ilyen formában, akkor részletesen tájékozódhatsz a weboldalon. Jelentkezzél fel hírleveleinkre is! www.egeszsegbomba.mylifecare.hu A felmerülő kérdéseidre szívesen válaszolok az alábbi e-mail címen: szerencseneked@gmail.com


Feladva: 2016-11-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AJÁNDÉKmellettmunkahelyettszívesenBIOmylifecareegeszsegbombahttphírleveleinkreakciókkalnemzetközikeresekhozzámegcímenHozdszeretnélegyszerűfel

Forrás: pepitahirdeto.multiapro.com

Az ország egész területén állunk rendelkezésükre! Küldje el hozzánk javítandó laptopját. Nincs kedve sok kilométert utazni a legközelebbi szervizig, otthagyni a gépet, majd újra visszamenni érte? Lehet egyszerűbben és kényelmesebben is javíttatni a laptopot. Rendeljen futárt hibás laptopjáért, amikor Önnek jó, ahova Önnek kényelmes. Az ország egész területén állunk rendelkezésükre!Futárszolgálattal az ország bármely településéről el tudja elküldeni részünkre a javítandó laptopot Küldje ... további részletek >>

el szervizünknek javításra! Milyen laptop hibákat javítunk? Lassú, problémás laptop javítása. Túlmelegedő, lefagyó laptopok javítása. Hardver problémák elhárítása. Laptop bővítés, korszerűsítés. Vonalas telefonszámunk: +36-1-709-10-86 Mobil telefonszámunk: +36-20-265-75-30


Feladva: 2017-11-26    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: LaptopországrendelkezésükrejavításaKüldjetelefonszámunkállunklaptopotterületénjavítandóegészÖnnekLaptopszervizcenterHardverfutártszervizünknek265

Forrás: pepitahirdeto.multiapro.com

Örökre búcsút vehet a súlyos patron és toner kiadásoktól, aki képes újratölteni azokat. Lehet akár tintasugaras, vagy lézernyomtató, esetleg fénymásoló. A módszerben segítünk. Vásároljon egy liter nyomtatótintát, vagy töltse újra drága tonerjét, akár 1.000 Ft alatti palackozott tonerporral!


Feladva: 2015-03-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: vagytoneregyakártintaestonerVásároljonkiadásoktólezerTintapatronsegítünkmódszerbenpatronfénymásolósúlyostonerjétlézernyomtatóvehetdrágabúcsút

Forrás: pepitahirdeto.multiapro.com

Buszvezető Németország 5 fő buszvezető (nyelvtudás nélkül) Demmelmair Lechhauser Str. 25 D-86316 Friedberg Tel: 0049-821-2628880 Dinamikusan terjeszkedő, németországi, bajor autóbuszos cégünk keres azonnali belépéssel, teljes munkaidőben helyközi személyszállításra és különjáratra 5 fő buszsofőrt Feltételeink: Lelkes, precíz munkavégzés, megbízhatóság, kulturált megjelenés. Német nyelvtudás előny, de nem feltétel. Lakáskeresésben és a hivatalos ügyek intézésében segítünk. ... további részletek >>

Szakmai fényképes önéletrajzát e-mailben várjuk: busfahrer0821@gmail.com vagy blasi@demmelmair-bus-reisen.de


Feladva: 2017-10-18    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: nyelvtudásnélkülNemetorszagBuszvezetobuszsofőrtmailbenbajorelőnyLechhauserkülönjáratraönéletrajzátnémetországiDemmelmairszemélyszállításrafényképesbus

Forrás: pepitahirdeto.multiapro.com

Bontott kisméretű tégla 75 Ft/db Országos kiszállítás! www.bontott-tegla.co.hu


Feladva: 2016-09-12    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: teglabontottkisméretű75FtÉrdKöveswwwkiszállításOrszágos

Forrás: pepitahirdeto.multiapro.com

A Csepel Car márkafüggetlen autószervízként vállalja minden típusú gépkocsi műszaki vizsgára felkészítését, időszakos, általános szervizelését, átvizsgálását, futómű állítást, klímatöltést. Ezen kívül használt gumi, új téli gumi és nyári gumi abroncs ajánlatokkal, akciókkal, gumi szereléssel és szervizeléssel állunk rendelkezésre magánszemélyek és cégek részére is. Kínálatunkban 1 db-os gumiabroncs is található, így a gumi pótlása defekt esetén költségkímélő megoldás lehet.


Feladva: 2015-01-21    [Autó - Motor - Jármű]

Címkék, kulcsszavak: gumicsepelcarnyárigumitéligumihasználtgumiEzendefektgépkocsiállunkklímatöltéstpótlásatípusúszervizelésselállítástmindenszerelésselfutóműígywww

Forrás: pepitahirdeto.multiapro.com

Ha gyűjtöd a hanglemezt, ajánlom figyelmedbe a Rock LP oldalt. Rock, Pop, Disco, Soul, Funky, Jazz, Blues... Kedvező árfekvésben.


Feladva: 2016-07-18    [Zene - Hangszer]

Címkék, kulcsszavak: RockBluesgyűjtödJazzBudakesziFunkyTiborSoulBotkaDiscoVinylPopBakelitHanglemezoldaltfigyelmedbeárfekvésbenajánlomKedvezőhanglemezt

Forrás: pepitahirdeto.multiapro.com

Gyógypedikűr, gél lakkal


Feladva: 2017-12-16    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: gélakciólakklakkalGyógypedikűrBudapestLaczkóné

Forrás: pepitahirdeto.multiapro.com

Csempézés, padlólapozás és egyéb hideg-burkoló munkák: 06/20/824-2880 és 06/30/643-6121. Kérem tekintse meg honlapomat is, amelyet a www.szladek.gportal.hu címen talál!


Feladva: 2017-06-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megCsempézéstekintseIstvánKéremSzládek6121javításatalál643Hidegburkolatcímen2880Hidegburkológportal824Hidegburkolásszladekmunkákwwwhidegburkó

Forrás: pepitahirdeto.multiapro.com

Akác kerítéslécek közvetlenül a gyártótól. Többféle minta és méret.Akár egyedi igények készítését is vállaljuk. Szeletelt akác. Kerítések kivitelezése. Kérje ingyenes árajánlatunkat email-ben.


Feladva: 2017-05-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: gyártótólakáckerítésingyenesméretKerítéslécKérjemintakivitelezéseTöbbféleKerítésekközvetlenülSzeleteltkerítéslécekvállaljukÉrdkészítésétAttilaben

Forrás: pepitahirdeto.multiapro.com

Aranyszarvas Apartmanház! Szarvason a Történelmi Magyarország szívében található Aranyszarvas Apartmanház Étterem és Grill Terasz újra megnyitotta kapuit. Vendégeink számára biztosítjuk a felejthetetlen, élményekben gazdag kikapcsolódást és pihenést. Minőségi apartmanok, 100 méter széles vízpart, óriási medencék, jacuzzik, szaunák várják a pihenni vágyókat.


Feladva: 2017-09-09    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: AranyszarvasÉtteremApartmanházvárjákSzarvaspihenéstTeraszszaunákajánlókikapcsolódástGrilljacuzzikHirdetőgazdagmedencékPepitaélményekbenóriási100

Forrás: pepitahirdeto.multiapro.com

Budapesti fuvarozó cég megbízható nemzetközi gépkocsivezetőket keres. Választható munkarend, napidíjas rendszer. Feltétel: C+E kategória, GKI sofőrkártya, PÁV. Kezdőket betanítunk. Érdeklődni a megadott telefonszámon, vagy itt üzenetben: www.crosseuropa.hu/hu/jelentkezes- sofornek


Feladva: 2015-11-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: gépkocsivezetőketmunkarendCrosseuropaÉrdeklődniVálaszthatókeresünkbetanítunkkeresKezdőketPÁVnemzetközisofőrkártyamegbízhatóGKIcégkategóriafuvarozó

Forrás: pepitahirdeto.multiapro.com

VW - Audi BONTOTT ALKATRÉSZ SZAKÜZLET! Bontott, gyári új és után gyártott, ALKATRÉSZEK, KAROSSZÉRIA ELEMEK nagy választékban! Már 18. éve vagyunk jelen az alkatrész piacon, több ezer bevizsgált alkatrész közül választhat! Futárszolgálattal 1 nap alatt az ország bármely területére eljuttatjuk a megrendelt alkatrészt! GYÁRI ÚJ alkatrészek 30-40%-al OLCSÓBBAN a márkakereskedésekhez képest! Kérjen tőlünk árajánlatot! Keressen minket elérhetőségeinken!! Tartott Típusok: VW: Amarok (2H) ... további részletek >>

, New Beetle (1C , 5C) , Caddy (9K , 2K) II-III , Crafter (2E) , Eos (1Q) , Golf IV,V,VI,VII (1J , 1K , 5K , 5Q) , Bora (1J) , Jetta (1K , 5C), Golf Plus (5M) , Scirocco (1K8) , Passat B3, B4, B5, B6, B7 (3A , 3B , 3C) , Polo III, PIV, (6N, 6N2), Polo V, VI, (9N, 9N2) , Polo VII (6R) , Polo Classic (6K) , Sharan I-II-III (7M , 7N) Tiquan (5N) , Touran (1T) II-III, IV, Touareg (7L) , Transporter T4- T5 (70 , 7H , 7J) , LT (2D) , UP (1S) Audi: A3 (8L , 8P) , A4 (8D , 8E , 8K) , A4 Allroad (8K) , A5 (8T) , A6 (4B , 4F , 4G), A6 Allroad (4B , 4F) A8 (4D , 4E) , Q3 (8U) , Q5 (8R) , Q7 (4L) Skoda: Octavia (1U , 1Z) , Fabia (6Y , 5J) , SuperB (3U , 3T) , Roomster (5J) , Yeti (5L), Rapid (5J) Seat: Alhambra (7M , 7N) , Altea (5P), Arosa (6H), Cordoba (6K , 6L) , EXEO (3R) , Ibiza (6K , 6L , 6J) Leon (1M , 1P), Toledo (1M , 5P) -VW- VOLKSWAGEN-AUDI Seat, Skoda ABS egység akkumulátor bölcső csonkállvány dugattyú EGR szelep elektromos szervó első - hátsó lökhárító, felnik féltengely fényszóró futómű függönylégzsák generátor hajtókar hengerfej homlokfal hűtőmaszk kárpit tartozékok kettős tömegű lendkerék kilincs klímahűtő klímakompresszor klíma ventillátor kormánymű kormányzsák kuplung lámpák légzsákok lendkerék lengőkar lökhárító rács motoralkatrész motorháztető műszerfal párna nagynyomású szivattyú negyedek oldal üveg önindító övfeszítő PD elem sárvédő szélvédő szervó szivattyú tandempumpa tetősín tükör üzemanyag szivattyú váltó vezérműtengely vízhűtő xenon fényszórók záralkatrész Csak olyan alkatrészt adunk el Önöknek, amit mi is szívesen látnánk az autónkban! Bontott alkatrészek vásárlása esetén választhat ajándékaink közül: elakadásjelző háromszög, kerékkulcs, téli ablakmosó folyadék! MINDEN KEDVES MEGLÉVŐ ÉS LEENDŐ ÜGYFELÜNK FIGYELMÉBE AJÁNLANÁM KÖVETKEZŐ AKCIÓNKAT! HA ELJÖSSZ HOZZÁNK ÉS FELRAGASZTHATUNK NEKED EGY MATRICÁT A HÁTSÓ SZÉLVÉDŐDRE AMIVEL NEMCSAK CÉGÜNKET REKLÁMOZOD HANEM JÓL IS MUTAT, 2000 Ft-os KEDVEZMÉNYT KAPSZ A VÁSÁRLÁSOD VÉGÖSSZEGÉBŐL, VAGY IGÉNY SZERINT AJÁNDÉKUTALVÁNY FORMÁJÁBAN!!!! Továbbá fagyálló és ablakmosó folyadékméréssel állunk rendelkezésére és hibakód olvasással is várjuk önöket!


Feladva: 2017-03-27    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BontottPoloIIIAUDIalkatrészekszivattyúSkodaalkatrészSeatszervóVIIAllroadlökhárítóközülHÁTSÓablakmosólendkerékválaszthatalkatrésztGYÁRIGolf

Forrás: pepitahirdeto.multiapro.com

Asztali sörcsapolók, hogy mindig legyen hideg sör a vendég előtt! Kell-e bármit még mondani ahhoz, hogy ellátogasson a honlapunkra?


Feladva: 2017-07-15    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: hogysörcsapolókAsztalimégDebrecenbármitajánlóKellHirdetőelőttPepitavendégsörhonlapunkrahidegellátogassonlegyenmindigahhozmondani

Forrás: pepitahirdeto.multiapro.com

A látás egyik legnagyobb értékünk. 6 féle olyan gyakorlatot tanulhat meg, aminek otthoni ismétlésével javítani, tudja saját és családja látását. A gyakorlatok könnyen megtanulhatók és együtt ismételheti az egész család. Időpont egyeztetésért, bővebb információért hívjon a 06-30/907-47-86 telefonon. Életmód Stúdió - www.eletmod-debrecen.hupont.hu/36/ a-latas-helyreallitasa-termeszetes- uton


Feladva: 2017-09-17    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: debrecengyakorlatokhelyreallitasagyakorlatotinformációértlátásátlatasolyanbővebbcsaládjahupontféleegyeztetésértsajátértékünkIdőponttudjaeletmod

Forrás: pepitahirdeto.multiapro.com

Rajzos, ez a szép,kis-közepes nagyságú 1,5 év körüli kan kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni lehet: ... további részletek >>

06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagySÜRGŐSgazdinakRajzosvárjatelepenkutyagazdaörökbeGYEPMESTERIkellutánközepesüzenetetnemBekerülésükNAGYONaltathatókishagyjeredetiÓzd

Forrás: pepitahirdeto.multiapro.com

Budapesten a XIV kerületi modern irodánkba keresünk lelkes, jól kommunikáló, telefonálni szerető operátorokat. A munka 6 órában végezhető, rugalmas beosztás mellett. Kezdők, tapasztaltak, diákok és gyermekes anyukák jelentkezését is várjuk! Fizetés: bejelentett jövedelem (fix alapbér -és mozgó bér a megkötött szerződések után) Leendő munkatársunk feladatai: - kimenő hívások indítása kizárólag vidéki területek irányába - script alapján beszélgetés irányítása - hívások adminisztrációja ... további részletek >>

Amit kínálunk: - nyugodt, modern munkakörnyezet - profi betanítás (kommunikációs- és értékesítés-technikai és szakmai ismeretek) - stabil háttér, hosszú távú munkalehetőség - összetartó közösség Elvárásaink: - kiváló kommunikációs készség, - felhasználó szintű számítógépes (Microsoft Office) ismeretek, - értékesítésben vagy call centerben szerzett tapasztalat előnyt jelent - lelkes, céltudatos hozzáállás - pozitív gondolkodású személyiség Amennyiben a fenti elvárásoknak megfelel és szeretne kellemes irodai munkakörnyezetben dolgozni, akkor várjuk a fényképes önéletrajzát a varadi.szabolcs@alphaphone.hu e-mail címre.


Feladva: 2017-10-31    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: lelkesmodernhívásokrugalmasvárjukkommunikációsXIVismeretekirodaiösszetartószerződésekSzabolcscéltudatosmunkakörnyezetgyermekescímreOfficeirányába

Forrás: pepitahirdeto.multiapro.com

Hetente, vagy havonta kereshetsz! Egy csomag ára 0.50 $ és kereshetsz 6,000 $-t, plusz 2,066 pozíciót kapsz, amivel újra keresel! Xprofit. A győzelem egy fenntartható egyenes vonalú mátrix! Amikor kifutsz 2,066 pozícióval jössz vissza újra! Korlátlan , csomag vásárlás. A csomagokat óránként adják hozzá a rendszerhez, hogy minden tag számára tisztességes legyen. 5 $-t utaljatok be minimum indulás előtt! Automatikusan lesz minden! Több számla is megengedett. Pif áthelyezési lehetőség. ... további részletek >>

Processzorok: Bitcoin, Payer, AdvCash, Payza


Feladva: 2017-11-23    [Pénzkeresés - MLM]

Címkék, kulcsszavak: xprofitcsomagwwwújraegyminden066winkereshetszmegengedettegyenestisztességesáraKorlátlanszámlafenntarthatószámárahavontahttpsTöbbtagvagy

Forrás: pepitahirdeto.multiapro.com

Szabaduljon meg adóssággal terhelt cégétől, akár több milliós tartozás esetén is. Eladósodott veszteséges, banki vagy köztartozással terhelt,tagi hitel és házipénztár gondokkal küzdő, csődközeli cégek ÁTVÉTELE, kiközvetítése belföldi partnerek részére. Hivatalos, gyors ügyintézés, jogi garanciával. (Végrehajtás, végelszámolás NEM AKADÁLY) 15 MFt feletti adósság esetén is! Problémás cégek adás vétele, ügyvezető kölcsönzés, cégalapítás.


Feladva: 2016-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: cégekeseténterheltSzabaduljonNEMkiközvetítésebankiügyvezetőKatalinvégelszámolásÁTVÉTELEveszteségesvételeMagyarVégrehajtáscsődközeliEladósodottadás

Forrás: pepitahirdeto.multiapro.com

A Google kereső algoritmusa folyamatosan változik, mondhatni finomodik... Ennek lehetséges következménye lehet, hogy néhány - addig jól kereshető - weboldal, esetleg hirdetés kereshetetlenné válik, eltűnik. Általánosságban természetesen törekszünk arra, hogy a hirdetéseinkkel ez ne történjen meg! Garantáltan megóvni azonban csak azokat a felügyelt tartalmakat tudjuk, melyekre konkrétan felkérnek. Köszönjük a bizalmat, amit egy-egy hirdetés feladással kifejeznek a kedves látogatóink, ... további részletek >>

de a legjobb az lenne, ha a fontos dolgokra külön fel is hívnák üzenetben a figyelmünket egy üzenettel! Marad a mottónk, mely alapján keresőinket is üzemeltetjük: Nekünk az a fontos, ami Önnek az!


Feladva: 2017-05-19    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: egyhogyfontoshirdetéshívnákÁltalánosságbanamitkövetkezményeüzemeltetjükazonbanHirdetőfeleltűnikbizalmatlehetségeskeresőinketmegóvniPepitakülön

Forrás: pepitahirdeto.multiapro.com

Eladó XVI. Kerületben, egy 6-lakásos társasház alatt, főútvonalon, az Örs vezér tér közelében (Nagyiccén) 20 m2-es, komfortos garázs WC-vel, mosdóval, saját vízórával és villanyórával. Két ablak nyílik a főútvo-nalra. A billenő garázsbejáraton még egy külön nyitha-tó személybejárat is van. Ára: 3.900.000.- Ft. Tel: 06302226247


Feladva: 2017-12-25    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: egygarázsXVIEladóközelébenvankerablaktérszemélybejáratBudapestKétvezérnyithaGyulavillanyórávalÖrskülönMolnárvízórávalfőútvonalonsajátmég

Forrás: pepitahirdeto.multiapro.com

Nem ígérek milliókat, de egy olyan lehetőséget ajánlok, amivel hozzájárulhatsz a családi kasszához hosszú távon. Vásárold meg most a neked tetszőt! 18 terméket 50%-al olcsóbban! Miért várnál kedvezményeket csak az év egy napján? Teremtsd meg a saját Black Friday napodat! Keress a részletekért!


Feladva: 2017-11-17    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 224232242hozkatkasszmilliolcscsalrekketrulhatszNemtermhozzSiófokmegamivelErzsébetroldnlokHajdugetingyenesenvonlehetősszletek249

Forrás: pepitahirdeto.multiapro.com

Ingyenes házhoz szállítás keltetőgépekre Magyarországon belül bárhova, ajándék hőmérővel! Új Keltetőgépek 1 év garanciával, kézi vagy automata forgatóval, légkeveréses, digitális kijelzővel. Továbbá kaphatóak a keltetéshez használatos kiegészítők: páramérő (3, 5e), hőmérő(2, 5e), tojáslámpázó(3, 5e). Keltethető tojások: szárnyasok, hüllők, méhek. Hu100sk: 32, 9e, Hu140sk: 36, 9e, Hu100fsk: 59, 9e, Midi55fsk: 69, 9e, Midi60fsk: 69, 9e, Midi100fsk: 79, 9e. Szállítási idő: 1 nap.


Feladva: 2013-12-11    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: garanciávalKeltetőgépekpáramérővagyHu100fskházhozkiegészítőkkéziHu140skIngyeneshasználatosHu100skGellértkeltetéshezméhekKajoskaphatóakDecembernap

Forrás: pepitahirdeto.multiapro.com

Fülcsi, ez az aranyos, 1 év körüli,közepes nagyságú szuka kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd meg!A kötelező oltás és chip árát a jövendőbeli gazdinak kell kifizetnie Érdeklődni ... további részletek >>

lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221vagyFülcsitelepenkutyagazdaörökbeGYEPMESTERISÜRGŐSgazdinakNAGYONaltathatóaranyoshagyjeredetijövendőbelijelentkezésétjelentkezéseazonnalárát

Forrás: pepitahirdeto.multiapro.com

Válassz kutyádnak nyakörvet széles választékunkból, legyen szó akár kistestű, akár nagy testű kutyáról.


Feladva: 2016-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: akárszóKutyalegyenválasztékunkbólszélesnyakörvetkutyádnakkutyárólVálassztestűgubanagyebengyártásakistestűnyakörvek

Forrás: pepitahirdeto.multiapro.com

Akrobatikus tűzzsonglőr és tűztánc show, színpadi pirotechnika, tűzijáték, UV & LED show, gólyalábasok, rendezvényszervezés. Acrobatic firejuggler and firedance show, stage pyrotechnics, fireworks, UV & LED show, stilts, event organizing.


Feladva: 2016-05-08    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: showtűzzsonglőrLEDfiredanceAkrobatikusandBudapestfirejugglerBeátaorganizingAcrobaticILLÉSeventrendezvényszervezéscsapatstiltsgólyalábasokprodukció

Forrás: pepitahirdeto.multiapro.com

Még mindig a leghatékonyabb módja a dohányzás leszoktatásnak a biorezonanciás kezelés. Kínlódás, és elvonási tünetek nélkül. A biorezonanciás kezeléssel megszűnik a nikotin éhség. Stresszoldást és általános méregtelenítést is adunk,a tartós eredmény érdekében. A rögzült szokások oldását életmód tanácsokkal segítjük. A kezelés személyre szabott, kérjük hozza el magával az utolsó szál, félig elszívott, majd eloltott cigarettáját. Időpont egyeztetésre hívjon a megadott telefonon.


Feladva: 2017-05-19    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kezelésMégbiorezonanciáskérjükDebreceneredményIdőpontnélkülszabott06309074786tartóscigarettájáttünetekszemélyrecigarettátóladunkeloltottelvonási

Forrás: pepitahirdeto.multiapro.com

Több mint ezer féle divatékszer és kiegészítő, mobil és táblagép kiegészítő, kozmetikai cikkek, ásványok, csillámtetoválás, pénztárca, tetoválás, óra, piercing és még sok minden más a lehető legjobb árakon. Rengeteg állandó és aktuális, egymással összevonható kedvezmény! Törzsvásárlói program és ingyenes kiszállítás! Ez mind és még sok minden más a LILI BIZSU Webáruházban. Ilyen olcsón még nem vásárolt....


Feladva: 2017-02-18    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: mégsokkiegészítőBIZSULILImásmindenlegolcsóbbanRengetegvásároltkozmetikaimindkiegészítőkárakonnemkiszállításÉkszereklegjobbtáblagépingyenesóra

Forrás: pepitahirdeto.multiapro.com

Yerba Mate Tea ------ yerbamate.hu ------ A mate tea egy 100% természetes, egészséges energia ital! Nagy segítség minden futónak és rendszeres fizikai tevékenységet végzőnek. A mate tea növeli a kitartást, a fizikai teljesítőképességet és javítja a hangulatot. A természet alkotta, mi juttatjuk el hozzád! Tudj meg többet oldalunkon: yerbamate.hu


Feladva: 2016-10-21    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teamateyerbamatetermészetesfizikaiTudjegészségeshozzádjuttatjukvégzőnek100alkottatevékenységetegytermészetrendszeresYerbahangulatotfutónakNagy

Forrás: pepitahirdeto.multiapro.com

Motoros mintás hátizsákok többféle mintával a retro pannónia logóstól a humoros feliratosig. Motoros férfiaknak és motoros nőknek egyaránt kiváló ajándék lehet minden alkalomra. Két rekeszes (egy nagy és egy zseb elől), könnyű poliészter hátizsák, fülhallgató kivezetéssel, állítható vállpánttal. Ha egyéni mintát szeretnél nyomatni, írj! Hossz / cm 40.00 Szélesség / cm 28.00 www.rockpont.polomania.hu/termekek /reszletek/151497_humoros_feliratu_ hatizsak_a_sor_kapcsan-online_rende les


Feladva: 2018-01-04    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: motorosegyhátizsáknőknekmintátmintásegyéniRockPontnagyférfiaknakvállpánttalrekeszesfeliratosigállíthatóKéthumoroskivezetésselalkalomralogóstól

Forrás: pepitahirdeto.multiapro.com

Elhunyt szerettei fotóját megörökítő porcelán plakettek. Fénykép alapján porcelánfestékkel készülnek, 80 °C felett beégetve, kopásálló felülettel és fotó minőségben. Plakettek nagy forma és méretválasztékban! Sürgősséggel akár 2 nap alatt is elkészül a sírkőkép és már a ravatalozáson is ott lehet.


Feladva: 2016-01-04    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: PlakettekporcelánkészülnekBudapestméretválasztékbanporcelánfestékkellehetDekormániaformaalapjánottfényképesnagyFényképravatalozásonragaszthatómár

Forrás: pepitahirdeto.multiapro.com

MD-600PROE Elektromos talicska - Mini dömper A csúszásmentes lábtartó lehetővé teszi a biztonságos állást. Az újonnan kifejlesztett 8-fokozatú hajtómű lehetővé teszi az intuitív és ergonomikus vezetést! Sebességváltó kar közvetlenül a vezérlőpulton. TECHNIKAI ADATOK: Motor / Hajtás: Litium ion akkumulátorral üzemelő villanymotor Motorteljesítmény: 3,5 kW / 80Ah-Akkumulátor Fordulatszám: 3000 Ford/ percenként Indítás: Elektromos Súlya: 235 Kg Hajtás: Hernyótalp Hasznos teher: ... további részletek >>

max.: 600 Kg Puttony térfogat: 0,4 m³ Billentés: Gépiesen Munkasebesség: Előre-max. 6.0 km / h. Hátra-max. 4,5 km / h Hasmagasság: 122 mm Kapaszkodóképesség: max.: 20 ° Méretek lánctalppal: 180 x 60 x 44 Csomagolási méretei (H/Sz/M): 1803 x 876 x 1088 mm RENDELÉSRE! www.lumagmagyarorszag.hu/termekek/epitkezes/minidomperek/md600proe


Feladva: 2017-07-05    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: maxElektromoslehetővétalicskaHajtásdömpertesziMiniKapaszkodóképességMotor600RENDELÉSRE3000122ADATOKteherhajtómű1088Fordulatszám600PROEHasznos

Forrás: pepitahirdeto.multiapro.com

Gázmegtakarítás 12-15%. Turbo Booster Gázfogyasztás csökkentő. ÁRA FÉL ÉV ALATT MEGTÉRÜL, utána folyamatos megtakarítás! Hivatalos engedéllyel! Bemérések és beszerelési útmutató a honlapunkon! www.patikamagazin.eu/?modul=oldal& tartalom=1205809


Feladva: 2015-11-05    [Vegyes hirdetések]

Címkék, kulcsszavak: GázmegtakarításfolyamatosBudapestmeregtelenitesutánaNEODYUMwwwMEGTÉRÜLhttpALATThonlapunkonFÉLútmutatóÁRAbeszerelésicsökkentőbemérésekGázfogyasztás

Forrás: pepitahirdeto.multiapro.com

4 izgalmas minta a gyerekszobába, kicsiknek és nagyoknak! Az új Star Wars & Velux Galactic Night Collection tetőtéri ablakokra szerelhető fényzáró rolóit Jedi lovagoknak és a galaktikus kalandoroknak terveztük, mindenki megtalálja köztük a kedvencét. A Star Wars & Velux Galactic Night Collection a tetőtéri ablakok üvegfelületét egy űrbéli kaland hátterévé varázsolja, így a kis hősök éjjel-nappal kedvenceikkel lehetnek. A Star Wars & Velux Galactic Night Collection segít abban, hogy a ... további részletek >>

gyerekszoba kis Jedi lovagja gyorsan álomba szenderüljön és utazását messzi-messzi galaxisokban folytassa. Kérjen árajánlatot online: www.farmtuzep.hu/star-wars-velux-galactic-night-collection


Feladva: 2017-09-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: veluxwarsstarnightgalacticcollectionmesszifényzárótetőtériJedikishogymintakalandgalaxisokbankalandoroknakabbanizgalmasűrbéligalaktikussegít

Forrás: pepitahirdeto.multiapro.com

Vízálló, csúszásmentes meleg burkolatok, fahatású, kőhatású, szövött és minimál design padlók széles választéka. Click és Loose-Lay padlórendszerek. Az anyag rugalmassága miatt minden helységbe alkalmas, akár falra, pultra, bútor homlokzatra is rögzíthető. Mikrofózolt élekkel, sima, előkészített burkolaton egy 1-3mm-es ragasztóágyba helyezve, gyorsan, kosz-és zajmentesen lerakható, padlófűtéshez is! A különböző termékcsaládjainkat és a színválasztékot megtalálja a www.magicfloor.hu oldalon!


Feladva: 2017-03-23    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: magicfloorburkolatokVízállókoszszövöttrögzíthetőVinyloldalonanyaggyorsankőhatásúhomlokzatraLuxuspadlórendszerekhelyezvefahatásúbútorwwwLayLoose

Forrás: pepitahirdeto.multiapro.com

A tisztaság fél egészség! Persze a mondás máshogy is szól, mely akár még igaz is lehet. Hiszen minek vesződjön a ruhatisztítással, a fárasztó mosással, vagy a korán sem kíméletes vegytisztítással, amikor van, aki szívesen megcsinálja Ön helyett? A mosoda Budapesten biztosítja azon professzionális ruha- és vegytisztítási szolgáltatásokat, melyek garantáltan foltmentes világot teremtenek. A mosoda Budapesten több évtizedes múltra tekint vissza. Új üzemeltetőként igyekszünk a patinás patyolat ... további részletek >>

hírnevét tovább vinni, munkatársaink a mosást, a vegytisztítást és a ruhatisztítást gyorsan és precízen látják el, olyan kiegészítő szolgáltatásokkal együtt, mint például a frissen mosott ruha házhoz szállítása. Teljes körű szolgáltatásaink, kedvező áraink, szakképzett kollégáink és a professzionális eszközeink teszik lehetővé, hogy a mosoda Budapesten még a háztartási mosógépek világában is versenyképes legyen. Ruhatisztítás Budapesten és egész Pest megyében, gyorsan és precízen!


Feladva: 2016-10-05    [Lakossági szolgáltatás]

Címkék, kulcsszavak: mosodaBudapestenprecízengyorsanmégRuhatisztításruhaprofesszionálismegcsináljamintfárasztóháztartásitovábbteremtenekmondáskedvezőszívesenegyüttaki

Forrás: pepitahirdeto.multiapro.com

Professzionális, személyre szabott doboktatás, egyéni időbeosztásban! Kezdőknek, haladóknak, korosztálytól függetlenül, minden zenei stílusban! Földesi Dobiskola!


Feladva: 2016-01-26    [Zene - Hangszer]

Címkék, kulcsszavak: egyéniDobiskoladoboktatásFöldesiidőbeosztásbanszabottstílusbanszemélyrezeneiProfesszionálismindenfüggetlenülkorosztálytólhaladóknakKezdőknek

Forrás: pepitahirdeto.multiapro.com

Ékszerek, kifutó termékek 100 Ft-ért, akár 90-95 %-os kedvezménnyel a Lili Bizsu webáruházban! www.lilibizsu.hu/modules.php?name= lista&id=59a07a381ca4x-100-FORINTOS -EKSZEREK Emellett több mint 1000 féle ékszer és divatkiegészítő egy helyen, akár ingyen házhoz szállítással!


Feladva: 2018-01-11    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: akárBizsuLiliékszerkifutóházhozEmellettÉkszerekingyenlilibizsuWEBÁRUHÁZwwwakcióhelyenwebáruházbanegydivatkiegészítőkedvezménnyelféleért1000

Forrás: pepitahirdeto.multiapro.com

Gázspray rendelés: www.latvanypont.hupont.hu/29/gazsp ray


Feladva: 2016-03-29    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: GázspraySzegedLátványpontgazsprayhupontlatvanypontwwwhttprendelés

Forrás: pepitahirdeto.multiapro.com

Betegségek lelki és fizikai okai és azok megoldása, avagy az egészséges élet TITKAIról válogatott VIDEÓ-részletek! Kattints ide érte: www.tiltottgyumolcs.hu/KL/3.html


Feladva: 2016-06-16    [
Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: tiltottgyumolcsegészségeswwwavagyhttpmegoldásaérteazokideokaiKattintsfizikairészleteklelkiVIDEÓBetegségekválogatotttudásTITKAIrólhtmlélet

Forrás: pepitahirdeto.multiapro.com

Nagy lépés ez egy embernek, és még nagyobb az emberiségnek! Megtakarítások nélküli probléma megoldás! Sok család eddig azért nem tudta megoldani nagy kiadásokkal járó problémáit, mert a bevételből nem tudott megtakarítani ezek érdekében! Ennek a korszaknak vége, most már nincs akadálya annak, hogy minden tervét megvalósíthassa! A „Jövőképem a Létem” Támogató rendszer többek között lehetőséget nyújt: Családi ház, nyugdíj, Gépjármű vásárlás, Áram és gázszámla megszüntetése, ... további részletek >>

Gyermeke magas szintű oktatása, Családja anyagi jóléte, utazások, hobby, karitatív tevékenység, egyéb álmok, célok megvalósítására! A „Jövőképem a Létem” Támogató rendszer célja, hogy megszüntessük Magyarországon a szegénységet, hogy ne kelljen családoknak szétválniuk külföldi munkavállalás miatt, hogy a családok életszínvonalát jelentősen növeljük annak érdekében, hogy a jelen és a jövő generációja már egy sokkal jobb világban élhessen! Úgy oldhatja meg a jövőben felmerülő jelentős összegű anyagi kiadásait, hogy nincs szüksége havi rendszeres megtakarításokra! Jövőkép Programunk tökéletes megoldás arra, hogy akár már 2-3 év alatt megoldhassa az igényeihez szükséges anyagi hátteret! Mivel Önnek garantáltan ez egy fillér költségébe sem kerül, és a programot követve garantáltam megoldhatja a jövőben felmerülő jelentős anyagi kiadásokkal járó problémáit, ezért jelentkezzen bátran, mert kizárólag csak nyerhet a Tökéletes Támogató rendszerünkkel! rozsabusiness@gmail.com


Feladva: 2017-04-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyanyagiTámogatómáregymegoldásproblémanélkülinemMegtakarításokproblémáitrendszerjáró8221nagykiadásokkalLétemTökéletesnincsJövőképemjelentős

Forrás: pepitahirdeto.multiapro.com

A legfontosabb babacikkek forrása! BABABOLT CSEPEL 1214 Budapest, Kossuth L. u. 150. 06-1/706-6261 06-70/777-3244 www.bababoltolcso.hu Hétfő- szerda-péntek: 10:00-17:00-ig. Kedd-csütörtök: 10:00-19:00-ig. Szombat: 10:00-14:00-ig. Mérlegkölcsönzés! Légzésfigyelő bérlés! Állandó és havi termékakciók! Babakocsi, etetőszék, járóka, autósülés, babaágy, bébiőr, légzésfigyelő, babamérleg, utazóágy, bébikomp, pihenőszék, babahinta, babaruha, babajáték széles választéka. ... további részletek >>


Feladva: 2016-11-16    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: CSEPELBABABOLTlégzésfigyelőBudapestHétfőpihenőszék1214termékakciókbababoltolcsobébikomphaviwwwutazóágyÁllandóhttpbabamérlegforrásabérlés3244777

Forrás: pepitahirdeto.multiapro.com

ORVOSI FORDÍTÁS, SZAKFORDÍTÁS! Orvosi, egészségügyi, gyógyszerészeti fordítások magyarra, angolra és németre. Akár teljesen online ügyintézés! EU Fordítóközpont – Fordítóiroda (EU Translations) Orvosi fordítás, szakfordítás valamint hiteles fordítás.


Feladva: 2015-05-08    [Fordítás - Tolmácsolás]

Címkék, kulcsszavak: OrvosifordításszakfordításeuforditasFordítóirodawwwFordítóközpontphpegészségügyiTelszakforditasÚjlipótvárosügyintézéskerhitelesonlineXIIIvalamint

Forrás: pepitahirdeto.multiapro.com

Kiadó próbatermek Csepelen! Érdeklődni: telefonon!


Feladva: 2016-08-12    [Zene - Hangszer]

Címkék, kulcsszavak: próbatermekKiadóÉrdeklődniCsepelenBudapestTulajpróbateremtelefonon

Forrás: pepitahirdeto.multiapro.com

PC játékok óriási választéka a Konzolvilágban, pénztárcabarát árak és speciális kiadások. Kiemelkedő kiszolgálás, gyors és megbízható futárszolgálat.


Feladva: 2017-09-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: játékokpénztárcabarátKonzolvilágbanválasztékafutárszolgálatóriásimegbízhatógyorsajánlókiszolgálásHirdetőKiemelkedőPepitakiadásokKonzolvilágspeciális

Forrás: pepitahirdeto.multiapro.com

Csapatomba keresek dolgozni akaró kollégákat! Otthonról dolgozhatsz, ha gyesen, vagy éppen tanulsz, de szeretnél zsebpénzt. Nem találsz munkát és szükséged lenne olyan lehetőségre, amivel csökkentheted háztartásod kiadásait. Nyugdíj mellett jól jönne kiegészítő jövedelem. Akkor Téged kereslek!!!


Feladva: 2017-11-21    [Pénzkeresés - MLM]

Címkék, kulcsszavak: dolgoznikiadásaitzsebpénztkeresekháztartásodszeretnélkereslekCsapatombacsökkenthetedtanulszTégedSiófokamiveléppenAkkorErzsébetlehetőségrevagyjól

Forrás: pepitahirdeto.multiapro.com

Olcsó bérautónk sokkal tisztább és biztonságosabb, mint a tömegközlekedés MÁV, Volán, BKK, BKV igénybevétele. Autókölcsönzõnk májusi akciójában Renault Clio bérautónkat napi csak 3.000,- Forintért adjuk az átvételtõl számítva 24 órára. Bérautónk www.pluszautorent.hu autókölcsönzés oldalon. Automataváltós olcsó bérautók. Autókölcsönzõnket megbízhatóság, pontosság, jellemzi. Opel Ford Suzuki, Renault, Skoda, Chevrolet bérautók jó áron. Tel: +3630 9488730 www.plusautorent.hu Car hire ... további részletek >>

in Budapest. Válasszon a tiszta, jó, szervizelt, karbantartott olcsó bérautókból. Hosszú autóbérlés esetén akár 30% kedvezmény is igénybe vehetõ. Rövidebb bérlésnél is lehet 10%, és 20% akciós árat igénybe venni. Autóbérlés Budapesten, Pest megyében és a Ferihegyi Liszt Ferenc Nemzetközi repülõtérre kiszállítással. Válasszon bérautóink közül amelyek, 3, 4, 5, 6, 7 személyes, klímás, automata vagy kézi váltós, személyautó vagy kis tehergépkocsi, Kicsi economy, nagy luxus bérautók kölcsönzése. Bérelhetõ autótípusok Opel Corsa C 1.2, a hölgyek kedvenc bérautója. Kicsi helyre is könnyû parkolni vele. Suzuki Ignis 1.3, erõs fürge, pörgõs bérautó. Opel Vectra B 1.6 automata váltós, nagy 4 ajtós kölcsönautó. Ford Focus C-MAX 1.6 HDI Dízel fokozatmentes automataváltós CVT, egyterû. Nagyon alacsony a fogyasztása. Autókölcsönzõ Magyarországon kiszállítással. Suzuki Swift 1.3, a MI autónk a magyarok kedvence. A legolcsóbb bérautó klíma nélkül. Renault Clio 1.4, erõs 74 kw-os motorral.Renault Scenic1.6 Automataváltós egyterû bérautó. Kombi van. Opel Vectra C 2.2 nagy 114 kw szedan, erõ és biztonság jellemzi. Gépjármûkölcsönzés 1992-tõl. Chevrolet Aveo 1.2 kicsi gazdaságos, ezüst bérautó. 5 személyes. Skoda Fabia 1.2 Benzin Gáz LPG üzemû, hatchback 5 ajtós. Személyautó bérbeadás. Opel Vivaro 1.9 dízel 6 személyes kisteherautó. Az ülések gyorsan, könnyedén kiszedhetõek, így a rakodó tér kétszeresére növelhetõ. B személygépkocsi jogosítvánnyal vezethetõ. Renault Espace 2.2 dízel automata váltós 7 személyes bérautó. Klíma, cd tár, navigáció stb. A felsorolás nem teljes kérem, nézze meg a www.plusautorent.hu autókölcsönzõ weboldalunkat is.


Feladva: 2017-12-09    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 245251RenaultOpelbérautóautókölcsönzszemélyesolcsóSuzukiAutomataváltóskiszállítássalwwwAutóbérlésbérautókváltósnagyautomatakicsidízelChevrolet

Forrás: pepitahirdeto.multiapro.com

Önnek is Budapesten van ingatlana? Problémát okoz a takarítás? Akkor önnek a lakástakarítás Budapest szolgálatunkra van szüksége! Számunkra fontos a tisztaság amint ezt a szolgáltatásunk is mutatja, így ön a legjobb helyen jár ha lakástakarítás ügyében keres, megbízható, precíz takarító szolgálatot. Lakástakarítás - Lakástakarítás Budapesten Akciós áron minden alkalomkor! www.takaritasmost.hu/lakastakarita s.html


Feladva: 2017-12-19    [Lakossági szolgáltatás]

Címkék, kulcsszavak: LakástakarításBudapestvanBudapestenönnektakaritasmostmegbízhatótisztasághttpProblémátkeresfontosalkalomkoringatlanaügyébenSzámunkramindenjáráron

Forrás: pepitahirdeto.multiapro.com

A Makulátlan Tiszta Terület Kft., Panoráma ablak, a PVC, a Parketta, a Felújítás utáni, A szőnyeg mély tisztítása, az Irodai eszközök tisztítását, a Zsíros kézmosó, a Boltíves üvegtető, a Lépcsőházi takarítás, a Kazánház takarítása, a Sportlétesítmény, a Kirakattisztítás, a Nagy felületű ablak tisztítása, a Mohás terasz takarítása, az Éttermi asztal tisztítása, a Maszatos, csíkos padló tisztítását a Gumicsík eltávolítását, a seprést, a Domború burkolatok, az Irodaház ablakainak tisztítását, az ... további részletek >>

Olajozott parketta tisztítását, a Garázs tisztítását, mind kihívásnak tekinti, és örömmel végezzük el.


Feladva: 2016-11-16    [Lakossági szolgáltatás]

Címkék, kulcsszavak: tisztításáttisztításaMakulátlanparkettatakarításaKftTerületablakTisztafelületűeszközökpadlóNagyGarázsIrodaicsíkoskerületKirakattisztításmélyPVC

Forrás: pepitahirdeto.multiapro.com

Ennyiért még szórólapot sem kap! Kezdő weboldalaknak, weboldalakon, webáruházakban megjelenő akcióknak és internetes figyelemfelhívásoknak kifejezetten ideális! Egyszerűen használható kezelőfelületen beállítható, módosítható, ha kell...


Feladva: 2017-06-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: 000szórólapotfigyelemfelhívásoknakméginternetesEnnyiértakcióknakajánlókellmegjelenőHirdetőmódosíthatówebáruházakbanPepitabeállíthatóweboldalakonért

Forrás: pepitahirdeto.multiapro.com

Béreljen riasztó rendszert és 3 év után az öné! Vagy válasszon akciós csomagjaink közül! Telepítéseinket az egész ország területén végezzük!


Feladva: 2016-10-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: riasztóSzolnokközülFerenccsomagjainkSzekeresakciósbefektetésselválasszonkisVagyrendszerönéutánrendszert5322126Béreljenriasztotgyorsan

Forrás: pepitahirdeto.multiapro.com

A Kingtel egy eddig még sohasem látott távlatot kíván megismertetni önökkel a Mobiltelefonok rohamosan fejlődő világában. Főbb szolgáltatásaink: Mobiltelefon Táblagép Telefonok a Boltunkban Gyári Tartozékok Kiegészítők iPhone Szerviz Android Szerviz Kijelző Felújítás Minden használt Mobiltelefont és Táblagépet készpénzért azonnal megvásárolunk vagy beszámolunk a legmagasabb piaci áron!


Feladva: 2017-09-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: MobiltelefonTáblagépKingtelSzervizszolgáltatásainkMindenlátottáronTelefonokhasználttávlatotBoltunkbanMobiltelefontkívánGyáriTáblagépetmegismertetni

Forrás: pepitahirdeto.multiapro.com

A bevásárlóközpontok, plázák, mallok világszerte méltán népszerűek... Olyan igényt elégítenek ki, amivel mindenki nyer! Magyarországon is jelentősen növekedik az e-kereskedelem. Számtalan webáruházat találhatunk, jót is és kevésbé jót is... Azoknak a kereskedőknek figyelmére mindenképpen számítunk, akik már megtapasztalták a saját webhelyeiken nem csak az éppen hatályos jogszabályoknak kell megfelelni, hanem folyamatosan karban kell tartani a webhelyet, annak az elérhetőségét, különben a ... további részletek >>

látogatottság, vele együtt az üzleti eredmény is elmarad. Azok figyelmére is számítunk, akik (esetleg földrajzi adottságaik miatt?) fejlődésre csak az interneten keresztül számíthatnak. Internetes kereskedelemről van szó, pláza szerű webes környezetben! Nem feltétlenül mindenki alkalmas azonnal árusítani termékét, interneten forgalmazható szolgáltatását. Ismerjük meg egymást! Ön tudni szeretné, hogy miképp lehet kereskedő webplázánkban, mi pedig azt, hogy Ön milyen gyakorlattal (ismeretekkel) rendelkezik már az internetes kereskedelemben, milyen árucikkeket, termékcsoportokat forgalmazna. Ezen a helyen biztonságosan üzenetet küldhet, egy rövid bemutatkozást, cégismertetőt kérünk! Ha van webhelye, kérjük írja meg webcímét is! Minden olvasónak köszönet az érdeklődésért, az üzenetekre a legrövidebb időn belül válaszolunk!


Feladva: 2017-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: márNemhogyjótvaninternetenakikesetlegmilyenplázaszámítunkfigyelméreinternetesmegkellMagyarországonmindenkicsakkérjükegymástüzletinyeridőn

Forrás: pepitahirdeto.multiapro.com

Kínálatunkban több mint 1000 féle fa bútor. Prémium minőségű tömörfa bútorok, szállítás Magyarország teljes területére.


Feladva: 2017-10-04    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: bútortömörfaPepitaminőségűMirekPrémiumféle1000területéremintteljestöbbMagyarországKínálatunkbanszállításajánlásbútorokHirdető

Forrás: pepitahirdeto.multiapro.com

Prezídium az igényes, és biztonságos hevederzár. Minden ajtóra felszerelhető, Rotó, Abus, vagy Mauer betéttel szereljük, árusítjuk. Egyedi méretben is kapható. A cilinderbetétet speciális felfogatása miatt törés és maghúzás ellen is védett. A zár a rudazatot mind a két irányban 110mm hosszon kitolja. Gordiusz pajzzsal dupla védelem (www.gordiuszpajzs.hu).


Feladva: 2015-10-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: hevederzárGordiuszbiztonságospajzzsalellenszereljükigényesmaghúzásbetéttelPrezídiumkitoljatörésMauerhosszonBudapestmiattvagy110mmPéterAbuskét

Forrás: pepitahirdeto.multiapro.com

Ahhoz, hogy egy kertben tartott kutya jól érezze magát minden időjárási körülmények között, elengedhetetlen a megfelelő kutyaház, kiválasztása. Természetesen legelőször is elengedhetetlen figyelembe venned, hogy nem minden fajtájú kutya alkalmas a szabadban tartásra. A kutyaháznak az a funkciója, hogy megvédje a kutyát az időjárás szélsőségeitől. Ilyen szélsőségek a hőmérsékletből, szélből, csapadékból adódhatnak. A kutyaház kiválasztásának elsődleges szempontja a megfelelő hőszigetelés.


Feladva: 2016-01-05    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: hogykutyaházelengedhetetlenkutyamegfelelőKedvenceinkmindennemkiválasztásánakérezzemegvédjevennedjólfigyelembeadódhatnaktartottfunkciójacsapadékból

Forrás: pepitahirdeto.multiapro.com

----Pick téliszalámi reklám áron! ---- Pick eredeti téliszalámi ára : 4390 Ft/kg Herz eredeti téliszalámi ára : 4390 Ft/kg Csongrádi füstölt kolbász ára : 1190 Ft/kg Pick paprikás szalámi ára : 990 Ft/db ---- Budapest XI. Bocskai út 42 sz. ----- ---- Telefon: 061/3611-609 ---- Web: http://www.lazarhus.hu Email:lazarhusmintabolt@gmail.com< /a>


Feladva: 2016-08-16    [
Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: áraPicktéliszalámiLázár4390Budapesteredetiszalámi1190Hús3611kolbász061füstöltárakTelefonCsongrádicomHúsboltBocskailazarhusmintabolt@gmail

Forrás: pepitahirdeto.multiapro.com

Class GSM Cégünk a Class-Mobil Kft (classgsm.hu) a következőkkel foglalkozik: • Használt és Új mobiltelefonok értékesítése. • Mobiltelefon megvásárlása, felvásárlása készpénzért. • Mobiltelefon csere. Ilyenkor árajánlatot teszünk régi készülékére az aznapi legmagasabb piaci áron, és amennyiben megfelel Önnek a kölcsönösen kialkudott összeg, úgy azt beszámoljuk új készülékének az árába. Amennyiben van otthon a fiókba, már nem használt mobilja, hozza be azt is hozzánk és ... további részletek >>

megvesszük. • Mobiltelefon kiegészítők, tartozékok értékesítése készletről. Amennyiben nincs készletünkön a keresett tartozék úgy azt gyors határidővel megrendeljük Önnek. Néhány kategória: Ütés álló üvegfóliák, kijelző védő fóliák, hálózati mobil és tablet töltők, autós töltők, adatkábelek, nagy választékban kaphatóak védőtokok, ami lehet flippes tok, szilikon tok, tpu tok, bőr tokok, gyári prémium tokoktól egészen a kézműves prémium bőr mobil és tablet tokokig. • Cégektől felvásároljuk leselejtezett mobiltelefon flottájukat. A Class gsm üzlete vasárnap kivételével minden nap szeretettel várja meglévő és új vásárlóit. A következő nyitva tartás szerint: Hétfőtől - péntekig 9 órától 19 óráig, szombaton 9-től 14 óráig. Vasárnap zárva vagyunk. ________________________________________ Hogyan jut el hozzánk? Gyalogosan: Az Újpest központ metrómegállónál kell leszállni. A metró aluljárónál a Trió-Burger közvetlen melletti lépcső-feljárónál kell felmenni a lépcsőn. Így már az Árpád út jobb oldalán (Újpest Városkapu irányában), és ezen tovább haladva megközelítőleg 320 lépés megtétele után (kb: 200 méter) Érkezünk meg a Árpád út – Kemény Gusztáv sarkára. Itt jobbra fordulva, már látható a Class GSM boltja, ami 10-12 méterre van jobb oldalon a saroktól. ________________________________________ Kérdése van? A leggyorsabb egy telefon hívás +36 70 502 5071 Vagy írjon nekünk a kapcsolati űrlapunk segítségével, amely a következő linkre kattintva érhet el: www.classgsm.hu/kapcsolat Tisztelettel a classgsm.hu csapata.


Feladva: 2017-12-05    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: 8226ClassGSMclassgsmÚjpestmobiltelefonAmennyibentokmobilaztvanmárhasználtamitöltőkÖnnekkellközpontértékesítéseÁrpádtablethozzánkbőrúgy

Forrás: pepitahirdeto.multiapro.com

Új és használt ipari csavarkompresszorok széles választékban! - 5,5 kw-tól 150 kw-ig - gyári új - felújított kompresszorok garanciával - alap gép - frekvencia váltós - légtartály - hûtveszárító - országos szervíz szolgálat 690.000.- Ft-tól Pitair KFT Tel: 06-20-330-6665 www.pitair.hu


Feladva: 2017-04-26    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: pitairKFTtólszervízlégtartályszélesTelváltóscsavarkompresszorokfrekvenciaiparigéphasznált000alapRáckeve690garanciávaljavításszolgálatországos

Forrás: pepitahirdeto.multiapro.com

Befektetési arany termékeinket azonnal, a fizetéssel egyidőben, készpénzért veheti meg Bp. 1085 József krt. 40. alatti központunkban és az oldalunkon felsorolt pénzváltókban. A pénzváltókban a választék és készlet mennyisége is kisebb mint a központban. Fizethet átutalással is, ilyen esetben hívjon minket telefonon! Központunkban és a készlettel rendelkező pénzváltókban (a budapestiek kivételével) el is adhatja aranyát, a központ mellett már Debrecenben is azonnal megkapja az ... további részletek >>

ellenértéket! A feltüntetett árakon kívül nincs semmilyen más költség. A vételi ár csak a fényképen látható és sérülésmentes csomagolású aranytömbökre, illetve a sérülésmentes érmékre vonatkozik. A listában nem szereplő aranytömböket és érméket is megvásároljuk egyedi ár alapján. www.correctgold.hu/befektetesi_arany


Feladva: 2017-07-14    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: pénzváltókbanaranybefektetesisérülésmentesazonnalKözpontunkbansemmilyenválasztékwwwközpontfizetésselhívjonnincsfelsoroltalapjánaranyáttermékeinket

Forrás: pepitahirdeto.multiapro.com

INGYENES Elme Tréner szoftver! Toppon Leszel! Egy nagyszerű eszköz az önfejlesztéshez, ami segít a tudatalattid hatékony átprogramozásában. Változtatni sohasem késő, kezd el most, ezzel az ingyenes szoftverrel! Bővebb információ a weboldalon, ahol például láthatsz egy nagyon jó videót, ami bemutatja azt a folyamatot, hogy mi játszódik le az agyadban, amikor szabotálod a sikereidet!: www.topponleszel.com/tudatalatti-u zenetek-mukodese


Feladva: 2017-04-03    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: ingyenesszoftverTrénerElmeszoftverrelsegítönfejlesztőamiezzelönfejlesztéshezmosteszközkezdnagyszerűcomkésőEgytopponleszelsohasemLeszelhttp

Forrás: pepitahirdeto.multiapro.com

Új műnövények érkeztek! fák, futók, bokrok. www.selyemviragok.hu/index.php?id= 2039 Válogasson és rendeljen a Zöldvilág Webáruházban


Feladva: 2017-12-11    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ZöldvilágfákérkeztekműnövényekGyőrWebáruházWebáruházbanNagykereskedésSelyemvirágrendeljenMűnövényVálogassonbokrokfutók

Forrás: pepitahirdeto.multiapro.com

Búvóhely pároknak Siófokon néhány órára vagy éjszakára is! Csak hívj és foglalj. A feltüntetett ár 3 órára vonatkozik.Új szolgáltatásunk, dézsafürdőnk is igénybe vehető.(egyeztetést igényel) Rejtett telefonhívásokat nem fogadunk! Csak párok hívjanak! Nálunk a diszkréció az elsődleges szempont!


Feladva: 2017-06-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: pároknakBúvóhelyCsakóráraRejtetthívjszempontigényeléjszakáraelsődlegesegyeztetéstvagydiszkrécióvehetőnéhányNálunkigénybeSiófokonhívjanakpárok

Forrás: pepitahirdeto.multiapro.com

Segítünk megvédeni mindent, ami Önnek fontos. Otthona, munkahelye biztonságát a távfelügyelet garantálja. Kiépítjük biztonsági rendszerét, távfelügyeletbe kapcsoljuk, és bármilyen riasztás esetén akár 5 percen belül a helyszínen a segítség. Mi nem jobbak, hanem másabbak vagyunk a konkurenciánál a professzionális vagyonvédelem területén!


Feladva: 2017-07-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: nemrendszerétmindentsegítségbiztonságimegvédenihelyszínenKiépítjükterületénSegítünkbelülgarantáljavagyonvédelemajánlópercentávfelügyeletHirdetőakár

Forrás: pepitahirdeto.multiapro.com

Budafok kertvárosi részén családi házrész korrekt áron eladó. Külön bejárat, önálló épület, jó műszaki állapot. Az eladó részhez kiskert és szuterén is tartozik. - További infó a weboldalon


Feladva: 2017-02-26    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóTovábbiKülönifjtartozikáronköltözhetszuterénkorrektAzonnalkiskertházrészrészhezcsaládirészénállapotkertvárosiműszakiBudafoképületönálló

Forrás: pepitahirdeto.multiapro.com

Lófejes kulcstartó, nyaklánc, övcsat eladó. Érdeklődj telefonon: 30 640 5940, vagy postázni is tudjuk. www.hunbolt.hu/spd/2411/Lofej-patk oval-kulcstarto-3-x-4-cm


Feladva: 2016-11-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: eladónyaklánckulcstartóLófejes640telefononÉrdeklődjövcsattudjukpostázniBudapestvagyMargó5940

Forrás: pepitahirdeto.multiapro.com

Kutyakozmetikus tanfolyam indul OKJ-s, EU-s bizonyítvánnyal Budapesten több helyen, Győrött és Gödöllőn. Rugalmas időbeosztás, egyénre szabott oktatás, részletfizetés, munkalehetőség. Mestervizsgás képesítéssel és 21 éves tapasztalattal! Szveti kutyakozmetika, nyilv.szám: E-000404/2014/A001 Bővebben: Winkler Viktória 0670/775-76-73, szveti@szvetikutyakozmeti ka.hu vagy www.szvetikutyakozmetika.hu


Feladva: 2016-09-27    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: kutyakozmetikatanfolyamKutyakozmetikusSzvetiBővebbenMestervizsgástöbbA001munkalehetőségBudapesten2014részletfizetésszvetikutyakozmetikabizonyítvánnyalwww

Forrás: pepitahirdeto.multiapro.com

Támogassa a koraszülött babák ellátását adója 1 százalékával! Miért minket támogasson? Köszönjük, ha elolvassa: www.anokert.hu/ado-1


Feladva: 2017-09-27    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: adobabákanokertkoraszülöttwwwTámogassaelolvassaajánlóKöszönjükHirdetőtámogassonPepitaminket8206MiértBabákértszázalékávalSzázalékadójaAdó

Forrás: pepitahirdeto.multiapro.com

Ausztriai kapcsolatokkal keresünk olyan agilis embereket Nemzetközi piacvezető Törzsvásárlói Rt.-hez akik Ausztriában partneri vezető Referensként tevékenykednének. Kiemelten várjuk 25-45 év közötti felsőfokú végzettséggel rendelkező céltudatos, sikerorientált munkatársak jelentkezését, akik nyitottak a tudatos vásárlási tanácsadó területre. Díjmentes, teljes körű magas színvonalú duális átképzést biztosítunk. Karrierlehetőség: • Kiemelkedő, teljesítményarányos nemzetközi jövedelem ... további részletek >>

• Életpálya program • Szakmai oktatások • Biztos háttér • Gépkocsi támogatás • Bónuszok Feladat: Az embereket és a cégeket informálni arról, hogyan tudnak tudatosan és felelősen vásárolni, ott, ahol eddig, azt, amit eddig, hogyan tudnak jelentős visszatérítéseket kapni készpénzben. A Vásárlási Tanácsadók feladata, hogy olyan plusz pénzeket tegyenek az emberek zsebébe, amely eddig is meg volt, de senki nem jutott hozzá, mert nem tudta, hogyan kell! A munkához tartozó elvárások:  Felső vezetéssel kapcsolattartás  Képzéseken való megjelenés Jövedelmi lehetőségek: Vásárlónként havonta 500-3000 forint lehetséges, teljesítményarányos jövedelem, amely kimagaslóan magasabb, mint amit Magyarországon bármilyen területen és pozícióban megkereshető! / Pl. 1000 vásárlónál 500.000-3.000.000,- millió forint havonta, EGYSZERI MUNKÁVAL!!!! / Gondolja át, hogy Ausztriában 8 588 584–en élnek és hányan vásárolnak nap, mint nap, és ennek megfelelően kiszámolhatja a havi jövedelmét is!!!! Jelentkezzen önéletrajzzal és motivációs levéllel Vásárlási Tanácsadónak, és ismerje meg a részleteket, amellyel Magyarország legmagasabb jövedelem kategóriájába kerülhet! Email: rozsabusiness@gmail.com


Feladva: 2017-04-04    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 8226eddigVásárlásihogyanjövedelem000AusztriaiteljesítményarányosakikAusztriábanmeghogynapmintemberekethavontatudnakforintnemzetköziamitnem

Forrás: pepitahirdeto.multiapro.com

Lomtalanítás Non Stop Szeretné komoly költségek nélkül elvitetni a feleslegessé vált lomjait, akár ingyen? Ez esetben máris tárcsázzon minket! Kizárólag akkor számítunk fel díjat, ha munkánk során költségek merülnek fel! Miért érdemes minket választania? A több éves tapasztalattal rendelkező, megbízható, munkájára igényes, agilis, rendszerető, a környezetvédelemre is odafigyelő munkatársak miatt, akik az Ön rendelkezésére állnak minden nap, akár hétvégén, vagy ünnepnapokon is!


Feladva: 2016-03-17    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: akárminketfelLomtalanításingyenköltségekváltakikBalogtapasztalattalmunkánkBudfeleslegessémiattnonstopévesdíjatLegyenelvitetnimunkatársaktöbb

Forrás: pepitahirdeto.multiapro.com

Állami támogatás kihelyezésével foglalkozom és mindenféle hitel közvetítésével, valamint biztosításokkal. Ingyenes tanácsadás, igényfelméréssel egybekötve, hogy legalább az információ meglegyen, ami nélkül hozzuk meg sorra a rossz döntéseinket. Kiválasztjuk együtt a legjobb megoldást és elmondom mit hogyan kell csinálni ahhoz, hogy saját otthonod melegét érezd és a saját kertedet szépítsd. Kérjetek visszahívást tőlem itt: www.otthonteremtes-biztonsaggal.webnode.hu vagy itt: ... további részletek >>


Feladva: 2016-11-06    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: hogytámogatásÁllamitanácsadásIngyenesittsajátotthonteremtesegybekötvedöntéseinkethttpigényfelmérésselahhozrossztőlemcsinálniBudapestsorrakell

Forrás: pepitahirdeto.multiapro.com

Nem online! Személyes segítség! Azonnali társtalálás megbízhatóan általam. Diplomások, Vállalkozók, jó társaság! Azonnali Társközvetítés · 23-96 év közöttieknek Férjet? Feleséget keres? · Hívjon már ma!


Feladva: 2017-07-15    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: Azonnali183FérjetSzemélyesközöttieknekonlineTársközvetítésNemajánlótársaságHirdetőVállalkozókPepitamárDiplomásokIrodájaHívjonáltalamTárskereső

Forrás: pepitahirdeto.multiapro.com

A menopauza kezelése a vöröshere izoflavon segítségével egyszerűen megoldható. Senki sem szeretne hőhullámoktól és hangulatváltozásoktól szenvedni. A Promensil erre kínál megoldást. Ez a vöröshere kivonat tartalmú készítmény klimax ellen teljes körűen hat, kedve a tünetek csökkentésétől egészen a betegségek megelőzéséig. A szív- és érrendszeri problémák nagy veszélyt jelentenek a menopauza alatt. Ezeket a krónikus betegségeket elkerülhetjük a Promensil szedésével, mely a lelki egyensúly ... további részletek >>

megteremtéséhez is hozzájárul. A normál és a korai menopauza működése bővebben: www.MenopauzaVitamin.com


Feladva: 2017-08-23    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: menopauzaPromensilvörösherekezeléseelkerülhetjükszeretnemegelőzéséigkészítménybetegségeketsembetegségekkoraitartalmúkrónikusSenkiegészennormálalatt

Forrás: pepitahirdeto.multiapro.com

Vásároljon profi IP kamerarendszert, beltéri éjjellátó IP kamerát, kültéri éjjellátó IP kamerát, szerelési anyagokat Magyarország egyik piacvezető kivitelező cégétől. Mi csak olyan IP kamerákat, hálózati videó rögzítőket, komplett kamerarendszereket ajánlunk Önnek, melyeket cégünk is nap mint nap telepít. Nézze meg web áruházunkat! Kameradepo webáruház Tel: 06 20 569 8848


Feladva: 2014-02-12    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: kamerátKameradeponapéjjellátómelyeketFullcégétőlwwwkamerarendszertÖnnekIparikivitelezőhttpprofiajánlunkpiacvezetőáruházunkatVásároljon8848egyik

Forrás: pepitahirdeto.multiapro.com

Csatlakozzon a legjobb feltételekkel a mi rendszerünkhöz! Belépési díj akár 0 Ft! Havi szolgáltatási alapdíj akár 0 Ft! A hirdetési költségek nagy részét átvállaljuk partnereinktől! Vállalkozásunk 1996 óta foglalkozik ingatlanközvetítéssel és a hozzá kapcsolódó, ezt elősegítő kiegészítő tevékenységekkel. Sikerünk alapja a költségtakarékos működés és a saját fejlesztésű know-how. Ezt a tudást és tapasztalatot adjuk át jövőbeni partnereinknek. Minden megyéből várjuk a jelentkezőket!


Feladva: 2015-12-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: MakkosknowfranchiseCentrumIngatlanlehetőségetátadásdinamikusanaztcéljábólterületenakikkörűfejlesztéseezenvállalkozóknakTeljeskiépítéseindítani

Forrás: pepitahirdeto.multiapro.com

Elvárások: • folyamatban lévő felsőfokú tanulmányok • magas fokú PC ismeret (adatbázis, függvények, diagramkészítés) • pontos, precíz munkavégzés • rendszerszerető, analitikus személyiség • szorgalom és megbízhatóság • heti min. 24 munkaóra vállalása Amit kínálunk: • szakmai tapasztalatszerzési lehetőség • szakmai képzések és tréningek • kiemelt órabér: bruttó 1000-1200 Ft • karrierlehetőség • jó hangulatú összetartó ... további részletek >>

és segítőkész közösség • modern munkakörnyezet • gyakorlati hely igazolása Munkavégzés helye: Budapest,VIII. kerület Amennyiben felkeltettük érdeklődését kérjük küldje el fényképes önéletrajzát a csaszar.laszlo@jobandcareer.hu e-mail címre vagy bővebb információkért hívja 06203933446-os telefonszámot. eng. 49765-1/2008-5100595


Feladva: 2017-11-08    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 8226szakmailehetőségMunkavégzéshetiAmennyibenismeretmoderntréningekgyakornokcímremegbízhatóságkerületfokú5100595közösségképzésekszámvitelimail

Forrás: pepitahirdeto.multiapro.com

Autódekoráció tervezése digitális nyomással, betűkivágással, hosszú élettartamú fóliákkal. Mágnesfóliára is. Fényképes ajándéktárgyak bögre,egérpad. Digitális képek nyomása vászonra, ponyvára, pólóra naptárra. Nyomtatás és riccelés egy menetben. Kiadványszerkesztés, grafikai tervezés, arculattervezés. Esküvői meghívó, névjegy készítése. Reklámtábla, kirakatdekoráció tervezése kivitelezése. Szitanyomás fémre,üvegre, textilre. Bp. Veres P. út 83. Tel.: (1) 401-0931 vagy (20) 570-3007


Feladva: 2017-04-11    [Autó - Motor - Jármű]

Címkék, kulcsszavak: betűkivágássalDigitálisAutódekorációtervezéseReklámtáblatervezésnyomásaSzitanyomásgrafikaiképek3007nyomássalkivitelezéseKiadványszerkesztés570menetben

Forrás: pepitahirdeto.multiapro.com

Non Stop Lakatos Budapest! Non-Stop Zármentés Budapest. A Non Stop Zárszerviz Budapest és környéke vállalja zárak cseréjét és javítását, postaládák zárcseréjét. Hevederzárak szerelése, javítása. Ellopták a kulcsait?Illetéktelen személyhez került a kulcs? Zárcsere!Ne váljon betörés ill. lopás áldozatává! A zárcserére és a biztonságtechnikára fordított összeg, többszörösen megtérülhet! Minket éjjel-nappal hívhat, mindig fix árakon dolgozunk. Munkánkról és a beépített anyagokról mindig ... további részletek >>

számlát és garanciát adunk! Tehát zárcsere, zárszerviz, lakatos munkák, vagyonvédelem és hevederzár szerelés Budapesten. Zárjavítás Budapest 0-24! Műanyag bejárati ajtó javítás és zárcsere. Felhúzó kilincses ajtók javítása és zárcseréje garanciával. HI-SEC ajtó zárcsere és javítás. Az elvégzett munkára és a beépített anyagokra garanciát adunk! Hevederzárak kínai ajtókra is! Kínai ajtó zárcsere és javítás. Hívjon bizalommal, minőség és szakértelem megfizethető áron! Hevederzár szerelés Budapesten és Pest Megyében. Minőségi hevederzárak kedvező áron, akár 3 év garanciával. Gyors és precíz, kiváló szakmunka a hevederzár specialistától! Személyre szabott vagyonvédelmi szaktanácsadás. A legjobb hevederzár árak! Biztibuk hevederzár, Prezidium hevederzár. Hevederzár zárbetétek kedvező áron. Hevederzár zárcsere, olcsón minőségi anyagokkal. Hevederzárak műanyag ajtókra is!!! Hevederzár kínai ajtóra is!!! Hívhat non-stop!


Feladva: 2016-10-12    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: HevederzárzárcserenonStopBudapestHevederzárakkínaizárszervizjavításajtóáronlakatosajtókraműanyagjavításagaranciávalmindigminőségiadunkgaranciát

Forrás: pepitahirdeto.multiapro.com

Hegesztő minősítő tanfolyamok indulnak a hét minden napján. A tanfolyamra jelentkezéshez ELŐKÉPZETTSÉG nem szükséges! Az MSZ EN ISO 9606-1 szabvány szerint lehetőség van magyar illetve német (TÜV) vizsga megszerzésére is. A magyar vizsgákhoz a Magyar Hegesztőminősítő Testület operatív szervezete az MHtE, a német vizsgákhoz a TÜV Rheinland Intercert Kft. biztosítja a vizsgabiztost. Kérésre egyszerre egy vizsgadarab meghegesztésével két bizonyítvány szerezhető, MSz és DIN szerinti is!


Feladva: 2016-01-10    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: tanfolyamokHegesztőnapmindenminősítőhétegyBudapestminősítésselWeldcontrolTÜVszerintszabványszükséges9606nem287ELŐKÉPZETTSÉGindulnak

Forrás: pepitahirdeto.multiapro.com

Konyhát, nappalit, teraszt, fürdőszobát újítana fel, de nem tudja, hogy hogyan kezdjen bele? Látogasson el bemutatótermünkbe és tekintse meg a folyamatosan frissülő termékválasztékunkat. Szakképzett eladóink minden kérdésére válaszolnak és segítenek a termékek válogatásában. A kb. 6000 féle burkolóanyag mellett zuhanykabint, hidromasszázskádat, infraszaunát is nézhet nálunk. Ha készül a felújításra, jöjjön el hozzánk és ne féljen tőlünk segítséget kérni. Kattintson az oldalunkra, ... további részletek >>

vagy hívjon telefonon!


Feladva: 2017-12-05    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: nálunktermékválasztékunkathozzánktudjaféleHirdetőfrissülőjöjjönnem6000PepitatelefononfolyamatosanfelújításrafelválogatásábanVásároljonhívjonmeg

Forrás: pepitahirdeto.multiapro.com

Indiánt, ezt a végtelenül kedves,2 év körüli,közepes nagyságú kan kutyát,az utcára kidobva találták csont soványan.Nem tudták hova tenni,ezért most a kutya, egy vidéki gyepmesteri telepen várja megmentője sürgős jelentkezését! Bekerülésük után 14 nappal a törvények szerint ”elaltathatóak”,örök álomra küldhetők, vagy új gazdinak örökbe adhatók, ha az eredeti gazda nem jelentkezik érte! A gazda által leadott kutya,helyhiány esetén azonnal ”altatható”! Fogadd örökbe, mentsd ... további részletek >>

meg!A kötelező oltás és chip árát és az ivartalanítás árát is a jövendőbeli gazdinak kell kifizetnie. Indiánnak olyan gazdát keresünk,Aki a fajtát ismeri,elő és utó kontrollal,kapcsolat tartással,IVARTALANÍTVA,örökbe fogadási szerződéssel lehet elvinni! Érdeklődni lehet: 06 70/325-2625, ha foglalt légy türelmes,vagy hagyj üzenetet! Visszahív. A GYEPMESTERI TELEP MEGTELT!!! Gazdik,vagy ideiglenes befogadók jelentkezése NAGYON SÜRGŐS lenne!!!


Feladva: 2018-01-07    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8221örökbevagykeresünkIVARTALANÍTVAgazdaIndiánnaknemgazdinaklehetGYEPMESTERIárátSÜRGŐSkutyaÓzdNAGYONörökhagyjoltásvidékileadottutcáraegy

Forrás: pepitahirdeto.multiapro.com

Törökbálinton a Depóba raktári takarítási munkára keresünk főállású takarítókat délelőttre, illetve délutánra egyaránt (reggel 6 és délután 18 óra között elosztva 2 x 8 órában átfedéssel). Feladatok: kézi és gépi takarítás egy szép igényes rendezett raktárban. Napi 8 órás munkaidő hétfőtől péntekig, a hétvégék szabadok. Elsősorban férfi alkalmazottat keresnénk, de minden megoldásra nyitottak vagyunk. Jelentkezni telefonon a 20/9-268-790-es számon, illetve önéletrajz küldésével lehet, ... további részletek >>

fizetési igény megjelölésével.


Feladva: 2017-05-29    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: illetveküldésévelátfedésselmindenállásúNapiállásönéletrajzórábankeresnénkkeresünkraktárbantakarítóelosztvaalkalmazottatmunkárarendezettszámon790

Forrás: pepitahirdeto.multiapro.com

Több mint 10 éve foglalkozunk PIANÍNÓ és ZONGORA szállítással. Szállítóink profi, gyakorlott szakemberek! Vállaljuk magánszemélyek, és cégek PIANÍNÓ és ZONGORA szállítását, alkalmanként, vagy rendszeres időközönként is! Továbbá vállaljuk Cégek és Magánszemélyek Költöztetését Budapesten és Vidéken egyaránt! Pianínó Szállítás, Költöztetés Budapest, Szállítás, Lomtalanítás, Költöztetés kalkulátor, Költöztetés olcsón a PianinoSzallitas.eu weboldalon AKCIÓS ÁRAKON!


Feladva: 2016-03-11    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KöltöztetésPianinóMagánszemélyekCégekvállaljukSzállításBudapestZONGORAPianínószállításolcsóngyakorlottprofikalkulátorSzállítóinkLomtalanításTovábbá

Forrás: pepitahirdeto.multiapro.com

Szobafestésre, felújításra készül? Polisztirol hab lécek, stukkók, díszítőelemek. A könnyű hablécek és mennyezeti díszítőlécek segítségével szép mennyezetet tud kialakítani. Rozetták, álmennyezeti lapok, festhető 3 dimenziós dekorlapok nagy választékban. Kültéri díszlécek között keretező lécek, párkánylécek, osztólécek, szintelválasztók natúr vagy kéregerősített felülettel. Egyedi stukkók gyártásával is felkeresheti cégünket!


Feladva: 2017-10-27    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: PolisztirolKültérilécekstukkókEgyedidíszlécekbeltéritudfelülettelkészülmennyezetetkéregerősítettfelújításraválasztékbanszépvagySzobafestésrenagy

Forrás: pepitahirdeto.multiapro.com

Egy lépéssel a betörők előtt! Bízza profikra otthona védelmét! Megbízható, pontos, referenciákkal rendelkező cég! Riasztó- és kamerarendszerek, távfelügyelet a legjobb árakon, Budapesten és Pest megyében! Kérje kollégánk segítségét: 06 20 452 2727 Írjon emailt, visszahívjuk!


Feladva: 2012-10-02    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: PestBudapestenvisszahívjukrendelkezőmegyébenemailtpontoskamerákÍrjonreferenciákkalriasztóksegítségétMegbízhatóAkcióskollégánkvédelmétmegyébenKérje

Forrás: pepitahirdeto.multiapro.com

A Penda 1997. februárjában a Betéti Társaság-ból Kft.-vé alakult, mely a mai napig is 100%-ban magyar tulajdonban van. A vállalat immár 20 éve a termelőeszköz forgalmazók és felhasználók igényeinek kielégítésére törekszik. Húzó termékeink: rendsodrók, szárzúzók, ekék, traktorok, rendkezelők, kaszák, bálázók, pótkocsik, permetező gépek, vetőgépek. Négy telephelyen, Békéscsabán, Kecskeméten, Kiskunmajsán és Nagykőrösön szerződéses partnereink raktározzák és adják ki áruinkat.


Feladva: 2017-08-31    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: PendaKftekékszárzúzókrendsodrókáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetétitörekszik

Forrás: pepitahirdeto.multiapro.com

AZOKNAK AKIK NEM AKARNAK ELŐRE BEFEKTETNI!!!! Csatlakozz hozzánk. Teendőd ingyenesen beregisztrálni és saját linkeden ingyenes tagokat gyűjteni. Miből lesz a pénzed?? Ha ügyesen dolgozol, gyűjtöd az ingyenes tagjaid, valaki a felső vonalból be fogja aktiválni az irodád, magyarul elindítja a te üzleti vállalkozásod. Ahogy érkezik irodádba a jutalékod, eldöntheted, fejleszted tovább, vagy megelégszel azzal a plusz jövedelemmel amit így fogsz elérni. A felső vonal nem csak téged fog ... további részletek >>

aktiválni, hanem azokat az ingyenes tagjaid is, akik szintén gyűjtik saját tagjaikat. Itt nem kell kattintgatni, videót nézni!! Semmi más dolgod nincs, mint ingyenes tagokat csatlakoztass. A regisztrációhoz szükséges adatokat emailben küldjed meg nekem! Teljes név, az üzletben használni kívánt felhasználó név, email cím, jelszó, Facebookos elérhetőséged.


Feladva: 2017-09-29    [Pénzkeresés - MLM]

Címkék, kulcsszavak: ingyenesnemaktiválnitagokatüzletinévsajátFelsőakiktagjaidkattintgatniérkezikKálváriaFacebookoshanemdolgozolRegisztráciohózjövedelemmelCsatlakozz

Forrás: pepitahirdeto.multiapro.com

10 éve működő tánc tanfolyam várja új kis tanítványait! 4-14 éveseknek. Helyszínek: XVI. kerület (Erzsébetligeti Színház, és Mltc Sportklub. XIV. kerületi Németh I. Ált.Isk. Korosztály szerint több csoportban: balett alapok, táncelőkészítő gimnasztika, videoklip táncok,divattáncok, színpadi show táncok, musicalek ... Fellépések, nyári napközis tánctábor. 5200 Ft/hó.


Feladva: 2017-02-17    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: kistánctáncokXVIvideoklipNémeth5200tanítványaitgimnasztikakerületitánctábortáncelőkészítőXIVnapközisvárjaalapokSportklubnyáritanfolyambalett

Forrás: pepitahirdeto.multiapro.com

MI AZ AGYKONTROLL? A Stanford-i egyetem kutatói szerint elménk adta képességeinknek csupán mintegy 2%-át használjuk ki. A Silva-féle agykontroll egy tudományosan megalapozott, egyszerű, praktikus, könnyen elsajátítható önfejlesztő módszer, ami lehetővé teszi, hogy ennél lényegesen nagyobb mértékben használjuk ki istenadta lehetőségeinket, s így sikeresebben oldjunk meg mindenfajta problémát. Egyik fontos eszköze a relaxáció avagy lazítás, ami egyúttal a bizonyítottan megbetegítő hatású ... további részletek >>

stresszt is levezeti. Az agykontroll nem vallás. Ateista ember ugyanúgy megtanulhatja elméje hatékonyabb használatát, mint az istenhívő, ahogy világnézetétől függetlenül mindenki megtanulhat például úszni is. Az agykontroll nem mágia, hanem elménk sokak által ma még kevéssé ismert, s emiatt kevéssé kiaknázott képességeinek okos – tehát nem kishitű és nem is fanatikus – használata, ami kiegészíti a cél elérése érdekében tett cselekedeteinket! Jelszavunk: egyensúly. MIRE JÓ AZ AGYKONTROLL? – A stressz levezetésére, – alvászavar megszüntetésére, – ébresztőóra nélküli, időzített ébredésre, – élénkítőszer nélküli felfrissülésre (például autóvezetéskor), – a fejfások 90%-ának és a migrénnek gyógyszer nélküli elmulasztására, – a minket foglalkoztató kérdések – bölcsebb tudatalattink és az „összemberi tudás”* bevonásával történő – megválaszolására, – a memória fejlesztésére, – gyorsabb és hatékonyabb tanulásra, – a jó döntéshozatal megkönnyítésére, – céljaink elérésére (magunk és szeretteink gyógyulását is beleértve), – a fájdalom és a vérzés gyors uralására, – szokásaink (pl. dohányzás, alkoholizálás, túlzott evés, lustaság, rendetlenség) akaraterő és kínlódás nélküli megváltoztatására, – gyerekeink és felnőtt szeretteink szavak nélküli megsegítésére, – a misztikusnak hitt, ám valójában természetes és hasznos intuíció avagy megérzőképesség rendkívüli fokozására. Tudományosan is bizonyított tény, hogy az emberi elmék között láthatatlan szálakkal kapcsolat van. Az egyes emberek tudása így bizonyos értelemben „összemberi tudássá” válik. Többnyire ez magyarázza, hogy felfedezők, feltalálók sokszor egyszerre álltak és állnak elő azonos ötletekkel. Nem véletlenül mondja hát a módszerről a világhírű amerikai orvos, dr. Clancy D. McKenzie: „Ha valaki megtapasztalja az eredményeket, amiket ezen a tudatszinten el lehet érni, akkor a későbbiekben már meg se kísérel ennek használata nélkül fontos döntéseket hozni vagy problémákat megoldani.”


Feladva: 2016-10-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 8211AGYKONTROLLnemnélküli8222amiméghogy8221kevésséhasználjukhatékonyabbfontoshasználatapéldáulMIREtudományosanszeretteinkelménkígyavagyának

Forrás: pepitahirdeto.multiapro.com

Honlap készítés Bemutatkozó honlap készítés Az internetes jelenlét egy cég számára elengedhetetlen manapság. Miért ne használná ki ezt a lehetőséget, aminek segítségével még több ügyfelet szerezhet? A bemutatkozó honlap potenciális lehetőséget ad, hogy vállalkozása jelen legyen az internet világában, így bárki számára megismerhető és elérhető lesz. A bemutatkozó honlap célja az, hogy minél többet megtudjon az érdeklődő a cégéről és tevékenységéről. A honlapnak a legfőbb célja hogy ... további részletek >>

meggyőzze a látogatókat arról, hogy valós megoldásokat találhat Önnél. A honlap elkészítési ára 40.000 Ft Ha nincs még tárhelye és domain neve, akkor intézzük teljeskörűen az igénylést és a regisztrációt. Ennek költsége bruttó 15.000 Ft / év. Mit tartalmaz a szolgáltatás? Képernyőhöz igazodó honlapot - responsív nézet Egy főoldalt max. 3-4 aloldalt – bemutatkozásnak, termék és szolgáltatás ismertetéséhez kapcsolati oldalt űrlappal galériát MIÉRT ÉRDEMES NÁLUNK TERVEZTETNI ANYAGAIT? Több, mint 15 éve tervezünk a hazai és a külföldi ügyfeleinknek. Precíz és kimagasló minőségű munkák kerülnek ki a kezünkből. Tervezésünk változatos és letisztult stílusú. Szakmai fejlődésünk folyamatos. Érdeklődni: info@emblemakeszites.hu címen


Feladva: 2018-01-02    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: honlaphogybemutatkozókészítésTöbbszámáraszolgáltatás000MIÉRTmégEgylehetőségetcéljacímenismertetéséhezszerezhetkerülnekhonlapothonlapnakÖnnél

Forrás: pepitahirdeto.multiapro.com

Sziasztok, ki szeretne otthonról: 🔸suli 🔸gyed 🔸gyes vagy 🔸meló mellett is akár egy kis plusz pénzt keresni? Ha elmúltál 18 éves, akár fő vagy mellékállásban is dolgozhatsz, saját időbeosztásoddal, azonnali jutalékkal! Te döntöd el mikor, honnan és mennyit dolgozol.   Nincs semmi másra szükséged csak egy okostelora vagy egy laptopra és internetre. Teljesen ingyenes! Én ezt teszem és te? Ha érdekel, írj privát, és küldöm a részleteket! ... további részletek >>

Nekem bejött!


Feladva: 2017-10-17    [Pénzkeresés - MLM]

Címkék, kulcsszavak: 128312vagyegyakárTeljesen12288DolgozzbejöttmellékállásbaninternetregyesdolgozolNekemlaptopragyedmennyitrészleteketévessulihonnanküldömmikor

Forrás: pepitahirdeto.multiapro.com

-550L-es alsó kifolyású, raklapra szerelhető rozsdamentes tartály -kb 400 db/perc teljesítményű gravitációs levező -4,5m3-es rozsdamentes tartályok -2 m3-es rozsdamentes tartály -rozsdamentes konténerek -pedálos zacskó záró gép -vibrációs rázók - 2 db 3m-es csigás felhordó -rozsdamentes szállítószalagok talpaslánccal: -2,5m-es -7,5m-es -3m-es -3,8m-es -3,5m-es


Feladva: 2013-09-02    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: rozsdamentesszállítószalagoktartálytartályokgépektalpaslánccalkonténerekkifolyásúalsó550Lfelhordó5m3Kongépcsigáslevezősavállórázókgravitációsgép

Forrás: pepitahirdeto.multiapro.com

VÁRPALOTÁN 24.690 m2-es teleken 1.243 m2 összes beépítettségű raktárcsarnok, telephely eladó. A bruttó 1.400 m2-es raktárcsarnok épületen belül van 213 m2 iroda. 8 szintbeli ipari kapu biztosítja az árumozgatást. A területen gépjármű parkolás lehetséges. Parkolóhelyek száma 40 db. Kiemelt befektetési érvek: - Kiváló lokáció, közel a 8-as főúthoz - Tehergépkocsival megközelíthető - További fejlesztési lehetőségek a telek méretéből adódóan Ár: 100,- millió Ft+Áfa


Feladva: 2017-01-07    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: raktárcsarnokVÁRPALOTÁNeladógépjárműmillióépületenközelterületen100lokációVárpalotaárumozgatástadódóan400KiválóFerencbiztosítjaméretébőlbruttó

Forrás: pepitahirdeto.multiapro.com

Nálunk megtalálod álmaid ruháját, vagy kedvenc nadrágodat.. Netán a varrogatáshoz nélkülözhetetlen cipzárat és gumit. Éjjel-nappal nyitva vagyunk, de azért ne telefonálj, csak illendő időben... E-mailt viszont bármikor küldhetsz: in fo@ionixdivat.hu Nézd meg - válaszd ki - rendeld meg - vedd fel!!


Feladva: 2016-04-24    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: megvagymegtalálodviszontcsinosgumitNálunkmailtEgycipzáratfelWEBÁRUHÁZidőbennélkülözhetetlenveddDIVATillendővarrogatáshozIONIXcsaknetánazért

Forrás: pepitahirdeto.multiapro.com

A legnèpszerűbb eladható tudàs a jobb agyfèltekès rajzolàs. Legyen ön is az Imre Dezső módszer akreditàlt kèpviselője. Akciós àr ötszàzezer Ft. Elvègezhető intenzív egy èv, vagy kèt èv alatt. Online konzultàciós lehetősèg tàvoktatàssal is.


Feladva: 2017-05-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 232224eladhatóegyImressaloktatóintenzívLegyentudásgezhetőrajzolvoktatlegnépszerűbbElvltekzezeragyflehetősötszjobbciósAkcióstudkonzult

Forrás: pepitahirdeto.multiapro.com

Rövid időre, néhány napra (de akár egy napra is) kiadó egy kellemes, barátságos, világos, felszerelt, önálló lakás az Örs vezér tere szomszédságában. Remek közlekedés, kiváló infrasrtruktúra, biztonságos környék. Csendes, kultúrált, intelligens vendégeket várunk. Mintha otthon lenne!


Feladva: 2018-01-09    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: BeatleegynapralakásidőrekörnyékönállóRövidbiztonságosfelszereltBudapestinfrasrtruktúravilágoslenneAndraskiválóbarátságosotthonközlekedésMintha

Forrás: pepitahirdeto.multiapro.com

Olcsó árak! Huawei Mate, Honor, Asus Zenfone, Asus Pegasus, Lenovo A, Lenovo Vibe, LeTv Le Eco, Mezu M, UleFone, UMI, Vernee Thor, Vernee Apollo, VKworld T1, VKworld G1, VKworld T3, Xiaomi Note, Xiaomi Redmi, Xiaomi MI. Minden egy helyen, minden a legjobb helyen.


Feladva: 2017-11-07    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: XiaomiVKworldLenovoAsusVerneemindenhelyenárakegyEcoOlcsóLeTvajánlásRedmiVibeHirdetőNotePepitaPegasusmobilApolloKínaiZenfoneThorHonor

Forrás: pepitahirdeto.multiapro.com

Profi weboldal készítés olcsón, garanciával.


Feladva: 2016-12-18    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: ProfikészítésweboldalBudapestKftBridgeDiamondgaranciávalolcsón

Forrás: pepitahirdeto.multiapro.com

5 Féle Napkristály ital egy dobozban - 5 x 500ml - 5 Napos Bioflavonoid program - Kibővített összetétel - A legkorszerűbb nanotechnológia - Új vonzó íz, kellemes a gyomor számára. A flavonoidok a szervezet antioxidáns kapacitását növelik, amely képes csökkenteni a szabadgyökök sejteket romboló hatását. Támogatják a védekező rendszer optimális működését. A vörösszőlő segíti az érrendszer optimális működését, javítja a keringést. Antioxidáns tulajdonsága révén, segíthet megvédeni a bőrt is...


Feladva: 2015-11-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: optimálisitalNapkristályAntioxidánsműködésétszabadgyökökvonzócsökkenteniszabananotechnológiaérrendszerképesbőrtlegkorszerűbbsegítiFéleamelyVali

Forrás: pepitahirdeto.multiapro.com

Balatonföldvár, Neptun apartmanházban klimatizált apartman eladó. Szauna, úszómedence használat az árban, Balatonpart kb. 150 méter. Eredeti ár: 13.7 MFt.


Feladva: 2017-05-07    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóapartmanNeptunBalatonföldvárúszómedenceSzaunaklimatizáltIrányárapartmanházbanméter150BalatonpartüdülőárbanBalatonihasználat

Forrás: pepitahirdeto.multiapro.com

Az igazi kárpitozott autós ágy, fülkével, kormánnyal, matraccal. Egyedi kivitelezés személyre szabott forma. Uniós formatervi védelem alatt. Könnyen átalakítható. Minden felületen puha szivacs, melyen választható a kárpit bevonat. - Traktor autós ágy - Vonat autós ágy - Pick-up autós ágy - Dömper autós ágy - Tolólapos autós ágy www.atalakulok.hu/autosagyak


Feladva: 2017-10-23    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: ágyautóskivitelezésDömperMindenEgyediPickátalakíthatómatraccalVonatKönnyenkormánnyalTraktoralattfülkévelbevonatvédelemkárpitozottkárpitigazi

Forrás: pepitahirdeto.multiapro.com

L-Recapin® Hajsampon: Bőrgyógyászatilag tesztelt hatóanyag kombináció, kíméletesen ápol! Ha rendszeresen használjuk az L-Recapin Hajtonikkal kombinálva, segít visszaállítani a haj és a fejbőr egészséges állapotát. L-Recapin® Hajtonik: Megállítja az örökletes hajhullást! Hajmosás után vigyük fel a nedves fejbőrre és körkörös mozdulatokkal masszírozzuk be! Csak mindkét termék rendszeres és tartós használatával érhetjük el a kívánt hatást! L-Recapin hajápolócsalád!


Feladva: 2016-05-10    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: RecapinHajtonikegészségeshasználatávalkombinációfelfejbőrtartóshatóanyagvigyükhajrendszeresteszteltutánvisszaállítanitermékbőrgyógyászatilagsegít

Forrás: pepitahirdeto.multiapro.com

Nyilván keresett, hiszen ha valaki valamit keres az interneten, akkor ahhoz a döntő többséghez tartozik akik a Google-val keresnek... Európában az emberek 97%-a! Érthető, hogy akik érdekeltek az internetes kereskedelemben, vagy egyéb értékes információk megjelentetésében, azok tesznek azért, hogy a különböző szavak, kifejezések keresésénél előlelő helyen legyenek a találatok között... És ha már megjelennének a keresés begépelése közben, az még előrébb helyezné őket? Hát persze! ... további részletek >>

Sokaknak sokkal vonzóbb a kattintási lehetőség képes ajánlatra, még ha a keresés közbeni legördülő Google ajánláson jelenik is meg! Nálunk elérhető ez a szolgáltatás... Lehet bármilyen tetszőleges internetes tartalomra mutató link: - weboldalak bármely oldala - közösségi oldal nyilvános tartalma (Facebook, Google+, Twitter, stb...) - webcímmel rendelkező PDF fájl Mivel a Pepita Hirdető keresője - kevés kivétellel - minden webhelyünkön megtalálható, ezért jóval több, mint egy hirdetés... Alább az Írjon nekünk! menü linkje látható, ha érdekelné... www.pepitahirdeto.multiapro.com/apro.php?page_id=21471


Feladva: 2017-06-12    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: GooglemegvalamitinternetesHirdetőkeresettPepitakereséshogyakikmárkivételleljeleniktesznekTwitterSokaknakemberekAlábbmutatótalálatokkevésHát

Forrás: pepitahirdeto.multiapro.com

Hatékony nyelvtanulás kezdőknek és újrakezdőknek. Közérthető nyelvtani leírások, érthető magyarázatokkal. Az otthoni tanulás segítője.


Feladva: 2017-09-12    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nyelvtanulásHatékonymagyarázatokkalérthetőleírásoknyelvtaniKözérthetőújrakezdőknekkezdőkneksegítőjetanulásIstvánotthoniotthon

Forrás: pepitahirdeto.multiapro.com

Gázkészülékek, Eladás, Gázkészülék Alkatrész, Gorenje, Vendéglátóipari Gép, Hőtárolós Kályha, Gázkészülék, Klímatechnika, Klímaberendezés, Pelgrim, Elekthermax, Nagykonyhai Gép, Konyhafelszerelések, Javítás, Szerviz, Ipari Fűtéstechnika, Pelgrim Klíma, Teka, Háztartási Gép.


Feladva: 2014-02-07    [Lakossági szolgáltatás]

Címkék, kulcsszavak: PelgrimSzervizGépXIVCímGázkészülék4009Iparitől4000470TelŐrnagyKlímaberendezésTekaKlímatechnikaKlímaemaxKályhahttpFűtéstechnikaHőtárolós

Forrás: pepitahirdeto.multiapro.com

Minőségi divatos ékszerek karórák a Lili Ékszer Webáruházban hatalmas kedvezménnyel


Feladva: 2017-12-03    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: hatalmasÉkszerLilikedvezményekkelkedvezménnyelDivatékszerekWebáruházbankarórákékszerekdivatosMinőségiWEBÁRUHÁZ

Forrás: pepitahirdeto.multiapro.com

A projekt alap célkitűzése az volt, hogy egy olyan agrár online piacteret hozzunk létre, amely a mai magyar piacon egyedülálló funkcionalitással rendelkezik. Ennek köszönhetően az agráriumban tevékenykedő gazdák a számukra érdekes termékeket és szolgáltatásokat egy helyen, a lehető legrövidebb idő és energia ráfordítás mellett tudják megtalálni és a beszerzéseiket elindítani. Ezen a webes felületen informálódhatnak az aktuális pályázatokról, a szakmai programokról és a szakmai kiállításokról. A ... további részletek >>

gépek, az eszközök, az alkatrészek, a tápanyagok, a növényvédelmi és állattartási eljárások innovációiról, az oldalunkon található videók megtekintése útján informálódhatnak a gazdák. Honlapunkat a gazdáknak készítettük, de a gazdákkal együtt szeretnénk egy igazán jól használható, modern és innovatív agrár online piactérré formálni. A jövőben is a látogatók felmerülő igényei alapján fejlesztjük tovább. A folyamatos megújulni akarás visz minket előre.


Feladva: 2017-11-07    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: KftPendaszárzúzókrendsodrókekékimmárNégyáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetéti

Forrás: pepitahirdeto.multiapro.com

Magas nedvszívó hatással rendelkező 130 gr-os felmosófej, zöld-fehér színben. Összetételének köszönhetően kevesebb vegyszert igényel, mégis könnyedén megbirkózik a szennyeződésekkel. Takarékos egyben hatásos is. www.szympyhygi.hu/micromix-zold-fe her-felmosofej-130g-t446987


Feladva: 2017-04-16    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: feherzoldmicromixfelmosófej130ghatássalmégisnedvszívóigényelMagasvegyszertajánlószympyhygikevesebbHirdetőwwwköszönhetőenPepitahatásosegyben

Forrás: pepitahirdeto.multiapro.com

A zöldárpa hatása annak köszönhető, hogy a legfontosabb tápanyagokat ideális arányban tartalmazza. Összetevői szinte azonnal felszívódnak a szervezetben, azaz rögtön hasznosulni tudnak. Az árpafű a Föld talán legegészségesebb növénye, amit nagyon ajánlott fogyasztani azoknak is, akik plusz kilóktól szeretnének megszabadulni. Mivel benne minden létfontosságú tápanyag megtalálható, a diétázók úgy táplálhatják szervezetüket, hogy közben egyetlen felesleges kalóriát sem visznek be! Nagyszerű ... további részletek >>

gyulladáscsökkentő és vérképzéshez is kitűnő. Mire jó a zöldárpa por? Még többet megtudhat róla weboldalunkon! www.zoldarpa.buzafule.net/zoldarpa


Feladva: 2017-12-07    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: zöldárpahatásahogyÖsszetevőiköszönhetőmindenpornagyonszervezetbenegyetlenannakbenneamitfelszívódnakközbenMivelMirenövényeazonnalKittikitűnő

Forrás: pepitahirdeto.multiapro.com

Röviden és kivonatosan... Ez a piackutató cég időnként küld Neked egy végtelenül egyszerű kérdőívet... 10 perc alatt megválaszolható az összes kérdés! És még arra is fizet, ha frissíted a körülményeidet, alapadataidat! Nekem bevált, az összegyűlt pénzem mindig megérkezett 3 napon belül!


Feladva: 2013-03-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: NekedmégcégbellkérdéspiackutatónaponsszeskivonatosanmegérkezettmegválaszolhatóRvidenmindigalattPénzpénzempercválaszodsszegyűltkérdőívetbevált

Forrás: pepitahirdeto.multiapro.com

Angol - igény szerint, minden szinten: - nyelvoktatás, korrepetálás, kiegészítő tanítás, - szintentartás, felzárkóztatás, - felvételire, nyelvvizsgára, érettségire, állásinterjúra, pótvizsgára, osztályozó vizsgára felkészítés, - tanulócsoportok mentorálása, konzultáció, - fordítás, - online tolmácsolás (előre egyeztetett idópontban) - az angol nyelvhez és kultúrterülethez tartozó témában célirányos felkészítés Tanítási módszerem: részletes magyarázat, stabil elméleti ... további részletek >>

alapok, házi feladat, gyakorlatorientáltság Óradíj és Fizetés: tanóra: 2700 Ft/50 perc fordítás, tolmácsolás: megegyezés szerint fizetés módja: átutalással bankszámlára Számlaképes vagyok. Rugalmas időbeosztással várom a tanulni vágyókat! A rendszeresség az egyik legfontosabb a nyelvtanulás során. Elfoglalt vagy? Sok a dolgod? Nem probléma: a tanóra időtartama megegyezés alapján akár 20 perc is lehet (ennek megfelelő árral)!


Feladva: 2017-04-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: angoltanórafizetésszerinttolmácsolásfordításpercfelkészítésmegegyezésidőtartamaalapokkorrepetálásegyikkultúrterülethezmódjaosztályozóelméletistabil

Forrás: pepitahirdeto.multiapro.com

Ki az ön kedvenc STAR WARS szereplője? A jókhoz húz a szíve, mint Luke Skywalker, Anakin Skywalker, Obi-Wan Kenobi, Yoda, Han Solo, Leia Organa, Padmé Amidala, Jar Jar Binks, Csubakka, Qui-Gon Jinn, Poe Dameron, Finn (FN-2187) vagy Ray? Netán a droidokat - R2-D2, C-3Po és BB-8 - szereti? Esetleg a sötét oldalon álló Darth Wader, Kylo Ren, Darth Maul, Palpatine alias Darth Sidious, Dooku gróf / Darth Tyrannus, Grievous tábornok, vagy Jabba a kedvenc hőse? Böngésszen termékeink között, és találja ... további részletek >>

meg az Önnek vagy Star Wars rajongó családtagjának, barátjának leginkább megfelelő ajándékot. Csillagok háborúja - Star Wars Shop www.starwars.boltaneten.hu


Feladva: 2017-01-18    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: WarsStarDarthvagykedvencJarSkywalkerWebshopBinksstarwarsMaulObicsaládtagjánakNetánJabbahttpRenrajongóRaytábornokAmidalaShopKyloAnakin

Forrás: pepitahirdeto.multiapro.com

Mixerbeton bedolgozás meggyorsításához és könnyebbé tételéhez rendelhet nálunk betonszivattyút huszonhárom méteres gémhossztól egészen ötven méteresig, melyeket igény esetén meg is lehet hosszabbítani földre fektetett csövek összeszerelésével. Óradíjainkat megtalálja weboldalunkon mixerbeton árlistánkban!


Feladva: 2014-01-16    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: mixerbetonbetonarwwwlehetbetonszivattyútárlistánkbanmegnálunkeseténrendelhetweboldalunkonigénytételéhezmegtaláljamelyeketkönnyebbéÓradíjainkatötven

Forrás: pepitahirdeto.multiapro.com

Automata mosógépek, mosogatógépek, hűtőgépek, varrógépek, mikrosütők, porszívók és egyéb háztartási gépek helyszíni és szervizes javítása 1 év garanciával.


Feladva: 2015-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: FerencCsókajavításagépekháztartásiszervizeshpmosógépekhospitalszervizesAutomataelektrohelyszíniltpwwwMarcalváros840Győr350egyébTelporszívók

Forrás: pepitahirdeto.multiapro.com

A szilvalekvár akkor az igazi, ha cukor nélkül főzzük. Ez akár egy teljes napot is igénybe vehet, de megéri a fáradozást, hiszen nemcsak finom, de nagyon egészséges csemegét kapunk végeredményként. Az aszalt szilva és a szilva lekvár hatásai hasonlóan jók, sőt, ez a gyümölcs nyers és aszalt formában tartogatja a legtöbb előnyt az emberi szervezet számára. Felhasználhatjuk székrekedés és túlzott gázképződés, puffadás ellen, valamint általánosságban az emésztés javításához. Ugyanakkor segíti a ... további részletek >>

májműködést és az agyi tevékenységet is. A szilva fajták és hatásuk bővebben weboldalunkon!


Feladva: 2017-02-14    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: szilvalekváraszalthatásukvalamintvehetlegtöbbKittifajtákvégeredménykéntellenigénybetartogatjaKellérkapunkpuffadásnapotformábankészítésecsemegét

Forrás: pepitahirdeto.multiapro.com

Hogy miért? Regisztrációkor leadott első 100 PV pontot meghaladó rendelésnél a következő AJÁNDÉKOKBA részesül: - 1 doboz ganodermás müzli - 1 doboz ganodermás fogkrém - Ingyenes regisztrációs díj - Ingyenes kiszállítás Ezen ajándékok értéke: 11.660,- Ft Legyen törzsvásárlónk


Feladva: 2017-05-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: ganodermásdobozIngyenesfogkrémelsőtörzsvásárlóitörzsvásárlónkleadottExcelLegyenRegisztrációkorGano660müzlimiértregisztrálniértékerészesülHogy

Forrás: pepitahirdeto.multiapro.com

Jó minőségű külső és belső fa nyílászárók, harmonika-toló, emelő-toló, bukó-toló erkélyajtók, valamint egyedi méretre gyártott konyha-háló-fürdőszoba-ebédlő-gardr ób-gyerekszoba-nappali-iroda-üzleti bútorok közvetlenül a gyártótól! Kérem hívjon bizalommal! 0620/473-7816 Megnyílt Nyergesújfalun a Kossuth Lajos u. 70. alatt a GU-BKS viszonteladói boltja! Minden kedves vásárlót szeretettel várunk! Tel/Fax: 0633/355-111


Feladva: 2016-10-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: tolóharmonikaBKSajtóKéremhálóFaxnyílászárókalattgyártótólkonyha0633belsőLajosközvetlenülgyártottTelkülsőKossuthbútorokméretrevárunküzleti

Forrás: pepitahirdeto.multiapro.com

Szia! Szeretném a nyáron nagyon kedvelt automata váltós, klímás bérautóimat bemutatni. A www.plusautorent.hu oldalon Opel, Suzuki, Renault, Ford Cvt automatic bérautóim megtekinthetőek akár 30% mennyiségi kedvezménnyel kiadók, bérelhetők. Autókölcsönzéssel 1992-tõl foglalkozom. 100% megbízhatóság, 24 év tapasztalat az autókölcsönzésben. Bérautóimat kiszállítom a bérlőnek a címére. Tel: +3630 9488730 Hello! I would like the summer is very popular with automatic transmission, air ... további részletek >>

conditioned rent a car present. The www.plusautorent.hu page Opel, Suzuki, Renault, Ford CVT automatic rent a car viewed by up to 30% volume discount publishers hired. Car rental deal since 1992. 100% reliability, 24 years of experience in car rental. I rental cars deliver the address of the tenant. Tel: +3630 9488730 Rent a car in Hungary, Budapest Hallo! Ich möchte den Sommer sehr beliebt ist mit Automatik-Getriebe, Klimaanlage Mietwagen vorhanden. Die www.plusautorent.hu Seite Opel, Suzuki, Renault


Feladva: 2017-12-16    [Autó - Motor - Jármű]

Címkék, kulcsszavak: carthe245RenaultSuzukirentalOpelRentplusautorentautomaticwwwBudapestBérautóimat9488730CVT3630100FordTel1992tenantHellovorhandensince

Forrás: pepitahirdeto.multiapro.com

Nagyszabású lakóparki beruházások kivitelezéshez keresünk építőipari és építőipari kiegészítő-tevékenységet végző, tapasztalt alvállalkozókat, valamint szakipari munkákhoz vállalkozásokat, szakembereket a kisebb munkákhoz is. Ajánlati szám: VSZ/00160/16/07


Feladva: 2017-12-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: VSZmunkákhozépítőiparikeresünklakóparkiNagyszabásúalvállalkozókatkivitelezőt00160tapasztaltberuházáshozvégzőszámtevékenységetAjánlatikiegészítőkisebb

Forrás: pepitahirdeto.multiapro.com

A Fordított Ozmózis víztisztító berendezés a mosogató alá szerelhető, kis helyigényű. Közvetlen a hideg víz csapjához csatlakoztatjuk a többlépcsős szűrőberendezést. A beszerelése különös szakmai tudást nem igényel, a használati utasításokon leírtak alapján egyszerűen elvégezhető. A víztisztító berendezés csak a szabvány ivóvíz, a vízművek által kibocsájtott víz tisztítására alkalmas. A nem a vízhálózaton keresztül folyó szennyezett származású víz tisztítása nem végezhető el!


Feladva: 2015-06-25    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: víztisztítónemvízszakmaifolyókisberendezésszűrőrendszerkülönöskeresztülszerelhetőbeszerelésevízhálózatonaláelvégezhetőkszűrőberendezéstalkalmasBéla

Forrás: pepitahirdeto.multiapro.com

A vesekő diéta segítségével megelőzhető a kövek kialakulása. Egy kis odafigyeléssel könnyen kivitelezhető, hogy kevesebb sót fogyasszunk, együnk több zöldséget, gyümölcsöt, csökkentsük a kávéfogyasztást. Ha már kialakult, a vesekő eltávolítása lehetséges akár otthoni módszerekkel is. Ehhez használhatunk vízhajtó teákat vagy speciálisan összeállított teakeveréket. A népi orvoslásnak az egyik leghatékonyabb gyógynövénye a vesekő tünetei ellen a nyírfalevél, melynek teája megakadályozza a kő ... további részletek >>

kialakulását, de a meglévő követ is képes elmorzsolni. Gyors és biztonságos beavatkozás az endoszkópos kőeltávolítás, mely után a beteg gyorsan felépül.


Feladva: 2017-03-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vesekőeltávolításakövetgyümölcsötleghatékonyabbkisbetegEhhezmeglévőzöldségetegyikEgyutánmódszerekkelkialakulásáttöbborvoslásnakkialakulásamely

Forrás: pepitahirdeto.multiapro.com

Évente tízezernél több családot, egyént, közösséget, nélkülöző embertársunkat segít a Mátrix Közhasznú Alapítvány által működtetett Centerke Adományozó Központ. Cipőt, ruhát, használati tárgyakat, tartós élelmiszert, bútort, egyéb életminőséget segítő tárgyakat adunk támogatóink jóvoltából rászorulóknak ingyenesen. A Centerke Adományozó Központ Ön nélkül nem lenne ilyen sikeres! Támogatását, segítségét, felajánlásait a gyermekek és a családok védelméért hálás köszönettel fogadjuk! Adó 1 ... további részletek >>

százalékhoz adószám: 18472273-1-06


Feladva: 2017-07-12    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: tárgyakatCenterkeAdóAdományozóKözponthasználatiajánlórászorulóknakMátrixcsaládokHirdetőingyenesenKözhasznúvédelméérttartósPepitanélkülAlapítvány

Forrás: pepitahirdeto.multiapro.com

Kőműves-, ács-, lakatos-, térburkoló munkák, bontás, épületfelújítás, kertépítés, festés, mázolás Budapesten, Pest megyében. Dumitru György www.gisi.hu 06-30-538-2573


Feladva: 2016-07-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GyörgyDumitrugisibontáshttpvállalásamunkáktérburkolómegyébenlakatosPestácsBudapestenKőművesmázolásPilisvörösvárfestésházépítés2573kertépítés

Forrás: pepitahirdeto.multiapro.com

Vonz a film világa? Rendezői babérokra törsz? Csakis a Legjobbtól érdemes tanulnod! Szurdi Miklós ismert és elismert színész, rendező. Sokszínű életpályáját mutatja, hogy a Színházi Adattárban regisztrált bemutatóinak száma rendezőként 65 mű! Ne hagyd ki ezt a lehetőséget, hogy Nála sajátíthatod el a színház és filmrendezés alapjait! :) Olyan képzést keresel: - ahol elismert szakemberektől tanulhatod meg a szakmát? - ahol nem évekig tanulsz, mégis komoly tudásra tehetsz szert? - ... további részletek >>

ahol fontos kapcsolatokat építhetsz? - ahol gyakorlati oktatás is szerepel a tematikában? Minket keresel! :) Őszi akciónk keretein belül, most 50% kedvezménnyel vehetsz rész a kurzuson! Jelentkezz: www.starsofthefuture.hu/jelentkezes Le ne maradj róla! :) A Kurzusról itt olvashatsz többet: www.starsofthefuture.hu/szinhaz-es-filmrendezes-alapjai


Feladva: 2016-10-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: aholelismertSzurdifilmrendezesszínházstarsofthefuturewwwhttphogykereselszínésztehetszvilágaJelentkezzMinketrendezőkéntismerttudásrafilmkurzuson

Forrás: pepitahirdeto.multiapro.com

Kameradepo a Biztonsági kamerák és video megfigyelő rendszerek webáruháza. Megbízható, kipróbált infrás beltéri és kültéri kamerák, digitális rögzítők közvetlenül a forgalmazótól. Szerelésre előkészített komplett kamerarendszerek, melyeket csak fel kell szerelnie. Keressen minket: www.kameradepo.hu Tel: 06 20 569 8848 Kameradepo webáruház


Feladva: 2016-03-16    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: kamerákKameradepoBiztonságirendszerekKeressenközvetlenülmegfigyelőszerelnierögzítőkvideokelldigitálisfelwebáruházBudapestcsakkültériKftmelyeket

Forrás: pepitahirdeto.multiapro.com

Zeneszeretõ - Bakelit rajongók figyelmébe! Az Audió Design Studió hosszú évek óta foglalkozik hangrestaurálásal. A stúdió vállalja minden tipusú hanganyag rendbe hozatalát, archív hangzók feljavítását ujra masterelését. Bakelit lemezek, kazetták, professzionális szinten történõ átirása, zajmentesítése az az, a hangzó anyagok restaurálása, digitális technológiával úgy , hogy a kész anyag megegyezzen az eredeti hangzással. Ne hagyja, hogy kincsei kárba vesszenek!


Feladva: 2017-10-09    [Zene - Hangszer]

Címkék, kulcsszavak: stúdióDesignBakelithogy245anyagévektörténátjátszáshozatalátkészhosszúszintenhangjavításrendbeúgyprofesszionálisDigitalizálásvesszenekhanganyag

Forrás: pepitahirdeto.multiapro.com

MTZ-re és más gyártmányú traktorra! Hazai gyártású kiváló minőségű homlokrakodók kedvező áron, 25 - 200 LE–ig, szinte minden traktor típusra, szállítással, üzembe helyezéssel, rövid határidővel, készletről. BB. Junior 1.4 homlokrakodó: Emelőmagasság max.: 3,9 m. Terhelhetőség: 2500 kg. Emelőerő: 1800 kg. Felszereltség: - Traktor típus szerinti adaptációs alváz - Joystick vezérlés - Kihelyezett 3. hidraulikakör - Lengés csillapítás - Szállítás, üzembe helyezés ... további részletek >>


Feladva: 2015-11-09    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: homlokrakodóüzembeTraktorhelyezés200szerintiJuniorárontípuskészletrőlSzállításkedvezőhatáridővelcsillapításhomlokrakodókFelszereltségrövidLengés

Forrás: pepitahirdeto.multiapro.com

Ásvány ékszerek hihetetlen árakon nagyszerű kedvezményekkel akár 60% kedvezménnyel a Lili Bizsu webáruházban www.lilibizsu.hu Házhoz szállítás már 650 Ft-tól akár ingyenesen is


Feladva: 2017-10-29    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÁsványBizsuLiliakárnagyszerűmárárakonszállításhihetetlenHázhozékszereklilibizsuwwwWEBÁRUHÁZwebáruházbanolcsóniyeningyenesenékszertkedvezménnyel

Forrás: pepitahirdeto.multiapro.com

Megbízható vízszerelő dugulás megszüntetés csőtörés csepegések megszüntetése csapok szerelése új vízvezeték rendszerek telepítése, gyors szolgálati munkák a legolcsóbban a fővárosban és Pest megyében! Tel.:303286969


Feladva: 2017-02-12    [Lakossági szolgáltatás]

Címkék, kulcsszavak: csőtörésvízvezetékmegszüntetésefővárosbancsepegéseklegolcsóbbanmunkákmegszüntetésszolgálatidugulásgyorsvízszerelőtelepítéseMegbízhatórendszerekSándor

Forrás: pepitahirdeto.multiapro.com

Vendégházunk a szabad strandtól kb 50 méterre, a Kecskeméti utca végén található. Két hálóval és egy hálóként használt nappalival a ház 4-6 fő részére kínál partközeli szállást. A házban 2 háló, egy előszoba, két fürdő és felszerelt konyha található. Az udvarban bográcsozási, grillezési lehetőség. Parkolás a zárt udvaron. A házba kutya és egyéb háziállat díjtalanul hozható! Létszám és a foglalni kívánt időszak megjelölésével kérje ajánlatunkat.


Feladva: 2017-12-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: egyméterretalálhatóstrandtólszabadházkétkívánthálókéntParkolás