0.78 MultiApro.com hirdetések - Ingyen apróhirdetés, egyszerűen pár kattintással több apróhirdető oldalra
Nincs találat .... Nézze meg kiemelt hirdétéseinket.

Falmatrica, faltetoválás, faldekoráció webáruház. Olcsó falmatricák, óriási választék! Ha unod otthonod egyszínű, fantáziátlan falait...


Feladva: 2016-10-20    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falmatricashopwwwwebáruházfaldekorációfaltetoválásFalmatricaválasztékóriásifalmatricákOlcsó

Forrás: pepitahirdeto.multiapro.com

Gázkészülékek, Eladás, Gázkészülék Alkatrész, Gorenje, Vendéglátóipari Gép, Hőtárolós Kályha, Gázkészülék, Klímatechnika, Klímaberendezés, Pelgrim, Elekthermax, Nagykonyhai Gép, Konyhafelszerelések, Javítás, Szerviz, Ipari Fűtéstechnika, Pelgrim Klíma, Teka, Háztartási Gép.


Feladva: 2014-02-07    [Lakossági szolgáltatás]

Címkék, kulcsszavak: PelgrimSzervizGépXIVCímGázkészülék4009Iparitől4000470TelŐrnagyKlímaberendezésTekaKlímatechnikaKlímaemaxKályhahttpFűtéstechnikaHőtárolós

Forrás: pepitahirdeto.multiapro.com

Klíma javítás, klímatelepítés - akár hűtésre, akár fűtésre -, karbantartás (gázzal feltöltés, gombátlanítás, fertőtlenítés), áthelyezés garanciával!!! Klíma telepítés 4m csőhosszig nettó 43.000 Ft! Minőségi klímakészülékeink: Panasonic, Nord, Samsung, Midea, Fisher, Fujitsu, Daikin


Feladva: 2015-04-01    [Lakossági szolgáltatás]

Címkék, kulcsszavak: klimaakárgaranciávalKlímaszerelés000wwwnettóDaikincsőhosszighűtésreFujitsutelepítésklímatelepítésFisherjavításMideaáthelyezéstólSamsungNord

Forrás: pepitahirdeto.multiapro.com

Vállaljuk műanyag, illetve alumínium redőnyök javítását. GURTNICSERE SZÉKESFEHÉRVÁR ÉS KÖRNYÉKE. Műanyag ablakok, ajtók beállítása, javítása, törött vasalatok cseréje. Hőszigetelt üvegek cseréje műanyag szerkezetekben. HÉTVÉGÉN IS!


Feladva: 2016-05-08    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: műanyagSZÉKESFEHÉRVÁRcseréjebeállításaRedőnyszervizajtókFejérHÉTVÉGÉNablakokredőnyjavításszerkezetekbenKÖRNYÉKEajtóAblakGURTNICSEREüvegekjavítását

Forrás: pepitahirdeto.multiapro.com

Nyíregyházán két utcával határolt 4650 m2 telephely, építési teleknek is, az ukrán, román, szlovák határokhoz vezető 41-es főút 6-os km-nél eladó. A városközpont 4 km, az M3-as autópálya 1 km, a határok 50-100 km távolságra vannak. Sok célra alkalmasan, lekövezve, bekerítve, közművesítve, tetszés szerint oszthatóan. 63 m széles. A telek előtt 23 ezer gépjármű megy el naponta.


Feladva: 2017-05-03    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 245251bekerítvenélgépjármutcávallekövezvevezetezerkétalkalmasanhatárokhozNyíregyházáncélraszlováktelekNyíregyházaSokrománszélesJános100

Forrás: pepitahirdeto.multiapro.com

Pop Socket?! Ismered? Van már neked is? Szeretnél egyet? Szerezd meg most! www.techdiszkont.superwebaruhaz.hu /pop-socket-ii-kategoria-t502793


Feladva: 2017-11-16    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: socketpoptechdiszkontmárVansuperwebaruhazIsmeredTRENDhttpmostmegSzerezdegyett502793Szeretnélkategorianeked

Forrás: pepitahirdeto.multiapro.com

Egyedi ajándék a legjobb áron‎ Rendeld meg a legszebb névre szóló ajándékot szerettednek!


Feladva: 2017-09-24    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: szólónévreáronlegjobbajándékszerettednekEgyediajándékotajánlóHirdetőPepitalegszebbékszerekmegRendeld8206

Forrás: pepitahirdeto.multiapro.com

A zöld teát nem ok nélkül hívják fiatalságmegőrző szérumnak, főleg az antioxidáns hatása miatt kapta ezt a becenevet. Nem mindenki szereti azonban az ízét, vagy csak nincs idejük a tea megfelelő lefőzésére. A sűrű fogyasztása továbbá terheli a vesét, valamint kiöblíti a szervezetből a káliumot és a mikroelemeket. Ebből az okból kifolyólag készítettük elő az ilyen alapú egyedülálló étrend-kiegészítőt. Lehetővé válik ezáltal a szérum jótékony egészségügyi hatásának teljes mértékű kihasználása. ... további részletek >>

leküzdi a szabadgyököket. segíti a rák megelőzését segíti a méreganyagok eltávolítását segíti a fogyást, valamint a megfelelő testsúly megtartását elűzi a fáradtságérzetet, élénkítve és stimulálva a szervezetet. könnyíti a koncentrációt. csökkenti a szívinfarktus és a keringési zavarok kockázatát könnyíti az emésztést fékezi az öregedéssel kapcsolatos folyamatokat támogatja az immunrendszert a vírusok leküzdésében.


Feladva: 2018-02-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: segítiNemkönnyítiteazöldmegfelelővalaminthatásánakízétfolyamatokatilyenfőlegkoncentrációtterheliBartalusegészségügyiazonbankapcsolatoselőszérum

Forrás: pepitahirdeto.multiapro.com
ÚJDONSÁG!!!  ELEKTROMOS CIGARETTATÖLTŐGÉP <br>1 doboz cigaretta pár perc alatt!!!<br>0630 582-7297
Homefashion.hu  Bútor ,Textil, Dekoráció
Függönyvarrás olcsón Budapesten
Hirdessen itt >>
Adatvédelmi nyilatkozat
04_053149
..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

Problémás a matek? Tanulj a ”Rendhagyó matek” sorozat könyveiből! Szeretsz gondolkodni, logikai feladatokat megoldani? Rengeteg feladatot találsz megoldásokkal a ”Gondolkodj!” című könyvben. Esetleg a természetbe vágysz? Szívesen olvasnál túraleírást, érdekel a Kéktúra? Akkor olvasd el a ”69 nap alatt Magyarország körül” című kiadványt. A megadott honlapon valamennyi könyvbe bele is olvashatsz.


Feladva: 2015-10-21    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: 8221matekcíműEsetlegbeleSzeretsznapkönyvbenkönyvbekönyveibőlolvasdGondolkodjvalamennyisorozatAkkormegoldásokkalhonlaponKéktúratalálszmegadott

Forrás: pepitahirdeto.multiapro.com

Mobiltelefon tartozékok kiegészítők széles választékban...


Feladva: 2017-11-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: kiegészítőktartozékokMobiltelefonGyörgyBotkaoázistartozékGSMbutikválasztékbanszéles

Forrás: pepitahirdeto.multiapro.com

Cégünk, a SkandiVisual egy építészeti és látványtervezési kreatív stúdió. 3D Illusztrációinkkal mindig az egyediségre, és különlegességre törekszünk, mert hiszünk abban, hogy egy jó ötlet megérdemli a megfelelő előadásmódot. Különböző módokon segíthetjük a projektek marketingjét: fotórealisztikus építészeti látványtervek, belsőépítészeti látványtervek, körpanoráma készítés, fotómontázs, 3D illusztráció alaprajzokhoz, 3D modellezés 2D rajzok alapján, családi ház léptékű építészeti tervezés és ... további részletek >>

tanácsadás. Keressen fel minket, és mi megelevenítjük az elképzeléseit! www.skandivisual.hu


Feladva: 2016-11-30    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: építészetiskandivisualtanácsadástervezéslátványtervekegyKülönbözőkülönlegességrefotómontázselőadásmódotegyediségrekészítésmegfelelőmindigkörpanorámaház

Forrás: pepitahirdeto.multiapro.com

GKI képzés és vizsga RÉSZLETFIZETÉSI LEHETŐSÉGGEL! Ingyenes tananyagot biztosítunk! Ne maradjon le róla! Tel.: 0620-248-6818; www.fuvinfoiroda.hu/tanfolyamok/ke pzesek-gepjarmuvezetok-reszere/gki- soforoknek


Feladva: 2017-04-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: GKImájusvizsgatananyagot248képzésünkreIngyenes0620LEHETŐSÉGGELTelindulóRÉSZLETFIZETÉSIrólaJelentkezzenmaradjon900képzéshétfőeseténBudapestwww

Forrás: pepitahirdeto.multiapro.com

Azért, mert a Gano Excel mellett már 4 éve elköteleztem magam, és amit életem egy jó lépésének tartok. Azért, hogy lecserélhesd a hagyományos kávéd egy egészséges és finom kávéra, amelytől jelentősen javul az energiád és a közérzeted. Azért, ganodermát, a spirulinát, és a Cordycepst tartalmaznak termékeink, és ezek jótékony hatására bármikor szükséged lehet. Egészség és szépség egy helyen! Azért, mert nekem már jövedelmem van ebből a „munkából”, és segíthetek Neked is ... további részletek >>

abban, hogy Te is tisztes jövedelemre tegyél szert. Persze csak akkor vagyok jó választás a számodra, ha neked is fontos a szabadság, az anyagi függetlenség és az egészség.


Feladva: 2017-08-16    [Pénzkeresés - MLM]

Címkék, kulcsszavak: AzértegyegészségmárnekedhogymertExcelválasszakkorspirulináthagyományosmunkábólGanoszépségengemcsakganodermátlecserélhesd8222Tatabányalehet

Forrás: pepitahirdeto.multiapro.com

A Tiwian color mosópor csökkentett foszfáttartalmú mosószer minden típusú mosógéphez javasoljuk. A Tiwian color mosópor alkalmas 30, 40, 60, és 90 ° C-os mosáshoz is. Színvédő adalékot és vízlágyítót tartalmaz. Magas vastartalmú vízben is hatékonyan tisztít. A mosóvízben nagyon jól, maradék nélkül oldódó mosópor. A Tiwian color mosópor hazai környezetbarát mosószer. Gyártja a Cudy Future Kft. www.mososzerbolt.hu/id/00002_Tiwia n-color-mosopor-10-kg-vodros


Feladva: 2017-10-14    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: mosóporcolorTiwianmosószerKftFutureCudySzínvédőGyártjanagyonmosáshozmosóvízbenalkalmaskörnyezetbaráttisztítjavasoljukhazaihatékonyanmosógéphez

Forrás: pepitahirdeto.multiapro.com

A krill omega 3 gélkapszula magas omega-3 zsírsav tartalmával csökkenti a keringési betegségek valószínűségét. Az idősebbeket és az egyre gyakrabban a fiatalabb korosztályt is érintő vérnyomás-, koleszterinproblémák, érrendszeri betegségek ellen sokat tehetünk, ha rendszeresen pótoljuk az omega-3 zsírsavakat A krill omega 3 gélkapszula kellő mennyiségben tartalmazza ezt az esszenciális tápanyagot, mely a legtöbb ember étrendjéből hiányzik - pedig minden életkorban nélkülözhetetlen. Segíti az ... további részletek >>

idegrendszer egészséges működését, növeli a fizikai és a szellemi teljesítményt, csökkenti a gyulladásokat és helyreállítja a hormonháztartás egyensúlyát. Krill omega 3 gélkapszula ára itt!


Feladva: 2016-09-23    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: omegaKrillgélkapszulacsökkentibetegségeknélkülözhetetlenkeringésieztgyulladásokatérrendszeriéletkorbantartalmávaltartalmazzakoleszterinproblémákminden

Forrás: pepitahirdeto.multiapro.com

Magyarország első találka alapú (pay per date) és fokozottan biztonságos társkereső szolgáltatása! Csak akkor kell fizetni, ha összejön a randi! Nálunk nincsenek kamu profilok! Nincsenek zaklató levelek! Ne ülj otthon a képernyő előtt! Próbálj ki valami újat! beengedlek.hu


Feladva: 2017-01-01    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: NincsenekbeengedlekkamudatePróbáljrandiperelőttösszejönpayképernyőfizetnialapúotthonkelltalálkaüljakkorelsőlevelekCsakMagyarországzaklató

Forrás: pepitahirdeto.multiapro.com

Kútfúrás. Engedélyes kutak fúrása. Víznyelők fúrása kedvező áron! Bízza szakemberre! Tökölön, Dunaharasztiban, Soroksáron. Kézi és gépi kútfúrás. Csepel-szigeten és környékén. Budapesten és környékén. Szentendrei szigeten, Pest megyében. Minőségi anyagokkal és szűrőkkel. SZAKMUNKA, precíz kivitelezés, megfizethető árak. Cső átmérő: 40 mm-től 125 mm-ig. Hívjon bizalommal!


Feladva: 2014-09-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kútfúrásfúrásamegyébenPestszigetenMegfizethetőkörnyékénáronkedvező9642PrecízCsepelbizalommalSZAKMUNKAVíznyelőkHívjonszűrőkkelgépikutak125mm

Forrás: pepitahirdeto.multiapro.com

100%-os hidegen sajtolt mákolaj eladó a préselőtől: - 1 liter 4.900 Ft. - 0,5 liter 2.500 Ft. - 0,2 liter 1.250 Ft. Bővebb információ honlapunkon...


Feladva: 2016-12-25    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: litereladómákolaj100BővebbPéter250Balogh500900préselőtőlsajtolthonlapunkonhidegeninformáció

Forrás: pepitahirdeto.multiapro.com

Környezetbarát tisztítószer, amely lehetővé teszi a zsíros szennyeződések eltávolítását minden felületről. Különösen alkalmas a tűzhely, a sütő és a főzőlap zsíros lerakódásainak eltávolításához. Bőrgyógyászatilag tesztelt. Ecolabel minősítéssel rendelkezik, amely tanúsítja a környezetkímélő, biológiailag könnyen lebomló összetevőket. - 750 ml-es szórófejes flakon www.vegatar.hu/id/01352_Neutral-Gr een-oko-zsiroldo-750-mL


Feladva: 2017-04-04    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: 750amelyNeutralGreenökozsírostanúsítjatisztítószerzsiroldotűzhelykörnyezetkímélősütőbiológiailaglehetővéfőzőlapkönnyenteszilerakódásainaklebomló

Forrás: pepitahirdeto.multiapro.com

Sporthálót gyártótól! Mindenféle sporthálót gyártunk minőségi anyagból, kézilabda, futball, röplabda, hoki, kosárlabda, teniszháló, célzó fal, labdafogó háló, védőháló és egyedi kérést is kielégítünk.


Feladva: 2017-01-11    [Sport - Kemping - Túra]

Címkék, kulcsszavak: sporthálótMindenféleteniszhálógyártótólkosárlabdaBékéshokiKonstantinkielégítünkröplabdaDumakéréstfutballSporthálóegyedikézilabdavédőhálóanyagból

Forrás: pepitahirdeto.multiapro.com

A szájvíz szájfertőzés gyógyítására segítséget nyújthat a tünetek enyhítésében, a gyulladás mérséklésében és a baktériumok elpusztításában. A szájfertőzés gyerekeknél is gyakran jelentkezik, hiszen ők kevésbé tudnak figyelmet fordítani a szájhigiéniára és gyakran a szájukba veszik a kezüket, ami tele van baktériumokkal. A szájfertőzések kezelése történhet helyileg és belsőlegesen is. Általában részét képezi az antibiotikum kúra, de ezt gyakran kenőcsök formájában rendeli el az orvos. ... további részletek >>

Előfordulhat, hogy a szájfertőzés egy alapbetegség kísérőtünete, ilyenkor kezelése a kiváltó ok megszüntetésével történik.


Feladva: 2018-01-11    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: szájfertőzésgyakrankezelésebelsőlegesengyógymódmegszüntetésévelszájhigiéniárarendeligyulladáshelyilegSokfajtakiváltófordítaniformájábanenyhítésébenezt

Forrás: pepitahirdeto.multiapro.com

Ingyenes házhoz szállítás keltetőgépekre Magyarországon belül bárhova, ajándék hőmérővel! Új Keltetőgépek 1 év garanciával, kézi vagy automata forgatóval, légkeveréses, digitális kijelzővel. Továbbá kaphatóak a keltetéshez használatos kiegészítők: páramérő (3, 5e), hőmérő(2, 5e), tojáslámpázó(3, 5e). Keltethető tojások: szárnyasok, hüllők, méhek. Hu100sk: 32, 9e, Hu140sk: 36, 9e, Hu100fsk: 59, 9e, Midi55fsk: 69, 9e, Midi60fsk: 69, 9e, Midi100fsk: 79, 9e. Szállítási idő: 1 nap.


Feladva: 2013-12-11    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: garanciávalKeltetőgépekpáramérővagyHu100fskházhozkiegészítőkkéziHu140skIngyeneshasználatosHu100skGellértkeltetéshezméhekKajoskaphatóakDecembernap

Forrás: pepitahirdeto.multiapro.com

Az online marketingen belül a social media marketing kiemelkedő jelentőségű! Te szeretnéd a KÖZÖSSÉGI MÉDIÁVAL MEGALAPOZNI a JÖVŐDET? Ez egy elképesztő pénzkereseti lehetőség bárki számára. Szeretnél többet tudni róla? Ha érdekel, ÍRJÁL vagy regisztráljál!


Feladva: 2018-02-23    [Pénzkeresés - MLM]

Címkék, kulcsszavak: többetKÖZÖSSÉGISárközinéSzeretnélszeretnédlehetőséggelszámárajelentőségűtalálkozikbárkikiemelkedőüzletlehetőségmarketingvagyAholpénzkeresetimedia

Forrás: pepitahirdeto.multiapro.com

Falpanelt keresel? A legnagyobb választék falpanelekből a KERMA Design webáruházban: gipsz, farost, fa, pvc, cukornád, műbőr, polisztirol, poliuretán, beton falpanelek. Tervezés, gyártás, és kivitelezés! KERMA www.kerma.hu #falpanel #kerma #műbőr #design #burkolat #bőrpanel


Feladva: 2017-09-15    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kermadesignfalpanelműbőrakkorkereselburkolatpoliuretánFalpaneltpolisztirolDebrecencukornádKftpvcfarostfalwwwgipszkivitelezéswebáruházbanbeton

Forrás: pepitahirdeto.multiapro.com

Amiért érdemes figyelemmel kísérnie minket: • 60-70-80 % kedvezmény! • Kifutó szériás bútorok, amíg a készlet tart! • Hetente megújuló választék! • Konyhabútor, 4-6 elemes 29.000 Ft-tól • Szobai szekrénysor 29.000 Ft-tól • Hálószobai szekrénysor 29.000 Ft-tól • Tükrös gardrób 19.000 Ft-tól • Ülőgarnitúrák 39.000 Ft-tól • Ágy 19.000 Ft-tól • Étkezőgarnitúra 19.000 Ft-tól • Tálalószekrény 19.000 Ft-tól • ... további részletek >>

Kiegészítő kisbútorok 3.000 Ft-tól


Feladva: 2016-08-30    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 8226tól000szekrénysorbútorokminketTálalószekrényfolyamatosanválasztékkísérnieÉtkezőgarnitúraAkciósmegújulófigyelemmelÁgyHetenteérdemesÜlőgarnitúrák

Forrás: pepitahirdeto.multiapro.com

Speciális kamerák a legtöbb igényre! A kamerák mellett kaphatóak tokok, táskák, tartó eszközök... Közvetlenül rendelhető: www.ebay.com/usr/didustore


Feladva: 2018-02-16    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: kamerákmellettcomebayigényrewwwlegtöbbrendelhetőSpeciálisKözvetlenülPepitaAdseszközökbúvártartóVízállótáskáktokokdidustorekaphatóakusr

Forrás: pepitahirdeto.multiapro.com

A Magyar Vakok és Gyengénlátók Országos Szövetsége 90 éve áll a hazai látássérült emberek szolgálatában. Érdekvédelmi tevékenységeinkkel és sokszínű szolgáltatásainkkal próbálunk könnyebb és élhetőbb világot teremteni a vak emberek számára. Pontírásban, hanganyagban és elektronikus formában készült folyóirataink és könyveink egyedülállóan biztosítják számukra az információhoz jutást, kultúrát és a szórakozást. Tankönyvellátó csoportunk szerzi be és alakítja át látássérült tanulóink számára a ... további részletek >>

tananyagot. Segédeszközboltunkban az önálló életvitelt megkönnyítő termékekhez juthatnak hozzá a látássérült emberek. A Magyar Vakok és Gyengénlátók Országos Szövetsége szeretne köszönetet mondani mindazoknak, akik személyi jövedelemadójuk 1 %-ával támogatták szervezetünket, és bízunk jövőbeni támogatásukban is. „Az ember dolga, hogy embernek lenni érdem, Hogy bátor legyen az elrendeltetésben, Az elhullásban és a fölemelkedésben, És nem hihetünk másban, csak e küldetésben” (Juhász Ferenc)


Feladva: 2016-10-15    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: OrszágosGyengénlátókVakokMagyarembereklátássérültSzövetségeHogyszámáraszeretneformábanFerenclegyenmegkönnyítősokszínűbízunkszórakozástTámogassa

Forrás: pepitahirdeto.multiapro.com

Cégünk tapasztalt emberei vállalják a nehéz tárgyak, berendezések, eszközök (gépek hűtők, klímák, jakuzik, zongorák, pianínók, egyéb nehéz hangszerek, stb.) szakszerű mozgatását, szállítását. Raktárainkban lehetőséget biztosítunk ügyfeleinknek, akár azonnal bútorok, eszközök, egyéb ingóságok rövidebb-hosszabb idejű elhelyezésére.


Feladva: 2017-10-03    [Lakossági szolgáltatás]

Címkék, kulcsszavak: eszközöknehézegyébtárgyaktapasztaltakárpianínókCégünkügyfeleinknekzongorákelhelyezéséreBudapestbiztosítunkjakuzikidejűCsacsitranszlehetőségetklímák

Forrás: pepitahirdeto.multiapro.com

A méh pempő nemcsak étrendkiegészítőnek kiváló, de a bőr- és hajápoláshoz is az egyik legjobb termék. A méhek állítják elő, hogy ezzel a sűrű, ragacsos anyaggal táplálják királynőjüket. A méh pempő áldásos hatásait az ember már korán felfedezte és alkalmazza ma is szinte valamennyi betegség ellen sikeresen. Hatásait annak köszönhetjük, hogy benne rendkívül sok hasznos anyag található. A létfontosságú tápanyagok mellett számos más értékes összetevőt tartalmaz, többek közt acetilkolint és 10-HDA ... további részletek >>

savat is. Ezek adják intenzív gyulladásgátló antivirális és az agyműködést elősegítő hatásait.


Feladva: 2017-07-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásaithogypempőméhkiválóértékessűrűbenneétrendkiegészítőnekintenzívkoránmásezzelnemcsakadjákmárszámoselőköszönhetjükKittiEzekemberannak

Forrás: pepitahirdeto.multiapro.com

Yerba Mate Tea ------ yerbamate.hu ------ A mate tea egy 100% természetes, egészséges energia ital! Nagy segítség minden futónak és rendszeres fizikai tevékenységet végzőnek. A mate tea növeli a kitartást, a fizikai teljesítőképességet és javítja a hangulatot. A természet alkotta, mi juttatjuk el hozzád! Tudj meg többet oldalunkon: yerbamate.hu


Feladva: 2016-10-21    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teamateyerbamatetermészetesfizikaiTudjegészségeshozzádjuttatjukvégzőnek100alkottatevékenységetegytermészetrendszeresYerbahangulatotfutónakNagy

Forrás: pepitahirdeto.multiapro.com

Egyedi konyhabútorok, térelválasztók, beépített szekrények gyártása Kerti bútorok, filagóriák, előtetők, növényfuttatók -Teraszok, faházak, kocsi beállók készítése Ilkó Sándor 06703110395


Feladva: 2018-01-07    [Lakossági szolgáltatás]

Címkék, kulcsszavak: gyártásaIlkókészítéseszekrényekbeállókbeépítettkocsitérelválasztókfaházakkonyhabútorokTeraszokEgyedinövényfuttatókIldikóelőtetőkHegedűsnéfilagóriák

Forrás: pepitahirdeto.multiapro.com

VENDÉGLÁTÓS állásaink Németországban: szakács, felszolgáló, szobalány, főzőasszony. SZAKÁCS végzettséggel és valamennyi némettudással, szállással és ellátással. 1800-2400€ Bruttó. FELSZOLGÁLÓ (végzettség nélkül is) Wirshausba (kocsma) 900€ nettó + borravaló (kb 1600-1800€ nettó lesz a vége), szállással és ellátással. (valamennyi némettudással-A1-től) 35 éves korig. SZOBALÁNY és konyhai kisegítő (50-50%) egy kis Panzióba ( 8 szoba van) 1000-1200 € nettó, ... további részletek >>

szállással és ellátással. (B1 némettudástól) BeiKoch – segédszakács, KUKTA- (főzőasszonyt- főzni tudó személyt keresünk) vendéglőbe valamennyi némettudással, szállással és ellátással. 1000-1200€ nettó. További infók a www.nemetmunka.hu/gastro.html weboldalunkon, ahol regisztrációs lehetőség is van. Érdeklődni munkaidőben a +36 1 920 3433 vagy a +49 8641 6949 000 vezetékes számokon lehet. Várjuk jelentkezését! Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban)


Feladva: 2017-03-26    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 8364ellátássalszállássalnettónémetnémettudássalvalamennyi1000állásainkSZOBALÁNYVENDÉGLÁTÓSFELSZOLGÁLÓTeamMunka1800SZAKÁCSvan1200számokonkonyhai

Forrás: pepitahirdeto.multiapro.com

MI AZ AGYKONTROLL? A Stanford-i egyetem kutatói szerint elménk adta képességeinknek csupán mintegy 2%-át használjuk ki. A Silva-féle agykontroll egy tudományosan megalapozott, egyszerű, praktikus, könnyen elsajátítható önfejlesztő módszer, ami lehetővé teszi, hogy ennél lényegesen nagyobb mértékben használjuk ki istenadta lehetőségeinket, s így sikeresebben oldjunk meg mindenfajta problémát. Egyik fontos eszköze a relaxáció avagy lazítás, ami egyúttal a bizonyítottan megbetegítő hatású ... további részletek >>

stresszt is levezeti. Az agykontroll nem vallás. Ateista ember ugyanúgy megtanulhatja elméje hatékonyabb használatát, mint az istenhívő, ahogy világnézetétől függetlenül mindenki megtanulhat például úszni is. Az agykontroll nem mágia, hanem elménk sokak által ma még kevéssé ismert, s emiatt kevéssé kiaknázott képességeinek okos – tehát nem kishitű és nem is fanatikus – használata, ami kiegészíti a cél elérése érdekében tett cselekedeteinket! Jelszavunk: egyensúly. MIRE JÓ AZ AGYKONTROLL? – A stressz levezetésére, – alvászavar megszüntetésére, – ébresztőóra nélküli, időzített ébredésre, – élénkítőszer nélküli felfrissülésre (például autóvezetéskor), – a fejfások 90%-ának és a migrénnek gyógyszer nélküli elmulasztására, – a minket foglalkoztató kérdések – bölcsebb tudatalattink és az „összemberi tudás”* bevonásával történő – megválaszolására, – a memória fejlesztésére, – gyorsabb és hatékonyabb tanulásra, – a jó döntéshozatal megkönnyítésére, – céljaink elérésére (magunk és szeretteink gyógyulását is beleértve), – a fájdalom és a vérzés gyors uralására, – szokásaink (pl. dohányzás, alkoholizálás, túlzott evés, lustaság, rendetlenség) akaraterő és kínlódás nélküli megváltoztatására, – gyerekeink és felnőtt szeretteink szavak nélküli megsegítésére, – a misztikusnak hitt, ám valójában természetes és hasznos intuíció avagy megérzőképesség rendkívüli fokozására. Tudományosan is bizonyított tény, hogy az emberi elmék között láthatatlan szálakkal kapcsolat van. Az egyes emberek tudása így bizonyos értelemben „összemberi tudássá” válik. Többnyire ez magyarázza, hogy felfedezők, feltalálók sokszor egyszerre álltak és állnak elő azonos ötletekkel. Nem véletlenül mondja hát a módszerről a világhírű amerikai orvos, dr. Clancy D. McKenzie: „Ha valaki megtapasztalja az eredményeket, amiket ezen a tudatszinten el lehet érni, akkor a későbbiekben már meg se kísérel ennek használata nélkül fontos döntéseket hozni vagy problémákat megoldani.”


Feladva: 2016-10-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 8211AGYKONTROLLnemnélküli8222amiméghogy8221kevésséhasználjukhatékonyabbfontoshasználatapéldáulMIREtudományosanszeretteinkelménkígyavagyának

Forrás: pepitahirdeto.multiapro.com

Ha üzletet nyit, kérjen ajánlatot a Váróczi Üzletberendezéstől! Váróczi minőség · Kiemelt garanciák * Tanácsadás * Üzletberendezés gyártás * Helyszíni beszerelés * Üzletberendezés tervezés


Feladva: 2017-09-21    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: ÜzletberendezésVáróczitervezésgyártásTanácsadás183minőségÜzletberendezéstőlajánlatotbeszereléskérjenHelyszíninyitüzletetajánlógaranciákHirdető

Forrás: pepitahirdeto.multiapro.com

A bagoly mintás zokni a szürke őszi-téli napokba egy kis pajkosságot varázsol színes mintájával és érdekesen kialakított felső részével. Kiknek ajánljuk ajándékba? - akik szeretik a különleges zoknikat - bagoly fanoknak - vidám minták kedvelőinek - akiknek mindig eltűnik a zokni egyik párja a mosógépben Méretei - egy méretben kapható: talpa 18-19 cm hosszú (nem nyújtott állapotban) - ez egy átlagos méretű női lábnak felel meg (35-39) szélessége: 8 cm Színe: több színkombinációban ... további részletek >>

kapható Anyaga: pamut, poliészter, spandex Itt található: www.atomzsir.hu/bagoly-mintas-szines-noi-zokni


Feladva: 2017-10-12    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: zoknibagolyegyszinestéliőszinoikaphatószínkombinációbanajánljuknyújtottakiknektöbbKikneknematomzsirkedvelőinekSzínerészévelhosszúszürkewww

Forrás: pepitahirdeto.multiapro.com

Elege van a magas közös költségből? Szeretné csökkenteni kiadásait? Válassza az AXA Trend Kft. szolgáltatását! Professzionális társasházkezelés; közös képviselet; társasházak és lakásszövetkezetek jogi képviselete; könyvelés; könyvvizsgálat! Amennyiben az Ön társasháza – közgyűlési határozat alapján – szerződést köt az AXA Trend Kft. társasházkezelővel, a társasház közös képviseletére, akár 10%-al csökkenthetjük a közös költséget.


Feladva: 2015-10-12    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: közösKftTrendAXA8211társasházkezelésProfesszionálistársasháztársasházaszolgáltatásáttársasházkezelővelAmennyibenVálasszakönyvvizsgálatkiadásaitSzeretné

Forrás: pepitahirdeto.multiapro.com

Minőségi Taktikai, outdoor, sport, vadász ruházat, kiegészítők és felszerelések nagy választékban! Webshopunkban több 100 termékkel, kedvező árakkal és folyamatos akciókkal várunk! Országos kiszállítás.


Feladva: 2016-10-30    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: FreskaZonetermékkeloutdoor100TaktikaitöbbMinőségiWebshopunkbanBudaörskiszállításválasztékbanNetOrszágosnagyvárunkfelszerelésekWebáruházakciókkal

Forrás: pepitahirdeto.multiapro.com

Az AR-5316-os A3-as másológép 1 db 250 lapos papírfiókkal és 1 db 100 lapos oldalsó adagolóval rendelkezik. Egyszerű, könnyen kezelhető berendezés. A másológép lézernyomtatóként is használható a beépített LPT és USB portjain keresztül. Windows 10 operációs rendszerrel nem kompatibilis. www.fullc.hu/sharp/webaruhaz.php?S HARP-AR-5316-hasznalt-masologep&ope n=&id=465&kat=24&menu=w


Feladva: 2017-09-18    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: 5316SHARPmásológéplaposHirdetőkeresztülEgyszerűPepitaportjainrendelkezikhasználtphpUSBadagolóvalwebaruhazLPToldalsófullcbeépítettmenuwww100

Forrás: pepitahirdeto.multiapro.com

Illat és allergénmentes mosószerek, öblítők és folttisztítók. Cudy illatmentes termékcsalád és Csepke Baby baba mosószerek. Ingyenes szállítási lehetőséggel. Hazai mosószer webáruház. www.mososzerbolt.hu/modules.php?na me=lista&id=4f94f83b88563_Illatment es_tisztitoszerek_es_mososzerek


Feladva: 2018-01-29    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: mosószerekillatmentesCsepketermékcsaládwebáruházmosószerCudyHazaifolttisztítóklehetőséggelöblítőkszállításiallergénmentesIngyenesIllatKftbabaSzte

Forrás: pepitahirdeto.multiapro.com

Elektromos moped 4 évszakos gumikkal, Garancia + Mobilszerviz, ingyenes, gyors házhoz szállítással és beüzemeléssel! Idősebbeknek, nehezebben mozgóknak mozgáskorlátozottaknak és egészségpénztári tagoknak ajánlunk három kerekű elektromos mopedeket. Járműveink kezelése egyszerű, fenntartása olcsó. Árak 180.000 Ft és 250.000 Ft között.


Feladva: 2016-02-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elektromos000elektromopedmopedmopedeketbeüzemelésselAkcióközöttszállítássalHúsvétikerekűházhoz250háromgyors180ajánlunkingyenesÁraktagoknak433

Forrás: pepitahirdeto.multiapro.com

Anyaga: rozsdamentes acél, talpa 11 rétegű Tartalma: sütőkosár nyéllel, bakelit alátét, vákuum gomb Szín: piros Nyél: biztonságos, nem forrósodik Súly: 5000 gr Használható: gáz, kerámialapos, halogén, indukciós és elektromos tűzhelyen is Szószos edény mérete: 16 x 8 cm Lábas: 20 x 10 cm Lábas: 24 x 14 cm


Feladva: 2017-07-21    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: LábasSúlynyélleledényEDÉNYKÉSZLETforrósodiksütőkosárSzószosRÉSZESnemTartalmatűzhelyenbiztonságosrétegűelektromosNyéltalpaindukcióspirosacél

Forrás: pepitahirdeto.multiapro.com

Vendégházunk 4 személyes apartmanjában és vendégszobáinkban kényelmes szállást biztosítunk kedves vendégeinknek. Levelezős diákokat,munkavállalókat,átutazókat is szívesen fogadunk. Vállalatoknak, munkavállalóknak hosszabb távra jelentős kedvezménnyel. 3500,-Ft/fő/éj-től. SZÉP KÁRTYA elfogadás. 3 éjszakán túli foglalás esetén akár 3290,-Ft-tól Az ár függ az eltöltött éjszakák és a személyek számától. www.aratovendeghaz.atw.hu tel:+36704593419


Feladva: 2017-09-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: eltöltöttapartmanjábanSZÉPátutazókatfüggszemélyestőlmunkavállalókattólVendégházunk350036704593419diákokat3290PécskedvezménnyeltelLevelezősakár

Forrás: pepitahirdeto.multiapro.com

Egri összkomfortos belvárosi szálláshelyünk, amely csendes, családias zöld övezetben található. Nagyon kevés egri szálláshely adottsága, hogy egy adott foglalt időpontban csak egy családnak vagy baráti társaságnak adjuk ki. A két apartman két különálló udvarban található és egyenként 4+2 személy befogadására alkalmas. Korszerűsített, teljesen felszerelt apartmanok. Egyik apartmanunk a tavalyi év folyamán korszerűsítve lett. Műanyag nyílászárok, redőnnyel, szúnyoghálóval ellátva, a fűtés cirko. ... további részletek >>

Zárt parkolót, pihenőudvart biztosítunk. Mind családoknak, mind baráti társaságoknak kiváló üdülési lehetőség. A történelmi belvárostól 5 perc sétára található. Eger látnivalói (vár, mecset, Líceum, Szépasszonyvölgy) gyalogosan megközelíthető. Közeli kis pincénkben termelői borkóstolási, borvásárlási lehetőséget biztosítunk. Üdülési csekket, Széchényi pihenőkártyát, Szép kártyát elfogadunk, (OTP, K&H, MKB Bank). Havas Apartman kulcstartójának felmutatásakor vendégeink, számos szolgáltató kedvezményt biztosít (Demjéni strandfürdő, Tangó étterem, taxisok, fodrászok.) Korlátlan internet, WIFI hozzáférés, kábeltévé. Állatbarát egri szálláshely, kis állat behozható. 2 db teljesen felszerelt kerékpár áll vendégeink rendelkezésére. Reméljük bemutatkozásunk elnyerte tetszésüket, és viszont látjuk egymást Magyarország egyik legszebb történelmi városában. Várja szeretettel Önt és kedves családját Észak Magyarország egyik legszebb városában, Egerben a Havas Apartman. Áraink: fő/éj vannak megadva, amely függ a foglalt idő hosszától és a vendégek számától. Áraink IFA - t nem tartalmazzák. (450.-Ft/fő, 18 év felett)


Feladva: 2017-11-26    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: HavasApartmanegyikegriEgertalálhatókéttörténelmivárosábanfelszereltlegszebbteljesenfoglaltÜdülésiMagyarországegybiztosítunkbarátiamelykismind

Forrás: pepitahirdeto.multiapro.com

Biológiai algairtó. Természetes humusz tartalmának köszönhetően hatásos védelmet nyújt az algásodás ellen. Megfelelő használat mellett ártalmatlan a halakra, növényekre és más mikroorganizmusokra. Adagolás: 5ml 10l akváriumvízhez 3-4 hetente. (1 kupak = 10ml) Ár: 990 Ft-tól www.fisch.hu/akvarista/webshop/pro duct/tetraaqua-algumin-259


Feladva: 2017-06-29    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: tetraaquaalguminalgairtóakváriumvízhezMegfelelőproductBiológiai10lellenwebshopajánló5mlalgásodásakvaristaHirdetőAdagolásnyújtfischPepitawww

Forrás: pepitahirdeto.multiapro.com

Eladó Pestszentimrén 50 nm-es családi ház. Összkomfortos, 1,5 szobás, étkezős konyha, kamra, kádas fürdőszoba, és külön vécé van. A fűtést az egész házban gáz-cirkó, a meleg vizet pedig gáz bojler biztosítja. A nappaliban egy cserépkályha is van, ami igény szerint használható. Rezsi alacsony a kellemes meleg ellenére. A 394 nm-es telken, szerelőaknával rendelkező nagy garázs, és melléképületek vannak, víz, ipari áram, gáz bevezetve. Dryvit szigetelés van a házon. Riasztóval felszerelt ház. Fúrt ... további részletek >>

kúttal a locsolás és egyéb megoldható. Központi helyen van a közlekedése is kiváló. 5-10 percre 54, 55, 84E, 89E, 94E, 166, 166A, 254E, 266, 294E, buszjáratok,10 percre a vasútállomás amivel a Nyugati pályaudvar 35 percre van. Központi rendelőintézet, iskola, óvoda, Posta, bankok, boltok, bevásárló központok a közelben. Érdeklődni, hétköznapokon +36704281107 vagy +36307449824 telefonszámon és a szabopap.judit@gmail.com email címen lehet.


Feladva: 2017-11-18    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vangázpercreKözpontimelegházbevásárlófelszereltpedigNyugatimelléképületekkonyhajudit@gmail84ERezsiutcaboltokRiasztóvalvizetamivelgarázsnagy

Forrás: pepitahirdeto.multiapro.com

Egyedi, megnyugtató környezetre vágyik? Színes hétköznapokra és egy kis romantikára? Vigyen az életébe egy csipetnyi csodát led csillárokkal! Kényelem a távirányító használatával és megannyi szín, mintázat, egyedi és különleges formavilág! Nézze ezt a fénytörést, mint valami varázslat… Energiatakarékos, színváltó led csillárok automata fényerő szabályozással, ajándék távirányítóval és garanciával!


Feladva: 2013-10-27    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: csillárokWebáruházledkülönlegesegyCsodafényegyedifénytöréstKényelemvágyikfényerőeztcsillárokkalkörnyezetreautomataNézzecsodátmegnyugtatócsipetnyi

Forrás: pepitahirdeto.multiapro.com

Melyek a szájszárazság okai? A szájszárazság oka lehet stresszes helyzet, idegeskedés, ilyenkor természetes, hogy a szervezet így reagál. Azonban, ha gyakran észleljük a száj kiszáradását, érdemes alaposabban utánanézni, mi lehet a háttérben. A szájszárazság ellen akkor tudjuk megtalálni a megfelelő terápiát, ha ismerjük a kiváltó okot. Amennyiben rendszeresen gyógyszert szedünk, olvassuk el a mellékhatásokat, hiszen sok fájdalomcsillapító, gyulladáscsökkentő, vérnyomáscsökkentő gyógyszer is ... további részletek >>

okozhatja a nyáltermelődés csökkenését. A szájszárazság oka ugyanakkor lehet betegség is, pl. cukorbetegség vagy Parkinson-kór.


Feladva: 2016-11-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: szájszárazságlehetokaokaiMelyekugyanakkorszájhiszenhelyzetmegfelelőészleljükmellékhatásokatstresszesmegtalálnigyakranolvassuktudjukcsökkenésétkór

Forrás: pepitahirdeto.multiapro.com

Nyüzsgés, kommunikáció, professzionalitás! Ez jellemzi cégünknél az ingatlanértékesítő mindennapjait. Ha szeretnél egy jó kedélyű, segítőkész csapatban dolgozni, és a hobbidnak élve kiváló pénzkereseti lehetőségre szert tenni, ha több van benned, és szeretnél karriert építeni, küldd el önéletrajzod és vágjunk bele a közös munkába! * Ha olyan munkát szeretnél, ahol keményen kell dolgozni, de saját magad osztod be az idődet, és szeretnéd, ha olyan vezetőd lenne, aki pontos szakmai tanácsokkal ... további részletek >>

segíti a munkádat, szakmai, jogi és üzleti hátterét, ahol a kereseti lehetőségednek nincs felső határa, akkor ez a munka Neked való. * A leendő munkatárs feladatai lesznek: Potenciális vevőink számára megtalálni a megfelelő ingatlant és az eladó piacképes ingatlanoknak vevőt találni. Tárgyalásokat bonyolítani, lakásokat bemutatni, kapcsolatot tartani meglévő és új ügyfelekkel. Mindezt cégünk 15 év alatt összegyűjtött tapasztalatának segítségével. * Irodánk AGÁRDON van, a munkavégzés viszont kiterjed a Velencei-tó környékére, illetve Székesfehérvár közelében található településekre is, ezzel biztosítva az értékesítők korlátlan lehetőségeit. * Egyéb információk: Nálunk senki nem állítja, hogy ez könnyű munka, amivel könnyen lehet pénzt keresni! Nehéz munka, de átlagon felüli keresetet tudsz elérni, mivel ehhez minden támogatást megkapsz. * A siker csak Rajtad múlik! * Jelentkezni fényképes önéletrajzzal a tunyogi.balint@dh.hu e-mail címen lehet!


Feladva: 2017-06-25    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: munkaszeretnélszakmailehetdolgozniVelenceiahololyanvanNekedbelefelüliAGÁRDONkapcsolatotpénzkeresetinemmegfelelőosztodjellemzicsaktalálható

Forrás: pepitahirdeto.multiapro.com

Cégünk a legjobb áron vesz motor, hajtómű és hidraulika olajat nagy tételben is országosan. A szállítás díjtalan! Tel: 06 20 590 5340


Feladva: 2017-04-19    [Autó - Motor - Jármű]

Címkék, kulcsszavak: országosanolajatFáradthidraulikahajtómű5340motor590veszTelárondíjtalanlegjobbszállításCégünkAttilatételbenfelvásárlásnagyolaj

Forrás: pepitahirdeto.multiapro.com

A fekete bodza sok olyan hatóanyagot tartalmaz, melyekkel hosszútávon is növelhetjük védettségünket a különböző betegségekkel szemben. Az immunerősítéshez az egyik legjobb gyógynövény, hiszen hatékony a vírusokkal, baktériumokkal szemben vívott harcban, természetes antibiotikumként viselkedik, miközben a már fennálló betegség tüneteinek csökkentésére is képes. A Sambucol bodza szirup gyerekeknek is egész évben adható étrendkiegészítő, melyet a láz és a köhögés csillapításához is használhatunk. ... további részletek >>

Biztonságos és rendszeresen alkalmazható székrekedés és bélgyulladások esetén. Sambucol fekete bodza szirup rendelés itt!


Feladva: 2017-05-23    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: bodzaszirupSambucolszembenfeketeimmunerősítéshezrendszeresengyerekeknekKittiharcbanittbetegségekkelBiztonságosképesKellérvívottrendeléskülönböző

Forrás: pepitahirdeto.multiapro.com

A szervezet savasodása több problémának is az okozója lehet, ezért érdemes odafigyelni a megfelelő savtalanításra, mely azt eredményezi, hogy a testünkben helyreáll a sav-bázis egyensúly. Ennek az állapotnak az elérése megkönnyíti a szervezet méregtelenítését, a nehézfémek eltávolítását, valamint megállítja a csontjaink számára veszélyes csontritkulást. A Blue Nature-ben azon az állásponton vagyunk, hogy maga a természet segít nekünk a megfelelő egészséges megoldás kidolgozására, a technológia ... további részletek >>

pedig csak támogató jelleggel van jelen. Erre alapozva jött létre az innovatív pH Boda Balance termék, melynek köszönhetően a savasodás problémája gyorsan elhárul. A szervezet túlzott savasodása nemcsak egészségtelen következményekkel jár, de a mindennapi közérzetünk és kényelmünk is nagyban lecsökken. Ez megkönnyíti a savasodási folyamat felismerését és leküzdését még azelőtt, hogy az komolyan károsítaná a szervezetet. Érdemes szem előtt tartani, hogy hosszú távon a túl nagy savasság és a felborult sav-bázis egyensúly nemcsak megakadályozza a szervezet természetes tisztulását, de a csontrendszerre is káros hatással van, csontritkulást okoz ami többek között megnöveli a csonttörés kockázatát. Mi utal tehát arra, hogy a szervezetünkben a pH egyensúly felborult? A savasodás tünetei többek között: állandó álmosság még megfelelően hosszú alvás után is visszatérő fej, csont és ízületi fájdalmak elgyengülés, rossz közérzet eredménytelen fogyókúra a sok áldozat ellenére. visszatérő bélrendszeri betegségek, sűrű gyomorégés, sűrű fertőzések, melyek bosszantóbbak, mint az általános allergiás tünetek


Feladva: 2018-02-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hogyszervezetegyensúlycsontritkulásthosszúsavvanmégBalancesűrűsavasodásaközötttöbbekmegkönnyítivisszatérőmegfelelősavasodásÉrdemesnemcsakbázis

Forrás: pepitahirdeto.multiapro.com

Egysoros, kétsoros és háromsoros árazógép forgalmazás! Pénztárgép szalag minden méretben. Minden típusú gép javítása, kellékanyag ellátása. Ruházati kellékek, belövőpisztolyok, függőszálak, papírcímkék, kézi szálak értékesítése. Üvegre, tükörre is írható színes tollkészlet. A dátumnak a nap/hónap/év sorrendet kell követnie. Az élelmiszerek jelölésével a 19/2004. (II. 26.) FVM-ESzCsM-GKM együttes rendelet foglalkozik. Honlapunkról letölthető! Szerviz, javítás. Rendelésre ... további részletek >>

csomagküldő szolgálat. Vállalunk gépátalakítást is.


Feladva: 2017-06-27    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: MindenárazógépgépHonlapunkrólajánlókellszálaktípusúfoglalkozikHirdetősorrendetkéziegyüttesPepitahónappapírcímkékgépátalakítástméretbenrendelet

Forrás: pepitahirdeto.multiapro.com

Turkálósok, piacosok, magánvállalkozók figyelmébe ajánlom cégünket, amely több éves tapasztalattal kínálja Önnek használtruha termékeinket. 20 kg-os kiszereléstől az 500 kg-os kiszerelésig biztosítjuk a szezonális ruházatot. I. osztálytól a cream minőségig megtalál nálunk mindent egy helyen. Minden megrendelést ingyenesen kiszállítunk garancia vállalással. Kínálunk gyerek ruházatot, felnőtt használt ruházatot, bálás ruhákat, válogatott extra használt ruházatot, pólós bálákat, melegítős - ... további részletek >>

jogging használt ruha bálákat, lakástextilt, fajtára válogatott extra minőségű ruházatot. Kérje részletes ajánlatunkat!


Feladva: 2017-08-02    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: 224232236zatotruhextra242kathasznhasználttunkcégünketminőségűcreamOrigin20kgkisznlommelegkeinketingyenesenfigyelmválogatottosztályt

Forrás: pepitahirdeto.multiapro.com

Ki az ön kedvenc STAR WARS szereplője? A jókhoz húz a szíve, mint Luke Skywalker, Anakin Skywalker, Obi-Wan Kenobi, Yoda, Han Solo, Leia Organa, Padmé Amidala, Jar Jar Binks, Csubakka, Qui-Gon Jinn, Poe Dameron, Finn (FN-2187) vagy Ray? Netán a droidokat - R2-D2, C-3Po és BB-8 - szereti? Esetleg a sötét oldalon álló Darth Wader, Kylo Ren, Darth Maul, Palpatine alias Darth Sidious, Dooku gróf / Darth Tyrannus, Grievous tábornok, vagy Jabba a kedvenc hőse? Böngésszen termékeink között, és találja ... további részletek >>

meg az Önnek vagy Star Wars rajongó családtagjának, barátjának leginkább megfelelő ajándékot. Csillagok háborúja - Star Wars Shop www.starwars.boltaneten.hu


Feladva: 2017-01-18    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: WarsStarDarthvagykedvencJarSkywalkerWebshopBinksstarwarsMaulObicsaládtagjánakNetánJabbahttpRenrajongóRaytábornokAmidalaShopKyloAnakin

Forrás: pepitahirdeto.multiapro.com

Tisztelt érdeklődő!Számlaképes vállalkozásunk több mint 15 éve foglalkozik lakossági és közületi költöztetéssel,melyet napi rendszerességgel végzünk,megrendelőink nagy örömére. Fiatalos,lendületes,összeszokott csapattal,tiszta bútorszállításra alkalmas tehergépjárművekkel,megfelelő segédeszközökkel dolgozunk Budapesten és az ország egész területén. Amit még vállalunk: -lomtalanítást akár rakodással is -zongoraszállítást -pianínószállítást -páncélszekrényszállítást -egyéb túlsulyos tárgy ... további részletek >>

szállítását. Bővebb információkért látogasson el honlapunkra! www.kriszvisz.honlapom.com KÖLTÖZTETÉS-ZONGORASZÁLLÍTÁS-LOMTALANÍTÁS! +3620-560-1051 KRISZVISZ AKI MINDENT VISZ!


Feladva: 2018-01-26    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: KÖLTÖZTETÉSKRISZVISZLOMTALANÍTÁSZONGORASZÁLLÍTÁS10515603620mégSzámlaképesbútorszállításratárgynapiAmitérdeklődőtisztatúlsulyosmelyetterületéncom

Forrás: pepitahirdeto.multiapro.com

Partira, esküvőre, bálra, céges bulira, városnapra rendezvényszervezőt keresel vagy fellépőre van szükséged? Hívj minket! > Kizárólagos produkció: Barna Barnabás a Mulatós Herceg > Egyedi programokkal, műsorokkal, technikai és marketing háttérrel állunk rendelkezésre > Gyerekműsorok (bohócok, óriásbábok, vásári komédiások) > Játszóház, kézműves foglalkozás > Ismert és helyi fellépők > Zenekari produkciók > Humoristák és stand-up comedy-sek > Játékpark ... további részletek >>

(ugrálóvár, körhinta, kis vonat, lézerharc, buborékfoci, rodeóbika, stb...) > Tűzijáték > Kordon és biztonsági szolgálat > Mobil WC > Élő online rádióközvetítés Egyedi, akár extrém igényekkel is keress bennünket, nálunk mindenre megoldást találsz!


Feladva: 2017-05-08    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: EgyedibuborékfociBarnabászenekarirendezvényszervezőtrádióközvetítésgyerekműsorokrendezvényszervezéslézerharcBarnatalálszfellépőkvárosnapraonlinekörűélő

Forrás: pepitahirdeto.multiapro.com

Hordozható, vezeték nélküli, újratölthető. 6 hónap garanciával. A készüléket ott használhatja, ahol Önnek szüksége van rá. Többé nem szükséges a gyakran túl rövid áthidalókábelekkel vesződnie. A Start-Booster (12 V) segítségével azok az autók, teherautók, vagy generátormotorok is könnyen újraindíthatók, melyek nehezen hozzáférhető, vagy távoli helyen állnak. A bikázót 12 V-os szivargyújtó kábellel is újra lehet tölteni és mint hordozható energiaforrást is lehet használni. Postai utánvéttel is!


Feladva: 2016-09-20    [Autó - Motor - Jármű]

Címkék, kulcsszavak: hordozhatólehetvagymintÖnneknehezenAUTÓvesződnietölteniaholmelyekATLASZáthidalókábelekkelújrahasználhatjaújraindíthatókbikázórövidkábellelott

Forrás: pepitahirdeto.multiapro.com

A Tilta Gravity G1 egy rendkívül könnyű, egyszerűen kezelhető, csúcsminőségű egykezes gimbal, professzionális használatra. Köszönhetően a 0-tól 3 kg-ig terjedő terhelhetőségének, kompatibilitása egyedülálló: a nehezebb DSLR konfigurációtól, a MILC és GoPro kamerákon át az okostelefonig szinte bármivel használható. Ezt nem csak a kifinomult vezérlésnek és a páratlanul erős motoroknak, hanem az egyedülálló váz-kialakításnak köszönheti, amely hosszabb és erősebb, mint bármely más egykezes ... további részletek >>

gimbalnál. Kiterjeszti az alkalmazhatóságát a gimbal markolat felett elhelyezkedő jobb és baloldali rozetta, amelyre monitor, mobil telefon (élőképhez), follow focus vagy más kiegészítő csatlakoztatható. A Gravity G1 markolata egy mozdulattal eltávolítható és a rozetták segítségével egyszerűen kétkezes gimballá alakítható. A működés finomhangolása bluetooth kapcsolaton keresztül a TILTA Assistant App (Androidra és iPhone-ra) segítségével történik. Bővebben: www.gaia.hu/tilta-gravity-g1-gimbal-stabilizator-grt02g1.html


Feladva: 2017-09-04    [Fényképezőgép - Kamera - Optika]

Címkék, kulcsszavak: gimbalgravitytiltamássegítségévelegyszerűenegyedülállóegyegykezesbármelyKöszönhetőenfinomhangolásaerőskameracsatlakoztathatókamerákonBővebbenmint

Forrás: pepitahirdeto.multiapro.com

A konténer rendelés Budapest minden kerületébe és Pest megye több településére is lehetséges nálunk! 10 éves tapasztalattal várjuk hívását, ha sitt szállítást, zöldhulaldék vagy háztartási szemét elszállítását szeretné hatékonyan megoldani! A konténer rendelés szemét és sitt számára nálunk 1 perc alatt lebonyolítható! Telefonon, emailen és a weboldalunkon található űrlapon keresztül is leadhatja rendelését! 1 munkanapon belül leszállítjuk a hulladékgyűjtőt az Ön által megjelölt címre! Kisebb ... további részletek >>

felújításokhoz, kerti munkákhoz és építkezésekhez, bontásokhoz is van megfelelő méretű konténerünk! Konténer rendelés Budapest!


Feladva: 2017-08-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: rendelésKonténernálunkBudapestsittszemétstoptalálhatókonténerünkmegoldaniévesmegjelöltnonweboldalunkonméretűhatékonyanlehetségesáltalemailenvan

Forrás: pepitahirdeto.multiapro.com

Budafok kertvárosi részén családi házrész korrekt áron eladó. Külön bejárat, önálló épület, jó műszaki állapot. Az eladó részhez kiskert és szuterén is tartozik. - További infó a weboldalon


Feladva: 2017-02-26    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: eladóTovábbiKülönifjtartozikáronköltözhetszuterénkorrektAzonnalkiskertházrészrészhezcsaládirészénállapotkertvárosiműszakiBudafoképületönálló

Forrás: pepitahirdeto.multiapro.com

Nagyszabású lakóparki beruházások kivitelezéshez keresünk építőipari és építőipari kiegészítő-tevékenységet végző, tapasztalt alvállalkozókat, valamint szakipari munkákhoz vállalkozásokat, szakembereket a kisebb munkákhoz is. Ajánlati szám: VSZ/00160/16/07


Feladva: 2017-12-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: VSZmunkákhozépítőiparikeresünklakóparkiNagyszabásúalvállalkozókatkivitelezőt00160tapasztaltberuházáshozvégzőszámtevékenységetAjánlatikiegészítőkisebb

Forrás: pepitahirdeto.multiapro.com

Olcsó árak! Huawei Mate, Honor, Asus Zenfone, Asus Pegasus, Lenovo A, Lenovo Vibe, LeTv Le Eco, Mezu M, UleFone, UMI, Vernee Thor, Vernee Apollo, VKworld T1, VKworld G1, VKworld T3, Xiaomi Note, Xiaomi Redmi, Xiaomi MI. Minden egy helyen, minden a legjobb helyen.


Feladva: 2017-11-07    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: XiaomiVKworldLenovoAsusVerneemindenhelyenárakegyEcoOlcsóLeTvajánlásRedmiVibeHirdetőNotePepitaPegasusmobilApolloKínaiZenfoneThorHonor

Forrás: pepitahirdeto.multiapro.com

A fogyókúra étrend követése során el kell felejtenünk a cukrot. Míg korábban a kávét, a kakaót, a teát előszeretettel cukroztuk, nem beszélve a házilag készült süteményekről, melyekből szintén nem sajnáltuk a fehércukrot, a fogyókúra étrend valami egészen másnak a kezdete. Egy olyan életmódnak, melyben a cukrot egészségesebb édesítővel váltjuk fel vagy hozzáadott formában teljesen kiszorítjuk a mindennapjainkból. Érdemes vásárláskor is odafigyelni arra, hogy az egyes termékek címkéjén mennyi ... további részletek >>

hozzáadott cukor van feltüntetve. Meg fogunk lepődni, hogy még az egészségesnek vélt paradicsompüré is nagy mennyiségben tartalmazza! Fogyókúra étrend tanácsok itt!


Feladva: 2017-08-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: étrendFogyókúracukrotnemhozzáadottméghogyfogyókúrásfeltüntetveÉrdemeskávéttartalmazzamelybenittvanszinténmindennapjainkbólkorábbanmennyiségben

Forrás: pepitahirdeto.multiapro.com

Eladó tulajdonostól Bpest. Rákoshegy - Nagyhangácson az Orgoványi utcában 620,2 nm-es, külterületen lévő bekerített kertgazdasági, szántó, gazdasági épület, kivett lakóház, udvar megjelölésű ingatlan és a hozzá tartózó 44,8 nm szolgalmi út. A telken villany és a vezetékes víz bekötve a házba, gáz az utcában, gyűrűs kút, bontandó vagy erősen felújításra szoruló 36 nm-es faház (2 helység, külön WC, tusolós mosdó, veranda és 26 nm-es fedett tároló) van. Csatorna, szennyvíztároló nincs. ... további részletek >>

Személygépkocsi tárolás kerítésen belül megoldható. Utca fronti személykapu, oldalsó gk. bejárat. A terület átminősítése gazdasági területté a Fővárosnál folyamatban van. Befektetésnek is ajánljuk. BKV busszal 10 perc a KöKi . Tájékoztatás csak telefonon! Az ár alkuképes irányár.


Feladva: 2017-10-16    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: vanEladógazdaságiutcábanirányárfedettkivettRákoshegyerősenUtcavillanyépületalkuképes26nmBpestfolyamatbanvagymegoldhatótelkenszántótelefonon

Forrás: pepitahirdeto.multiapro.com

Értékesítőket és Hálózatépítőket keresek az ország minden területéről! Olyanok jelentkezését várom akik szeretnének elérni valamit az életükben és vannak céljaik! Lehetsz: - munkanélküli - gyesen, gyeden lévő anyuka - 18 életévét betöltött diák - nyugdíjas - vállalkozó - vagy aki jövedelmét szeretné kiegészíteni Aki komolyan foglalkozik vele rövid időn belül lehet akár Főállás is! Feltétele a munka kezdéshez: - Internet elérhetőség - Jó kommunikációs készség - Akarat - Kitartás - ... további részletek >>

Célok Akinek felkeltettem az érdeklődését és szeretne a munkatársam lenni, írjon!


Feladva: 2017-01-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekHálózatépítőketÉrtékesítőketszeretneAkivállalkozóAkaratcéljaikmindenbelülnyugdíjaskészségvannakországidőnírjondiákkommunikációséletükben

Forrás: pepitahirdeto.multiapro.com

Velence-korzón Novotny Hajgyógyászat és Biofodrászat szépség szalon! Nemzetközi diplomával rendelkező hajgyógyászunk várja szeretettel. 20 éves tapasztalattal személyre szabottan analizáljuk és megoldjuk problémáját: - hajhullás - roncsolt haj Kezelés színenergiával és biológiailag aktív hatóanyagokkal. Tudományos, orvos-technikai módszerek, mikro-kamerás haj- és fejbőr vizsgálat. Vegyszermentes hajfestés, dauerolás. Kérjen időpontot!


Feladva: 2016-11-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: NovotnyhajVelenceHajgyógyászatbiológiailagévesfejbőrszínenergiávalszeretettelkorzónKezelésvárjakamerásroncsolthajgyógyászunkmikroGabriellahajhullás

Forrás: pepitahirdeto.multiapro.com

Szálláshelyek és szállásfoglalás Erdélyben. Foglalja le már most erdélyi szálláshelyét, nyaralásához. Erdelybe.hu és szallas-erdely.hu oldalainkon válogatott erdélyi szálláshelyeket találhat. Szálláshelyeinknen már többezer elégedett vendégünk megfordult. Az erdélyi szálláshelyek közül csak a legjobbakat válogattuk ki Önnek, hogy egyszerű legyen a választás.


Feladva: 2017-02-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekerdélyimárErdélybentöbbezerszálláshelyétÖnnekmostválogattukSzálláshelyeinknenFoglaljalegjobbakattalálhatcsakszálláshelyeketszállásfoglalás

Forrás: pepitahirdeto.multiapro.com

KARIKATÚRA 1 NAP ALATT ESKÜVŐRE, ÜNNEPEKRE VAGY BÁRMELY ALKALOMRA! KÜLDJE EL A LERAJZOLANDÓ FOTÓJÁT, 1 NAP ALATT ELKÉSZÍTEM A PROFI RAJZOT, 1 NAP ALATT MEGKAPJA A KÉSZ MUNKÁT. EGYEDI AJÁNDÉK BÁRMIKORRA! KUSTANSTUDIO - TÖBBezer ELÉGEDETT ÜGYFÉL! 70 3347285 Lépj be a profi karikatúrák világába: www.77rolo.wixsite.com/kustanrolan d


Feladva: 2017-04-14    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ALATTNAPKARIKATÚRAprofiBÁRMIKORRALERAJZOLANDÓhttpsAJÁNDÉKKÜLDJEvilágábaEGYEDIALKALOMRAkarikatúrákMUNKÁTBÁRMELYKÉSZVAGYLépjMEGKAPJAÜNNEPEKRE

Forrás: pepitahirdeto.multiapro.com

Használt mobiltelefonok, tabletek, laptopok eladása, szoftveres szervizelése Látogass el weboldalamra, várlak szeretettel!


Feladva: 2017-09-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: laptopokKaisertabletekmobiltelefonokHasználtszeretettelTatabányavárlakajánlóweboldalamraHirdetőLátogassPepitaszervizelésewebáruházszoftveresSzerviz

Forrás: pepitahirdeto.multiapro.com

Bécsi úti referenciaszalonba felelősségteljes, munkájára igényes lelkes és kreatív, a szakma iránt elkötelezett fodrász munkatársat keresünk! Ha érdekelnek a vegyszermentes csúcs technológiák, és a környezet tudatos anyagok, és szeretnéd a legjobbat ajánlani vendégeidnek, nálunk a helyed! Elérhetőség: 20/ 323-7254-s számon!


Feladva: 2017-05-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkanyagokirántBudapestszámontudatosszakmaGabriella7254környezetkreatívNovotni323technológiáklelkesFodrásztElérhetőségcsúcsigényeshelyed

Forrás: pepitahirdeto.multiapro.com

Segítünk berendezni, kérje Önnek szóló ajánlatunkat: www.hu-mago.hu/boltok-tervezese-sz erelese Vállaljuk boltok: felmérését, tervezését, látványterv készítését, összeszerelését, bontását. Szolgáltatásaink: » Boltok tervezése, szerelése » Bevásárlókocsi felújítás » Galvanizálás » Raktári állvány építés » Sorompó telepítés Új és használt forgalmazott termékeink megtekintéséhez látogasson el weboldalunkra!


Feladva: 2017-04-17    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 187BoltokszerelésetervezéseösszeszerelésétkérjeállványkészítésétweboldalunkraberendezniRaktárilátványtervlátogassonSegítünkGalvanizálástervezésétmago

Forrás: pepitahirdeto.multiapro.com

Az endometriózis esetén terápiák léteznek, melyek gyógyszeres kezelést, hormonpótlást vagy laparoszkópiás műtétet, végső esetben pedig a méh eltávolítását foglalják magukban. Ám létezik több alternatív módszer is, amivel megpróbálhatjuk legyőzni a betegséget. Az endometriózis tünetenyhítés egyik módja lehet az akupunktúra, a mozgás, a relaxáció, meditáció, melyek segítenek megküzdeni a többféle betegséget okozó stresszel. A legújabb nézetek szerint az endometriózis diéta is sikeres lehet, ... további részletek >>

mellyel csökkenthetjük a méreganyagok mennyiségét a szervezetben, ezzel a hormonháztartás egyensúlyáért is sokat tehetünk.


Feladva: 2018-02-15    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: endometriózisbetegségettünetenyhítéslehetmelyekszerintlaparoszkópiásrelaxációezzeltöbbnézetekvagymozgásszervezetbenléteziklegújabbhormonpótlástméh

Forrás: pepitahirdeto.multiapro.com

KAMIONOS állásajánlatok Németországban. Általános infóink a sofőr állásokról: www.nemetmunka.hu/sofor.html Konkrétumok- SOFŐR Szerződött Bajor Speditőr partnerünk (NEM Zeitfirma, nem török, román, stb- hanem német cég) részére keresünk gépkocsivezetőt CE jogosítvánnyal és 95-ös bejegyzéssel és a kamionos álláshoz szükséges némettudással. Próbamunka nincs. Személyes állásinterjú után azonnali munkakezdés van. A telephely egy Rosenheimtől nem messze lévő faluban van. A fizetés ... további részletek >>

2000-2200€ bruttó. A cég Németországi és Olaszországi fuvarozást végez. A napidíj Németországi fuvaroknál 24€/nap nettó, Olasz fuvaroknál 34€/nap nettó. A fizetés és a napidíj együtt adókategóriától és fuvaroktól függően kb. 1800-2000€ nettóra jön ki. A telephely és Budapest között kb 600km a távolság. Hétvégi hazautazás gyakorlatilag 2 hetente lehetséges, mert az egyik héten 2 fuvar van hétfőtől péntekig, a másik héten pedig 3 fuvar van hétfő kora reggeli indulással és szombat délelőtti visszaérkezéssel. Jelentkezni lehet: (e-mailben, regisztrálással vagy telefonon) 1./ E-mailben: info@nemetmunka.hu 2./ Ingyenes regisztrációval a következő linkre kattintva: www.nemetmunka.hu/regisztracio-nemetorszagi-munkavegzesre.html Várjuk régi regisztráltjaink újbóli jelentkezését is. 3./ Telefonon munkaidőben a magyar 06 1 920 3433 ill. a német 0049 8641 6949 000 vezetékes számokon. (hétfőtől péntekig 9,00-17,00-ig) Josef Kling Német Munka Team = EXACT Personal UG (német munkaközvetítő cég Bajorországban) Cégjegyzék száma: HRB 25122 Traunstein (közvetítési vagy egyéb díj nincs)


Feladva: 2017-10-14    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: Németvan8364SOFŐRnemnemetmunkawwwkamionoscégtelephelyMunkafizetésnettóhtmlnincsnapfuvaroknálmailben2000péntekigvagyhétfőtőlNémetországi

Forrás: pepitahirdeto.multiapro.com

Olcsó, gyors személyszállítást végzünk Ausztriába, Németországba


Feladva: 2017-03-24    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: NémetországbavégzünkszemélyszállítástgyorsOlcsóBudapestEutaxiKisbusszalAusztriába

Forrás: pepitahirdeto.multiapro.com

Már több éve tagja vagyok egy MLM vállalatnak, de csak lassan tudtam haladni az online munkával. Nem igazán ment. Nem a vállalattal volt a hiba, hiszen láttam, hogy sokan milyen szépen gyarapodnak, haladnak. A DXN tökéletes választás volt. Már közel álltam, hogy kimondjam: ez nem nekem való, nekem nem megy. Kb. másfél hónapja szponzorom megmutatott egy új eszközt, ami segíthet nekem is. Gondoltam, mit veszíthetek, kipróbáltam. Eleinte szkeptikus voltam, de jöttek az eredmények. Egy hónap alatt, ... további részletek >>

többen csatlakoztak hozzánk, mint előtte lévő évben összesen. Felcsillant a remény, hogy ezzel én is tudok eredményesen dolgozni! Nagyon megszerettem ezt az automata eszközt! Így már én is meg tudom csinálni. Csatlakozz a csapatunkhoz, hogy kipróbálhasd Te is ingyenesen magadat és az eszközt! Ha dolgozol, garantált a siker, és ez nagyon jó érzés.


Feladva: 2017-09-29    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogynemmárnekemEgyeszköztvoltNagyonÍgyösszesenközelgarantáltingyeneseneredményekhiszenautomataamivállalatnakévbensikerkipróbálhasdjöttek

Forrás: pepitahirdeto.multiapro.com

Szabaduljon meg adóssággal terhelt cégétől, akár több milliós tartozás esetén is. Eladósodott veszteséges, banki vagy köztartozással terhelt,tagi hitel és házipénztár gondokkal küzdő, csődközeli cégek ÁTVÉTELE, kiközvetítése belföldi partnerek részére. Hivatalos, gyors ügyintézés, jogi garanciával. (Végrehajtás, végelszámolás NEM AKADÁLY) 15 MFt feletti adósság esetén is! Problémás cégek adás vétele, ügyvezető kölcsönzés, cégalapítás.


Feladva: 2016-05-27    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: cégekeseténterheltSzabaduljonNEMkiközvetítésebankiügyvezetőKatalinvégelszámolásÁTVÉTELEveszteségesvételeMagyarVégrehajtáscsődközeliEladósodottadás

Forrás: pepitahirdeto.multiapro.com

Rácsos gyerekágy kókuszmatraccal, m: 80 cm, h: 120, sz: 60 + állványos kád fehér + etetőszék fehér eladó 15000.- Ft.


Feladva: 2018-02-24    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: gyerekágyRácsoseladófehérBudapest15000Brenneretetőszékkádállványos120kókuszmatraccal

Forrás: pepitahirdeto.multiapro.com

Kéményajtó légbevezető, forgalmazása, beépítése és egyéb légtechnikai rendszerek kiépítésével foglalkozunk. Termékeink megvásárolhatók webáruházunkban, a www.kemenyajto.com oldalon


Feladva: 2013-10-25    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kemenyajtoforgalmazásalégbevezetőhttpWebáruházunkbanbeépítésmegvásárolhatókTermékeinkfoglalkozunkkiépítésévelrendszereklégtechnikaioldalonegyébcom

Forrás: pepitahirdeto.multiapro.com

Magyarország legnagyobb óriáscsúszdás oldala! Szabadtéri és fedett élményfürdők, ahova rossz idő esetén is érdemes menni...


Feladva: 2016-11-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: óriáscsúszdásStrandokoldalalegnagyobbMagyarországMagyarországonFürdők

Forrás: pepitahirdeto.multiapro.com

Családi vállalkozásunk több évtizedes tapasztalattal áll mindennemű parkettás munkában Budapest és környéke lakosságának rendelkezésére. Pontos megbízható kivitelezés. Garancia munkáink a honlapon találhatók. Igény esetén szobafestő, mázoló, tapétázó szakembert tudunk ajánlani, akivel régi jó munka kapcsolatban állunk.


Feladva: 2017-01-05    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BudapestparkettaIgényBarabásmunkatalálhatókmunkábanlakkozásrégihonlaponparkettásakivelmunkáinkmindenneműcsiszolásajánlaniGaranciaálltudunktöbb

Forrás: pepitahirdeto.multiapro.com

Több mint ezer féle divatékszer és kiegészítő, mobil és táblagép kiegészítő, kozmetikai cikkek, ásványok, csillámtetoválás, pénztárca, tetoválás, óra, piercing és még sok minden más a lehető legjobb árakon. Rengeteg állandó és aktuális, egymással összevonható kedvezmény! Törzsvásárlói program és ingyenes kiszállítás! Ez mind és még sok minden más a LILI BIZSU Webáruházban. Ilyen olcsón még nem vásárolt....


Feladva: 2017-02-18    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: mégsokkiegészítőBIZSULILImásmindenlegolcsóbbanRengetegvásároltkozmetikaimindkiegészítőkárakonnemkiszállításÉkszereklegjobbtáblagépingyenesóra

Forrás: pepitahirdeto.multiapro.com

Tisztelt Hölgyem, Uram! A Szuvorov Kft. édesipari termékek importálásával és forgalmazásával foglalkozik. Szeretnénk, hogy minél több helyen jelenjenek meg termékeink, ezért várjuk viszonteladók jelentkezését! Szerződött partnereinknek akár kizárólagos forgalmazási jogot tudunk biztosítani, terület megjelöléssel! Az ország távolabbi pontjain található kiskereskedelmi egységek számára, (megrendelt mennyiségtől függően) ingyenesen szállíttatjuk ki megrendeléseiket. Termékeink ... további részletek >>

megtekinthetőek a honlapunkon.


Feladva: 2016-10-13    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: TermékeinkSzuvorovtalálhatóUramakárminélpontjainHölgyempartnereinknekhogymegrendeléseikettávolabbiTiszteltSzerződöttSzeretnénkszállíttatjukország

Forrás: pepitahirdeto.multiapro.com

Hatékony német tanulás otthon, a Te beosztásodhoz igazítva, ingyen!


Feladva: 2016-12-18    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: németHatékonyZsuzsaKulcsárTanfolyamOnlineingyenigazítvabeosztásodhozotthontanulás

Forrás: pepitahirdeto.multiapro.com

Non Stop Lakatos Budapest! Non-Stop Zármentés Budapest. A Non Stop Zárszerviz Budapest és környéke vállalja zárak cseréjét és javítását, postaládák zárcseréjét. Hevederzárak szerelése, javítása. Ellopták a kulcsait?Illetéktelen személyhez került a kulcs? Zárcsere!Ne váljon betörés ill. lopás áldozatává! A zárcserére és a biztonságtechnikára fordított összeg, többszörösen megtérülhet! Minket éjjel-nappal hívhat, mindig fix árakon dolgozunk. Munkánkról és a beépített anyagokról mindig ... további részletek >>

számlát és garanciát adunk! Tehát zárcsere, zárszerviz, lakatos munkák, vagyonvédelem és hevederzár szerelés Budapesten. Zárjavítás Budapest 0-24! Műanyag bejárati ajtó javítás és zárcsere. Felhúzó kilincses ajtók javítása és zárcseréje garanciával. HI-SEC ajtó zárcsere és javítás. Az elvégzett munkára és a beépített anyagokra garanciát adunk! Hevederzárak kínai ajtókra is! Kínai ajtó zárcsere és javítás. Hívjon bizalommal, minőség és szakértelem megfizethető áron! Hevederzár szerelés Budapesten és Pest Megyében. Minőségi hevederzárak kedvező áron, akár 3 év garanciával. Gyors és precíz, kiváló szakmunka a hevederzár specialistától! Személyre szabott vagyonvédelmi szaktanácsadás. A legjobb hevederzár árak! Biztibuk hevederzár, Prezidium hevederzár. Hevederzár zárbetétek kedvező áron. Hevederzár zárcsere, olcsón minőségi anyagokkal. Hevederzárak műanyag ajtókra is!!! Hevederzár kínai ajtóra is!!! Hívhat non-stop!


Feladva: 2016-10-12    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: HevederzárzárcserenonStopBudapestHevederzárakkínaizárszervizjavításajtóáronlakatosajtókraműanyagjavításagaranciávalmindigminőségiadunkgaranciát

Forrás: pepitahirdeto.multiapro.com

Nálunk megtalálod álmaid ruháját, vagy kedvenc nadrágodat.. Netán a varrogatáshoz nélkülözhetetlen cipzárat és gumit. Éjjel-nappal nyitva vagyunk, de azért ne telefonálj, csak illendő időben... E-mailt viszont bármikor küldhetsz: in fo@ionixdivat.hu Nézd meg - válaszd ki - rendeld meg - vedd fel!!


Feladva: 2016-04-24    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: megvagymegtalálodviszontcsinosgumitNálunkmailtEgycipzáratfelWEBÁRUHÁZidőbennélkülözhetetlenveddDIVATillendővarrogatáshozIONIXcsaknetánazért

Forrás: pepitahirdeto.multiapro.com

Az álmok jelentése a legtöbb embert érdekli. A tudomány sem cáfolja azt a nézőpontot, miszerint álmunkban legbensőbb világunk jelenik meg, félelmeink, vágyaink, reményeink vetülnek ki különböző fantáziákba szőve. Az álom működése azonban még ma sincs teljesen megfejtve. Hogy mit üzennek, gyakran csak találgatni tudjuk, máskor pedig egészen egyértelmű, hogy a napközben átélt helyzeteket dolgozzuk fel általuk. Az álmok megfejtése napjainkra egyfajta “tudományággá” vált, sokszor ... további részletek >>

segítségül hívhatjuk a különböző lelki problémák, konfliktus- és stresszhelyzetek feldolgozásához.


Feladva: 2016-11-08    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: jelentéseálomhogykülönbözőmégálmoktudjuksegítségülműködésefelálmunkbantalálgatniKittisokszordolgozzukmiszerintcsakKellérváltszővehelyzeteket

Forrás: pepitahirdeto.multiapro.com

Gerincsérv, derékfájás, lumbágó, isiász, hátfájás, porckorongsérv, térdfájdalom, ízületi fájdalom? Meglepő fájdalomcsillapító tapasztalatok egy 7 perces VIDEÓban! 4 ember mondja el tapasztalatait és azt, hogy pontosan mit csinált!


Feladva: 2015-12-08    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Gerincsérvizületitapasztalataitporckorongsérvmondjahátfájás33580emberisiász4124VIDEÓbanlumbágóclikapercderékfájáshttptapasztalatokcsináltMarcsi

Forrás: pepitahirdeto.multiapro.com

Keress pénzt új közösségi oldal népszerűsítésével! www.szinek.hupont.hu/147/penzkeres eti-tippek


Feladva: 2018-02-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: közösségipénztKeresstippekKecskemétpenzkeresetiIlona147SzabóhupontmunkaszinekOtthonihttpnépszerűsítéséveloldal

Forrás: pepitahirdeto.multiapro.com

A Meiszter Apartmanok Balatonlelle szabad strandja mellett kiadó apartmanházak. A kétszintes kertes házak a Balaton partjára vezető utcában kb. 80 méterre a vízparttól fogadja a vendégeit. A házak két szintjén 1 és 2 szobás apartmanok 2-4 fő számára nyújtanak kényelmes szállást. Valamennyi lakrész saját konyhával, fürdőszobával, erkéllyel vagy terasszal rendelkezik. Kitűnő vízközeli szálláslehetőség pároknak, gyerekekkel érkező családoknak. Mini apartman 2 főre részére, konyhával, terasszal. ... további részletek >>

Apartman 4-5 főre 2 hálószoba, minikonyha, fürdőszoba, terasz vagy erkély. Apartman 6 főre 3 hálószoba, konyha, nappali, 2 fürdőszoba, terasz. Szobák: 2-3 fős fürdőszobás szobák, erkéllyel vagy terasszal itt a konyha közös. Az árak irányárak!


Feladva: 2018-02-23    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: ApartmanvagyfőreBalatonlelleterasszalapartmanokerkéllyelszobákkonyhávalházakteraszfürdőszobakonyhahálószobaMeiszterpartjáraerkélyTamásKitűnőkét

Forrás: pepitahirdeto.multiapro.com

Készítünk bármilyen méretben hordó szaunát, Mérettől függően e-mailben vagy telefonon konkrét ajánlatot adunk. A hordó szauna remek kiegészítője lehet a fürdő dézsának. Nagyon jó ár-érték arány! 06203979102 pollakferi@icloud.com


Feladva: 2017-09-15    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: hordószaunacomMérettőlpollakferi@icloudremekszaunát06203979102méretbenfurdodezsakbármilyenwwwadunkKészítünkarányajánlatotTatabányaértékkonkrét

Forrás: pepitahirdeto.multiapro.com

Tulajdonságok: - LED televízió, 40 cm (15,6”) képátlóval - USB bemenet - HD DVB-T/C közvetítés USB feljátszása - Időeltolódás funkció (Timeshift) - Multimédiás fájlok lejátszása pendrájvról - Támogatott formátumok: DivX, XviD, MP3, WMA, JPEG - Dinamikus kontraszt: 8.000:1 - Fényerő: 300 cd/m2 - Visszahatási ütemidő: 5 ms - HD READY (1366 x 768) - Beépített HD DVB-T/C (MPEG4, MPEG2) tuner - PAL, SECAM BG/DK/I/NICAM, AV bemenet i NTSC 4,43 - Képfelbontás: WXGA 1366 x 768 Px - ... további részletek >>

Látószög: 150°/150° - Elektronikus műsorkalauz (EPG) - Teletext - Több nyelvű menü - Digitális fésűs szűrő (DCF) - ZOOM - Ekvalizer - Kikapcsolás-időzítő - Automatikus kikapcsolás - Gyermekóvintézkedés - Hotel üzemmód - Kimeneti teljesítmény: 2x 3 W - VESA méretben (100 x 100 mm) - Csatlakoztatható: HDMI, SCART, AV bemenet, VGA, PC Audio bemenet, USB, CI slot - Fogyasztása készültségi üzemmódban: 20 W / 0,5 W - A készülék méretei (sz x ma x mé): 376 x 240 x 38 mm - Méretek állvánnyal (sz x ma x mé): 376 x 274 x 120 mm - Tömege (készülék/csomagolás): 1,3/2,5 kg Ugrás a televízióhoz: www.aqua.hu/sencor-sle-1660m4-156-hd-ready-led-tv-303503.html


Feladva: 2017-07-15    [TV - Hifi - Házimozi]

Címkék, kulcsszavak: bemenetUSBledready1660m4768sleDVB3761366sencorkikapcsolás100készülék150LátószögTimeshiftKimenetiMPEG4Pepita274fésűsWMAfunkcióüzemmód

Forrás: pepitahirdeto.multiapro.com

Szekrénysor LED világítással. A szettbe beletartozik két álló vitrin, egy tv állvány, és egy lebegő polc. Rendelhető több színben: www.brwbutorhaz.hu/modern-szekreny sor-3112


Feladva: 2017-09-22    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: szekrenysoregymodernwwwbeletartozikszínbenszettbetöbbvilágítássalRendelhetőLEDpolcajánlólebegőHirdetőPepita3112állványvitrinállóbrwbutorhaz

Forrás: pepitahirdeto.multiapro.com

Vendégházunk a szabad strandtól kb 50 méterre, a Kecskeméti utca végén található. Két hálóval és egy hálóként használt nappalival a ház 4-6 fő részére kínál partközeli szállást. A házban 2 háló, egy előszoba, két fürdő és felszerelt konyha található. Az udvarban bográcsozási, grillezési lehetőség. Parkolás a zárt udvaron. A házba kutya és egyéb háziállat díjtalanul hozható! Létszám és a foglalni kívánt időszak megjelölésével kérje ajánlatunkat.


Feladva: 2017-12-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: egyméterretalálhatóstrandtólszabadházkétkívánthálókéntParkolásCsikósfoglalnihálóvallehetőségkiadóhálóLétszámvégéngrillezésiönállóházbanutca

Forrás: pepitahirdeto.multiapro.com

Modern és klasszikus olasz gyerekbútorok prémium kivitelben. Számtalan színből és elemből válogathat. Látogasson el üzletünkbe. 1093 Budapest Közraktár utca 20./a Telefon: 061-215-33-74


Feladva: 2017-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: olaszwwwBudapest1093klasszikusmatracfutarüzletünkbeModernLátogassonBútoráruházlineaflexbutorválogathatLineaflexwebelembőlgyerekbútor215színből061

Forrás: pepitahirdeto.multiapro.com

Minőségi bőr karkötők nagyon kedvező áron a Lili Bizsu webáruházban Emellett több mint ezer féle ékszer és divatkiegészítő egy helyen kedvezményekkel. www.lilibizsu.hu/modules.php?name= lista&id=5883b7ed4x58x-BOR


Feladva: 2018-01-23    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: karkötőkbőrBizsuLiliféleezermintMinőségitöbbWEBÁRUHÁZEmellettolcsónwebáruházbankedvezményekkelhelyenegyárondivatkiegészítőkedvezőékszernagyon

Forrás: pepitahirdeto.multiapro.com

A noni termékek A-, B-, C- és E-vitaminokat, nátriumot, magnéziumot, káliumot, vasat és sok antioxidánst tartalmaznak. Minden korosztály számára fontos tápanyagok ezek, melyekhez a gyümölcsből természetes formában juthatunk hozzá. A noni ital sokféle hatását nemcsak a polinéz törzsi gyógyítók tapasztalatai alapján ismerjük, de ma már a tudományos alapokon végzett vizsgálatok eredményei is sokat mondanak ennek a gyümölcsnek az előnyeiről. Több mint 100 bioaktív hatóanyagával már a sejtektől ... további részletek >>

segíti egészségünk megőrzését, immunerősítő és gyulladásgátló hatással is rendelkezik. Noni rendelés webshopunkban!


Feladva: 2017-07-26    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: Nonimárgyógyítókjuicegyümölcsbőlsegítimondanakvasattörzsimelyekhezsejtektőlsokatkáliumotpolinézwebshopunkbanezekeredményeimagnéziumotnemcsak100

Forrás: pepitahirdeto.multiapro.com

Készbeton szivattyúzásához rendelhet nálunk beton pumpát vagy pumix-ot huszonhárom méteres gémhossztól egészen ötven méteresig, melyeket igény esetén meg is lehet hosszabbítani földre fektetett csövek összeszerelésével. Készbeton szivattyúzási óradíjainkat megtalálja weboldalunkon!


Feladva: 2014-07-04    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: Készbetonbetonarhosszabbítanihuszonháromwwwlehetpumixweboldalunkonmegvagymegtaláljaeseténpumpátóradíjainkatigénybetonszivattyúzásimelyeketnálunk

Forrás: pepitahirdeto.multiapro.com

Minden gépjárműre, személyautóra, kisteherautóra, kamionra traktorra, buszra készítünk méret pontos üléshuzatot. Legalább 100 fajta anyag minta közül választhat. UV álló anyagok, gyári kárpit anyagok, utángyártott anyagok, elasztikus anyagok, szövetek, között válogathat. A különböző színű, mintájú, vagy minőségű anyagok összevariálásának csak az ön fantáziája szabhat határt. Vásárolhat nálunk trikó üléshuzatokat, valamint univerzális üléshuzatokat is. Várjuk szeretettel. Tekintse ... további részletek >>

meg weboldalunkat: huzatkiraly.hu Bán&Vincze BT Kecskemét, Jókai utca 41 Telefon: 0630/911-1277 - 0630/4853749


Feladva: 2016-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: anyagokVinczeBán0630üléshuzatokatKecskemétkárpitvalamintpontosminőségűüléshuzatgyáritrikóméretvagyMéretpontoshuzatkiralyállónálunkkészítünk

Forrás: pepitahirdeto.multiapro.com

Bogács üdülőövezetében a Termálfürdőtől, horgásztótól öt perc sétára önálló vendégház kiadó. Pihenjen családjával, barátaival úgy, hogy csak ismerősök vegyék körül! Itt nem kell idegenekhez vagy a tulajdonoshoz alkalmazkodnia. 2014 óta változatlan árakkal várjuk vendégeinket.


Feladva: 2017-01-24    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: kiadóvendégházBogácscsaládjávalNórakellPihenjenvendégeinketKozmánénemvárjukBogácsonIttárakkalkörülönállóváltozatlanvegyéksétáraótaismerősök

Forrás: pepitahirdeto.multiapro.com

Amennyiben Önnek, vagy a cégének jogi problémája az alábbiak valamelyikével összefügg, keressen bizalommal! Gazdasági jog: - gazdasági társaságok alapítása, működésükkel kapcsolatos ügyek, egyéb cégjogi kérdések - cégek szerződéses vitái, cégek közötti kártérítéses ügyek - csőd, felszámolás Munkajog: - munkaviszonnyal kapcsolatos ügyek Polgári jog: - szerződésekkel kapcsolatos ügyek - szerződéskötés, azok teljesítésével kapcsolatos problémák, szerződések megszüntetése stb... - ... további részletek >>

ingatlan adásvételi szerződések - öröklés - tulajdonjog - kártérítés - élettársi kapcsolatokkal összefüggő kérdések, vagyoni viszonyok Családjog: - válás - gyermek elhelyezés - házassági vagyonjog Büntetőjog: - gazdasági, illetve vagyon elleni bűncselekmények Sportjog: - átigazolási és fegyelmi ügyek, ezekhez kapcsolódó speciális munkajogi kérdések, hivatásos és amatőr szerződések - sportszervezetek alapításával, működésével kapcsolatos ügyek - szponzorálási és arculat-átviteli szerződések


Feladva: 2017-07-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ügyekkapcsolatosszerződésekkérdésekgazdaságijogbizalommalcégekszerződéseselhelyezésvalamelyikévelezekhezadásvételiHirdetőátviteliházasságialábbiak

Forrás: pepitahirdeto.multiapro.com

Megújult műsorral, új felállásban vállalunk fellépéseket: - falunapokon - céges rendezvényeken, bálokon. Hívjanak bizalommal. Élőzenés előadás, nem playback! Elérhetőségek és ízelítő a műsorokból a honlapon hallgatható formában. CD rendelést felveszünk Ének: Lehoczky Judit - retró - örökzöldek (angol, német, olasz nyelven) - magyar nóta - csárdások - cigány dalok - mulatós - operett német nyelven - német slágerek (német nyelven)


Feladva: 2017-04-04    [Zene - Hangszer]

Címkék, kulcsszavak: németnyelvenhonlaponJuditLehoczkyÉneklehoczkyjuditBennünketolaszkezdjükhttpBizalommalangolfelállásbanhallgathatóhívjanakörökzöldekműsorralbálokon

Forrás: pepitahirdeto.multiapro.com

Leszakadt a redőnye? Hívjon! 0670 68 08 268 Szorul? Hívjon! 0670 68 08 268 Akadozik? Hívjon! 0670 68 08 268 Gyors redőnyjavítás akár azonnal egész Győr-Moson-Sopron megye területén, szükség esetén hétvégén is. Új és régi redőnyök szerelését vállaljuk rövid határidővel (egy hét), kedvező áron. Szalag függöny, Zsalúzia, Reluxa, Napellenző, Szúnyogháló +36 70 68 08 268 Új árnyékolástechnikai berendezést szeretne, de nem tudja, kihez forduljon? Hívjon bizalommal: 15 éves tapasztalatommal ... további részletek >>

készséggel állok rendelkezésére.


Feladva: 2017-04-25    [Lakossági szolgáltatás]

Címkék, kulcsszavak: Hívjongurtnicsereredőnyjavítás268redőnyszerelés0670szúnyoghálónapellenzőhupontreluxahttpajtóműanyagGyőrredonyszredőnyökazonnalfüggönyrégiakár

Forrás: pepitahirdeto.multiapro.com

Szalonunkban a hajhosszabbítás, hajdúsítás gyakorlattal (1997), egyedi hajfelvarrással illetve csomózással, európai póthajjal készül. Hozott hajjal is pótolunk! Látogass el honlapunkra, Facebook-ra: facebook.com/hajhosszabbitas.hajdus itas


Feladva: 2017-01-02    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: facebookhajdúsításhajhosszabbításCsepelcomilletveSzépségszalonhajfelvarrássalCityhonlapunkraegyediLátogass1997pótolunkgyakorlattalhajjalHozottXXI

Forrás: pepitahirdeto.multiapro.com

Esküvőre, családi rendezvényre, céges összejövetelre, felvonulásokra, koszorúzásra csak minket hívjon! Emelje rendezvénye fényét a Pomázi Tűzoltózenekarral!


Feladva: 2017-09-27    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: PomáziTűzoltózenekarkoszorúzásrafelvonulásokraösszejövetelreTűzoltózenekarralcégesrendezvényrefényétcsaládirendezvényeEsküvőreEmeljeajánlóhívjonHirdető

Forrás: pepitahirdeto.multiapro.com

ÜZLET AHOL SENKI NEM VESZÍTHET! SunMoney az első világot behálózó KÖZÖSSÉGI NAPERŐMŰ PROGRAM - Az üzletet építheted online is - Itt nincs havi kötelező befizetés - Itt nem terméket kell venni, hanem egy termelő eszközt vásárolunk


Feladva: 2016-09-05    [Pénzkeresés - MLM]

Címkék, kulcsszavak: nemIttsunmoneywebofficeSENKIegyonlinehttpsAHOLhanemépíthetedRegisztrációÜZLETvenniüzletetcomTiborkellPROGRAMsunmoneyonlineNaperőművedbotibi

Forrás: pepitahirdeto.multiapro.com

A Piccolo Café Itália kávézóinak hangulatát hozza el Budapestre. Espresso alapú kávéinkhoz Caffé Danesit, egy méltán híres római kávé különlegességet használunk. Konyhánkat az egyszerűség, az egészséges táplálkozás és az olaszos ízek jellemzik. Paninit, szendvicseket szolgálunk fel kedves vendégeinknek, illetve igen népszerű nálunk az igazi olasz street food, az Emilia-Romagna tartományból származó Piadina (olasz lepénykenyér) is. Kávézónkban a hagyományos és paleo sütemények is kaphatók.


Feladva: 2016-01-02    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: olaszCaféPiccoloBudapestPaninithagyományosrómaiigazihangulatátjellemzikKávézónkbanhíresnálunkkávézóinakízeklepénykenyérméltánnépszerűItáliaegy

Forrás: pepitahirdeto.multiapro.com

Fashion Plus divatos női ruha webáruház, naponta bővülő divatos női ruha kínálattal, és akciókkal ajándékozza meg látogatóit. Napi Fashion Plus divat tippek a divatos női ruha webáruház kínálatát felsorakoztatva kiegészítőkkel és szép divatfotókkal, a legjobb divat tippeket nyújtja a divat és női ruhák szerelmeseinek. Női ruhák és alap darabok, pulóverek, pólók, divatos nadrágok, divatos szoknyák, kabátok és kiegészítők bő választéka!


Feladva: 2016-10-29    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: NőidivatosruhadivatPlusFashionruhákwebáruházdarabokkiegészítőkkelajándékozzaalapfelsorakoztatvaakciókkalkínálatátválasztékakínálattalkiegészítők

Forrás: pepitahirdeto.multiapro.com

Minőségi, bontatlan bálás használtruha, számos fajtáit kínáljuk, értékesítés céljából, különböző kategóriákba sorolva. Friss gyűjtésű, szezonális, minőségi import, gyerek használtruha, felnőtt használt ruha, használt munkásruha, és lakástextil, valamint ágynemű. Nyers bálásruha, és válogatott, zsákos kiszerelések! Érintetlen, eredeti csomagolások! Nagykereskedelmi árak, magánszemélyek részére is! Ingyenes házhoz szállítás országosan. Tel: 0670-579-1452 (Viber is!) Web: ... további részletek >>


Feladva: 2017-02-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: használtruhaminőségibáláshasználtimportNagykereskedelmibontatlanlakástextil1452FrisscsomagolásokGyulamunkásruha579sorolvaeredetiangol0670ruha

Forrás: pepitahirdeto.multiapro.com

Gordiusz zárvédő pajzs. Saját szabadalom. Amikor az interneten megvehető, majdnem minden zártípushoz a nyitó szerszám, ez a pajzs megbízhatóan véd minden nyitási módszer ellen. Külön zárszerkezet, az ajtó külső oldalára szerelve a zár kulcsnyílásának védelmére szolgál. Variációk száma 6000000. Nem kell pénzt költenie, drága betétekre, amiket utólag kívülről könnyű megrongálni. Házilag is felszerelhető, ha van korszerűtlen, vagy gyenge minőségű hevederzára, páncélajtója.


Feladva: 2015-10-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: pajzsGordiuszmindenzárvédőkellkülsőHázilagszerszámBudapestNemajtómegrongálninyitóPéter6000000zárszerkezetkönnyűzártípushozKnappszámaKülön

Forrás: pepitahirdeto.multiapro.com

Munkánkat telephelyünkön végezzük. Weboldalunkon minden információt megtalál rólunk!


Feladva: 2017-01-27    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: FalusimarásmegmunkáláscncvégezzüktelephelyünkönMunkánkatImre

Forrás: pepitahirdeto.multiapro.com

Ha Hévízre kíván jönni, nálunk kényelmes családias elhelyezésben részesül. Közel a belvároshoz, 500 m-re a tótól kínálunk kétágyas, fürdőszobás, erkélyes szobákat. Reggeli, kisebb étkezések elkészítésére lehetőség van, az udvarban pedig parkolási lehetőség. Részletesebben honlapunkon, illetve az elérhetőségeinken. Keressenek bennünket telefonon, vagy e-mailben, egész évben szeretettel várjuk vendégeinket!


Feladva: 2017-10-02    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: 245séglehetségeinkenkívánvanvendégeinkettótólHévízreelkészítésérevárjuk500elérhetHévizétkezésekszeretettelbelvároshozillZoltánnékisebbévben

Forrás: pepitahirdeto.multiapro.com

ANTENNA SZERVÍz 06 30 222 2912 Parabola antenna szerelés, közösségi antennák, karbantartás és átalakítás, MinDig tv DVB-T Földi digitális antenna, Upc Direct , forgatható parabola antennák szerelése, Kábel tv lakáson belüli javítása, elosztása, és a jelszint szakszerű erősítése, Elöregedett vagy tönkrement, nem használt régi tetőantennák, árbócok lebontása. Meglévő antenna házhálózatok javítása, fejlesztése.


Feladva: 2017-10-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: antennaparabolaszerelésantennákjavításaUpcnemjavításszerelésefejlesztésekarbantartástönkrementközösségivagyházhálózatokElöregedettforgatható2912

Forrás: pepitahirdeto.multiapro.com

Önálló vendégházunk Zamárdiban a József Attila utcában, csendes környezetben a Balaton parttól kb 500 méterre található. A ház 6-8 személyes, tökéletesen alkalmas családok, baráti társaságok számára. A házban 3 db háló, nappali, felszerelt konyha, fürdőszoba, és külön wc áll vendégeink rendelkezésére. Parkolás a zárt udvarban. A házat és az udvart kizárólag vendégeink használják. A szállás csak egyben bérelhető, külön szobákat nem tudunk kiadni. Létszám és a foglalni kívánt időszak ... további részletek >>

megjelölésével kérje ajánlatunkat.


Feladva: 2017-12-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: személyesvendégeinkÖnállókülönkívántalkalmasszállásutcábanfürdőszobavendégházfoglalnitökéletesenhasználjákAttilakonyhaszobásLétszámJózsefkiadni

Forrás: pepitahirdeto.multiapro.com

Cigány (lovari) nyelvoktatás, középfokú állami nyelvvizsgára szakszerű felkészítés (10 hét, 80 óra)! Vizsga- és oktatási anyagokat (órai jegyzeteket is) biztosítok cigány és magyar nyelven. A képzés helye: a Nyugati Oktató Központban Jelentkezés: az alábbi elérhetőségeken.


Feladva: 2015-05-08    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: 06204284486cigánylovariBudapestvagyVizsgaLászlóóraciganynyelvoktatasÁgostonJelentkezéshétwwwDemeternyelvenfelkészítéshttpKözpontbanmagyarLink

Forrás: pepitahirdeto.multiapro.com

Alumínium porfestés, színterezés Ablakok és ajtók, zsaluk, szúnyoghálók alumínium szerkezeti elemeinek, profiljainak, medencefedő szerkezetek elemeinek elektrosztatikus felületi kezelése porszórással a RAL-skála minden színében választható. Automatikus és kézi kabin. Kérje árajánlatunkat! Várjuk szíves érdeklődésüket. A porfestés folyamata képekben: www.femarkzsalu.hupont.hu/5/galeri a-porfestes


Feladva: 2017-03-14    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: alumíniumelemeinekporfestésKérjefelületiAblakokkabinelektrosztatikusszínterezéskéziAutomatikusszerkezetekZalaegerszegválaszthatómedencefedőKftminden

Forrás: pepitahirdeto.multiapro.com

Horvátország, Dalmácia, Zadari Riviéra. Budapesttől 630 km-re, 4 nemzeti park közelében, Zadartól 15 km-re északra Privlakán, közvetlenül a tengerparton 40.000 nm-en fenyőfák árnyékában helyezkedik el a Dalmacija Camp***Holiday Komplex, sekély, homokos, köves öböl szélén, jól kiépített stranddal, parti zuhanyozókkal. Itt minden megtalálható, élelmiszerbolt, zöldséges, pizzéria, bajor söröző, grillház, parti pub, étterem, gyerekjátszótér, szép, tiszta vizesblokkok, wifis pub, fagyizó. Itt ... további részletek >>

ajánlunk összközműves 4-6-8 fős, 2-3 szobás, nappali-konyhás, fürdő-wc-s, klímás, wifis, kábeltv-s mobil-home apartman házakat nagy terasszal, heti (heti 210 euro-tól) és telepített klímás, wifis, tv-s lakókocsikat (heti 30 e Ft-tól). 2007 óta várjuk érkező utasainkat. Áraink 10-20 %-al olcsóbbak a kemping árainál. Magyar iroda, programok, kölcsönző. Videó ajánlásaink: www.youtube.com/user/TravelVirServis


Feladva: 2017-04-13    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: hetiwifisHorvátországpartitólIttpubklímástisztaPrivlakánÁrainkmegtalálhatótelepítettkonyhásKomplexwwwszépészakrautasainkateuromindennappali

Forrás: pepitahirdeto.multiapro.com

VALTSD VALORA AZ ALMAIDAT A DXN-NEL LEGY ANYAGILAG FUGGETLEN Keress egy olyan terméket, amit minden nap fogyasztasz és beszélj róla másoknak is, mint eddig, amikor semmi anyagi érdekeltséged nem fűződött hozzá! Ilyen egyszerű! Semmi több! www.kaveido.ganodermakave.hu Két jó hírem van: Nem kell tovább keresned, megtaláltad ezt a terméket: a ganodermás kávét! Te is meg tudod csinálni! Kapcsolat ilonakovacs60@gmail.com Skype ilonakovacs1960


Feladva: 2017-09-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: VALTSDterméketSemmiNemALMAIDATVALORAkávétamitKétanyagiganodermásolyanganodermakaveilonaamikoregykaveidohorvathilonakovacs1960eddigeztKeress

Forrás: pepitahirdeto.multiapro.com

Ne szalassza el a lehetőséget, hogy részese legyen az egyik legnagyobb szállítási vállalatcsoportnak, amely 100 évre tervez es amely részvényeinek értéke állandóan nőni fog! A SkyWay részvények tulajdonlása jólétet biztosít majd Önnek és családjának! Tehát nem érdemes sokat késlekedni a befektetéssel! A Sky Way részvényeit 2018-ben viszi a tőzsdére 1 $ db áron!! A befektetésednek köszönhetően már a közeljövőben a részvényeid hozamából élhetsz.


Feladva: 2017-09-23    [Pénzkeresés - MLM]

Címkék, kulcsszavak: amelyrészvényeidélhetszhozamábólhogyrészvényeitmajdlehetőségetWaybiztosíttervezközeljövőbenszalasszaSkyjólétetévremárÁgibefektetéssel100sokat

Forrás: pepitahirdeto.multiapro.com

Nálunk a kár nem kár! Óde-Car - 19 éves tapasztalat - biztosítási ügyintézés - ingyenes kölcsönautó - minőségi munka, minőségi anyagokkal - rövid határidő - garancia - fejlett technológia - családias légkör - márkafüggetlenség - szaktanácsadás - megbízhatóság Óde-Car Kft. 1117 Budapest, Budafoki út 70. 06-20-9374-593 06-70-666-7777 o decarkft@gmail.com www.karosszeriatjavit.hu


Feladva: 2016-04-27    [Autó - Motor - Jármű]

Címkék, kulcsszavak: CarÓdebiztosításiBudapestKftkárminőségiügyintézésfejletttapasztalat1117garanciakarosszeriatjavitéveshatáridőwwwrövidcomnemanyagokkalNálunk

Forrás: pepitahirdeto.multiapro.com

Amerikában (Texas és New York államokban) szállodai és bentlakásos házvezetőnői állások, pároknak és hölgyeknek egyaránt” Leinformálható, megbízható, segítőkész!


Feladva: 2018-02-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: AmerikábanLeinformálható8221TexasegyaránthölgyeknekBudapestpároknakKleinállásokMirjamházvezetőnőimunkákbentlakásosszállodaisegítőkészállamokbanYork

Forrás: pepitahirdeto.multiapro.com

Küldje el digitális fotóját kedvencéről, családtagjáról, barátjáról s mi visszaküldjük 3 dimenziós formában, üvegkockába gravírozva! • A kép legalább 3 megapixeles és a file 800 KB vagy több legyen • Ha régi fényképet szeretne beszkennelni, akkor minimum 300 dpi-ben és .jpg file-ként mentse el! www.gravirexpressz.hu/2d-fotobol-3d-uveghasab-75×9×13-cm Üzleteink: Gravír Expressz Westend 1062 Budapest, Váci út 1-3. Középső szint, főbejárat - a Niagara vízesésnél jobbra a ... további részletek >>

Starbucks kávézóval szemben! Mobil: 06-20/922-2384 Tel./Fax: 06-1/238-7125 Gravír Expressz Mammut 1024 Budapest, Lövőház u. 2-6. Mammut I. 2. emeleti mozgólépcső Mobil: 06-20/922-2356 Tel./Fax: 06-1/345-8165 Gravír Expressz Pólus 1152 Budapest, Szentmihályi út 131. Mobil: +36-20/454-9634 Tel./Fax: +36-1/410-5080 Gravír Expressz Árkád Pécs 7622 Pécs, Bajcsy-Zsilinszky u. 11. A földszinten, az Intersparral szemben Mobil: 06-20/264-1170


Feladva: 2016-09-28    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ExpresszGravírMobilBudapestFaxTelfile8226szemben922PécsMammutSzentmihályimentseajánlóLövőházfényképetÁrkádszintüvegkockábakéntHirdető1170

Forrás: pepitahirdeto.multiapro.com

Weboldalak üzemeltetőjeként és keresőmarketingesként biztosan kijelenthetem, hogy az internetre tartalmakat elhelyezők döntő többsége egyáltalán nem foglalkozik azzal, hogy amit készít, az megjelenjen - például a Google - keresésekben! Végeztem egy saját felmérést, ami alapján úgy tűnik, van egy általános elképzelés arról, hogy ez a kereshetőség vagy: - magától megtörténik - nem a tartalom készítőjének a feladata - a szolgáltató dolga a kereshetőség biztosítása A válaszok alapján ... további részletek >>

megdöbbentem, de ezek után egyáltalán nem csodálkozom sokak internetes eredménytelenségén... Nem szeretnék játékrontó lenni, tehát a Pepita Hirdető szabad felületei változatlanul elérhetőek lesznek még a játszadozóknak is. Azoknak azonban, akik már a játszadozáson túl vannak, jó pár lehetőséget kínálhatok ingyenesen is és több-kevesebb befektetéssel egyaránt. A legkomolyabbaknak maximum 30.000 Ft éves költséggel! Automatákkal nem, automataként viselkedőkkel szintén nem, viszont azokkal, akik jó kereshetőséget szeretnének webtartalmaiknak szívesen beszélgetek, levelezek! Fentiek alapján ez NEM FELHÍVÁS hirdetés feladására, az legyen tudatos és tervezett inkább...


Feladva: 2017-05-30    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: NEMalapjánhogyegyakikegyáltalánHirdetőPepitavagykereshetőségtudatospárdolgainternetrewebtartalmaiknakelérhetőekáltalánosbetűkkelévesinternetes

Forrás: pepitahirdeto.multiapro.com

Befektetőt, társat keresünk, 50-100 Mft-tal, azonnal kezdhető társasházak építéséhez, közre működéssel vagy a nélkül. Biztos megtérülést, garanciát, biztonságot ajánlunk. Biztosan Ön is tudja, hogy most lakásokba megéri befektetni. Jelentkezni a haza i@upcmail.hu e-mail címen.


Feladva: 2017-10-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: építéséhezkeresünkBefektetőthogyközrepesttudjaKftBiztosantársasházakcímenFinancialajánlunkkezdhetőmailEurópabiztonságotazonnalhazai@upcmailtal

Forrás: pepitahirdeto.multiapro.com

Itt az idő, az ablakcsere ideje. Vásárolja Ön is nyílászáróját nagykerből 48% kedvezménnyel! Rendelje meg most ablakait és ajándékba adjuk az egyik ablakra a redőnyt vagy szúnyoghálót! (250000 Ft feletti rendelés esetén) IGLO5, IGLO5 CLASSIC •5 kamrás, •70 mm beépítési mélységű, •2x külső EPDM gumitömítéssel, •alap üvegezése 4/16 Ar/4 Low-e thermofloat üveggel, argon gázzal töltve, •Uw=0.92 W/m2K, •EN-674 szabványnak megfelelően, •MACO MULTI ... további részletek >>

MATIC KS vasalattal, •Lehetőség változó vastagságú üveg beépítésére Redőny, szúnyogháló, reluxa kedvező áron, rövid határidővel! További 5% kedvezmény nyugdíjasoknak és egyedülálló 2 vagy több gyerekes családoknak Látogasson el weboldalunkra, ahol részletes leírást talál termékeinkről. 2017. május 1-31. között regisztráló felhasználóink között ajándékokat sorsolunk ki, amelyet megrendelésével együtt szállítunk! Ajándékok: Hoppe Secustic kilincs 3 megrendelőnk minden ablakára, amelyet tőlünk rendel, Aereco légbevezető 5 lakásba, amelybe tőlünk rendelik a nyílászárókat.


Feladva: 2017-05-02    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: 8226vagyRedőnyAblakamelyetközötttőlünkIGLO5MULTIablakaitmájusLowEljöttamelybetöbbeseténHoppeszúnyoghálóMACOmost2017üvegezéseBudapestmeg

Forrás: pepitahirdeto.multiapro.com

A cukorbetegség egyre több embert érint, sokan nem tudják, hogy számos klinikai vizsgálat igazolta a BALZSAMKÖRTE, más néven karéla, keserű dinnye, keserű uborka, keserű tök vércukor szintre gyakorolt hatását és a testzsír felhalmozódás mértékének csökkentését. A cukorbeteg személyeknek, az elhízott vagy hízásra hajlamos személyeknek kifejezetten ajánlott! Megrendelés: www.herbcaps.com/hu_HU/webshop/ter mekeink/104/balzsamkoerte-kapszula. html vagy +36 (30) 856-39-74 telefonszámon


Feladva: 2018-02-09    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: keserűcomherbcapsvagyBALZSAMKÖRTEszemélyeknekhajlamoscukorbetegségvércukor104klinikaihízásraVÉRCUKORSZINTÉRTtöktermekeinkszámoselhízottOPTIMÁLIS

Forrás: pepitahirdeto.multiapro.com

A GÁL-60® típusú kopasztógéppel óránként hatvan csirkét lehet megtisztítani. A gép egyéb baromfiakhoz (liba, kacsa, gyöngytyúk, fácán stb.) is használható. Kétféle méretben készül. Pulykák pucolásához célszerű a pulykapucoló változatot megrendelni. Egy perc alatt egyszerre egy csirkét lehet megpucolni, melyet közben fogni kell. A tokokat és az erős tollakat is kiszedi, ezért kézi utópucolásra nincs szükség. A géphez számos kiegészítő berendezés tartozik (pl.: kábító, vágó, forrázó, ... további részletek >>

bontó, csöpögtető, stb.), melyek alkalmazásával biztosítható az optimális kiszolgálás, csökkenthető a pucolási idő, növelhető a feldolgozott darabszám. (Kérjen árajánlatot a kiegészítőkről!) www.csibekopaszto.hu/magyar/index.html


Feladva: 2017-07-24    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: 174stbGÁLlehetgépcsirkétegyhatvanwwwtollakategyszerreoptimálisKétféleberendezésóránkéntkiegészítőkrőlerősalattbiztosíthatóhasználhatótokokat

Forrás: pepitahirdeto.multiapro.com

Értékesítésben jártas munkatársat keresek. Egészségtudatos, kitartó, célorientált, magáért tenni akaró személyt keresek, számítógépes ismeret előnyt jelent, mivel profi online eszközökkel dolgozunk.


Feladva: 2017-08-22    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresekjártasÉrtékesítésbenmunkatársatszámítógépesArankaszemélytdolgozunkakaróeszközökkeltennionlinemagáértproficélorientáltmivelkitartójelent

Forrás: pepitahirdeto.multiapro.com

A Bella Baby Happy Midi (5 - 9 kg), Maxi (8 - 18 kg) és Maxi Plus (9 - 20 kg) méretű pelenkái az elasztikus derékrésznek, a rugalmas tépőzárral történő rögzítésnek és a redőzött, szivárgás elleni védőgátaknak köszönhetően megbízható védelmet nyújtanak a kicsiknek. A Quick Dry fedőréteg, és az anatómiailag meghatározott nedvszívó mag minden eddigi megoldásnál szárazabban tartja a bababőrt: a felvett nedvesség ugyanis azonnal géllé alakul át, és egyenletesen eloszlik a nedvszívó réteg teljes ... további részletek >>

hosszában, egyben a kellemetlen szagokat is semlegesíti. A pelenka légáteresztő kivitele a bőr szabad szellőzéséért felel. Már első látásra is bababarát a pelenka külseje a sok bájos figura jóvoltából, a pelenkacserék a játékos mintáknak köszönhetően szórakoztató élményt is nyújtanak. Bella Baby Happy Webáruház - Olcsó pelenkák, baba termékek


Feladva: 2017-07-14    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: maxiHappyBabyBellanedvszívónyújtanakpelenkaköszönhetőenQuicktermékekszellőzéséértrétegrugalmastartjafigurakicsiknekbabaszabadderékrésznekbájos

Forrás: pepitahirdeto.multiapro.com

Használtruha Nagykereskedésünk, az originál bálás használt ruha, valamint a minőségi válogatott használt ruha kollekciójával várja kedves vásárlóit. Nyári bálás ruha kínálatunk: vegyes ruha bála, felnőttruha bála, gyerek ruhabála, szabadidős jogging bála, Holland lakástextil és ágynemű bála, valamint Német munkásruha bála. Válogatott Angol ruházat 1.osztály, Extra és Krém minőségben a legjobb áron! Termékeink tartalma: szezonális, divatos és márkás ruha, garantált minőségben! Visszavásárlási ... további részletek >>

garancia! Hívjon minket bizalommal! Látogasson el weboldalunkra! Ingyenes házhoz szállítás a hét minden napján! Viber/Tel: 06306995904 Web: www.europanagyker.hupont.hu


Feladva: 2017-05-17    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: bálaruhahasználtruhaVálogatottbálásvalamintNagykerminőségbenAngoldivatoshttpgyerekLátogassonszezonálisminőségiWebfelnőttruhabizalommaltartalma

Forrás: pepitahirdeto.multiapro.com

Csatlakozzon a legjobb feltételekkel a mi rendszerünkhöz! Belépési díj akár 0 Ft! Havi szolgáltatási alapdíj akár 0 Ft! A hirdetési költségek nagy részét átvállaljuk partnereinktől! Vállalkozásunk 1996 óta foglalkozik ingatlanközvetítéssel és a hozzá kapcsolódó, ezt elősegítő kiegészítő tevékenységekkel. Sikerünk alapja a költségtakarékos működés és a saját fejlesztésű know-how. Ezt a tudást és tapasztalatot adjuk át jövőbeni partnereinknek. Minden megyéből várjuk a jelentkezőket!


Feladva: 2015-12-09    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: MakkosknowfranchiseCentrumIngatlanlehetőségetátadásdinamikusanaztcéljábólterületenakikkörűfejlesztéseezenvállalkozóknakTeljeskiépítéseindítani

Forrás: pepitahirdeto.multiapro.com

A projekt alap célkitűzése az volt, hogy egy olyan agrár online piacteret hozzunk létre, amely a mai magyar piacon egyedülálló funkcionalitással rendelkezik. Ennek köszönhetően az agráriumban tevékenykedő gazdák a számukra érdekes termékeket és szolgáltatásokat egy helyen, a lehető legrövidebb idő és energia ráfordítás mellett tudják megtalálni és a beszerzéseiket elindítani. Ezen a webes felületen informálódhatnak az aktuális pályázatokról, a szakmai programokról és a szakmai kiállításokról. A ... további részletek >>

gépek, az eszközök, az alkatrészek, a tápanyagok, a növényvédelmi és állattartási eljárások innovációiról, az oldalunkon található videók megtekintése útján informálódhatnak a gazdák. Honlapunkat a gazdáknak készítettük, de a gazdákkal együtt szeretnénk egy igazán jól használható, modern és innovatív agrár online piactérré formálni. A jövőben is a látogatók felmerülő igényei alapján fejlesztjük tovább. A folyamatos megújulni akarás visz minket előre.


Feladva: 2017-11-07    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: KftPendaszárzúzókrendsodrókekékimmárNégyáruinkatvállalatvetőgépekbóltermékeinkadjákvangépekTársaságHúzóraktározzáktulajdonbanpermetezőBetéti

Forrás: pepitahirdeto.multiapro.com

Hölgyeim és Uraim! Engedjék meg hogy bemutatkozzam,Ábrahám Zsolt vagyok Esküvői és Parti Dj. Minőségi szolgáltatást nyújtok elérhető áron számlaképesen, országosan! Céges rendezvényre, Születésnapra, vagy egy fergeteges szilveszteri bulira is szívesen megyek. Elérhetőségem: 0620/274-0390 Az Őszi ár akció elkezdődött! 25%kedvezmény, minden Esküvő árából! Leinformálható nívós referenciával, komplett minőségi hang és fénytechnikával,(RCF hang, ledes lámpák fények, Pioneer Dj pult, Shure ill, ... további részletek >>

Sennheiser mikrofonok. Zenéim a hetvenes évektől napjainkig(retro, pop, rock, rock&roll, alternatív, funky, stb. Magyar és külföldi top slágerek, vagy igény szerint mulatós zenéimre táncolhatnak, IDŐKORLÁT NÉLKÜL akár hajnalig.www.edjbier.hu zsoltbraham@freemail.hu Budapest XXII. ker


Feladva: 2017-10-16    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: CégeshangminőségiBudapestrendezvényreZsoltrockÁbrahámvagynyújtokNÉLKÜLUraimMagyarkedvezményZenéimszilveszteriszolgáltatástIDŐKORLÁTRCFHölgyeim

Forrás: pepitahirdeto.multiapro.com

Kuka, szelektív hulladéktároló, 120 literes, barna, fekete, kék, sárga, piros és zöld színekben. Továbbá 240 literes barna, fekete, kék, sárga, piros és zöld színekben, valamint fedél barna, fekete, kék, sárga, piros és zöld színekben. Tengely 120 l., tengely 240 l. és kerekek is kaphatók. 60 literes, 80 literes, gurulós, 85 literes, 110 literes, kerek, 110 literes horganyzott fém és többféle szemétgyűjtő konténer különböző színekben. ... további részletek >>


Feladva: 2016-02-16    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: színekbenkékfeketebarnakuka120lzöldpirossárgakülönböző240lszelektivtengely110lKerhttpgurolóstetővel80lvagy60lszínbenkonténerkaphatók

Forrás: pepitahirdeto.multiapro.com

Szeretettel várok minden új és régi vendégemet újonnan nyílt szalonban :) Bejelentkezni ezen a telefonszámon tudtok : +36 70 626 1434


Feladva: 2017-09-28    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: régi1434minden626vároktudtokSzeretetteltelefonszámonBudapestezenÉvaBejelentkezniGázerszalonbanVicuskutyakozmetikanyíltújonnanvendégemet

Forrás: pepitahirdeto.multiapro.com

Kínai és Gyári mobiltelefonok, táblagépek szervizelése! Adatmentés Töltés javítás Függetlenítés Szoftveres javítás Kijelző csere Albertirsa Pesti út 97 06305805905


Feladva: 2017-09-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: AlbertirsaKínaijavításTöltésAdatmentésszervizelése06305805905táblagépekPestimobiltelefonokGyáricsereKijelzőAttilaPetrovicsSzoftveresMobilszervíz

Forrás: pepitahirdeto.multiapro.com

Angol es Holland munkaadok alkalmaznak angol nyeltudassal, gyari munkasokat. A kezdo fizetesesk 1500 euro Hollandiaban es 1300 font Angliaban. Minden esetben a szallas bisztositva van. Regisztrajanak INGYEN a www.nrgkulfoldimunka.hu vagy telefonajanak MOST a kovetkezo telefonszamokra: +36 70 627 5010; +36 70 638 5010; +36 70 883 5010


Feladva: 2018-02-19    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: 5010angolfizetesesk627nalunkbisztositvakezdotelefonszamokracsakszallasmunkasokatkovetkezofizetesekesetbengyariMOSTkulfoldiMindennyeltudassalwww

Forrás: pepitahirdeto.multiapro.com

Otthonról végezhető munkára keresek 5 főt Betterware csapatomba! Komoly gondolkodású,kitartó munkatársak jelentkezését várom. - Ha elmúltál 18 éves, - Jól kezeled a számítógépet, - Szeretnél plusz jövedelmet, - Dolgoznál is érte Írj és megbeszéljük. :)


Feladva: 2017-05-03    [Pénzkeresés - MLM]

Címkék, kulcsszavak: OtthonrólgondolkodásúVelemSzeretnélKomolyDolgozzszámítógépetcsapatombakezeledBetterwareJólfőtéveskeresekmegbeszéljükelmúltálmunkáraÍrjváromérte

Forrás: pepitahirdeto.multiapro.com

Motoros mintás hátizsákok többféle mintával a retro pannónia logóstól a humoros feliratosig. Motoros férfiaknak és motoros nőknek egyaránt kiváló ajándék lehet minden alkalomra. Két rekeszes (egy nagy és egy zseb elől), könnyű poliészter hátizsák, fülhallgató kivezetéssel, állítható vállpánttal. Ha egyéni mintát szeretnél nyomatni, írj! Hossz / cm 40.00 Szélesség / cm 28.00 www.rockpont.polomania.hu/termekek /reszletek/151497_humoros_feliratu_ hatizsak_a_sor_kapcsan-online_rende les


Feladva: 2018-01-04    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: motorosegyhátizsáknőknekmintátmintásegyéniRockPontnagyférfiaknakvállpánttalrekeszesfeliratosigállíthatóKéthumoroskivezetésselalkalomralogóstól

Forrás: pepitahirdeto.multiapro.com

Szavazz a Neked tetszőre! Minták a készítők elérhetőségeivel, hogy kapcsolatba is léphess velük... Mindent ezen a honlap oldalon találsz a szavazásról: www.mukorom.hu/mukorom-mintak/porc elan-mukorom-mintak


Feladva: 2017-04-12    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: mukorommintakPepitakapcsolatbamintaporcelanhogyporcelánwwwelérhetőségeivellegszebbszavazásrólkészítőkMelyiktalálszMintákoldalontetszőrehonlap

Forrás: pepitahirdeto.multiapro.com

Eladó új Huawei Honor okostelefonok! Honor 5X Honor 7 Honor 7i Honor 8 Honor V8 Honor Note 8 Huawei Mate 8 Részletekért látogasson el weboldalunkra! www.puremobile.hu/huawei


Feladva: 2016-10-28    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: HonorHuaweiokostelefonokpuremobileweboldalunkralátogassonRészletekértMateNoteEladóBudapest

Forrás: pepitahirdeto.multiapro.com

Dormán László mosógépszerelõ vállalja Whirpool, Ignis, Polar, Energomat, Minimat, Midimat, Energolux, LG, Zanussi, NDK-s WA tipusú, stb. automata mosógépek javítását. MOSÓGÉPSZERVIZ KISPESTEN a kerületben lakóknak, mosógépszerelés munkanapokon, akár 4 órán belül is lehetséges. Mosógépszerelés: Erzsébet, Kõbánya, Pestlõrinc, Pestimre, Csepel, Soroksár, Ferencváros, Józsefváros, Kispest és a XVII. ker.-ben. www.mosogepszereles-javitas.hu


Feladva: 2016-03-14    [Lakossági szolgáltatás]

Címkék, kulcsszavak: 245MosógépszerelésDormánkerLászlówwwZanussirinclakóknakhttpEnergoluxXIXkerületbenbenMidimatPestlBudapestKISPESTENMinimatbányaMOSÓGÉPJAVÍTÁS

Forrás: pepitahirdeto.multiapro.com

Az elhunyt hamvasztásának és hamvainak hozzátartozó részére történő átadásának lehetőségeiről, körülményeiről és a szolgáltatás díjáról kaphat részletes információt. A Gyászhuszár Temetkezés munkatársai elintézik Ön helyett a bürokratikus tennivalókat, melyek az elhunyt hamvasztásának megszervezése során felmerülhetnek. HamvasztásTemetkezési szolgáltatás kedvező áron Budán a Móricz Zsigmond körtérnél és Pesten az Igazságügyi Intézetnél!


Feladva: 2017-09-30    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: TemetkezésGyászhuszárhamvasztásánakelhunytszolgáltatásmelyekkörülményeirőlHamvasztásTemetkezésitennivalókatIntézetnéllehetőségeirőlbürokratikusIgazságügyi

Forrás: pepitahirdeto.multiapro.com

Az isiász gyógyítása általában teljes sikerrel jár, hiszen nem rosszindulatú betegségről van szó. Ez sokkal inkább egy tünetegyüttes, melyet az ülőideg összenyomódása okoz. Rendszeres testmozgással, a gerinc és a hátizmok ülés közben történő megtámasztásával, a helyes ülésmód elsajátításával megelőzhető a kialakulása és a kiújulása is. Az isiász lelki okai a túlterhelés érzésében gyökereznek. Ha valakin túl nagy a nyomás, a felelősség, túl sokat vállal magára pl anyagi gondok miatt, nagy ... további részletek >>

eséllyel alakul ki nála ez a probléma. Az idegbecsípődés és isiász kezelése történhet gyógyszerekkel és megfelelő tornával is.


Feladva: 2017-01-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: isiászidegbecsípődéstúlnagykezelésevállalsokkalkiújulásagyógyításagerincsokatszókialakulásaKittiproblématestmozgássalvanmegelőzhetőKellérnála

Forrás: pepitahirdeto.multiapro.com

ZENEBOLTUNK MEGLEPETÉSE Webáruházunkban a Zenebolt teljes választéka elérhető. Hogy még kényelmesebb legyen a vásárlás, mostantól 16.000 Ft feletti vásárlás esetén a megrendelt termékeket Magyarország egész területén ingyen szállítjuk házhoz!


Feladva: 2017-07-11    [Zene - Hangszer]

Címkék, kulcsszavak: ZENEBOLTvásárlásszállítjukZENEBOLTUNKmostantólházhozMEGLEPETÉSE000WebáruházunkbanfelettiteljeseseténválasztékamegrendeltelérhetőtermékeketKALÁKAmég

Forrás: pepitahirdeto.multiapro.com

Szeretném eladni ezt a szekrényt! Több, mint 100 éves, fából készült! Hibátlan állapotú! 40.000.- Ft. (a kombinált rész három vízszintes részből áll, szállítható!) Egerben található! Érdeklődni: 20/9680-016.


Feladva: 2017-10-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: 100mintTöbbEgerbenévesELADÓrészbőlSZEKRÉNYvízszintesháromrészszekrényt016kombináltezt9680000eladniÉrdeklődniállapotúSzeretnémtalálhatóáll

Forrás: pepitahirdeto.multiapro.com

Tuti Turi Ptc Kiegészítő jövedelemre van szükséged? Gyere és dolgozz velünk! 2017. Magyarország egyetlen PTC oldala! Ami ingyen is elkezdhető, és csinálható! Napi kereset változó! Jutalék rendszer és más egyéb lehetőségek! Csak rajtad múlik, hogy mennyit akarsz keresni! Az első 2000 Tag, ajándék tagságban részesül! Link... http://tutituriptc.xyz/?ref=ijoco< /a>


Feladva: 2017-05-20    [
Pénzkeresés - MLM]

Címkék, kulcsszavak: PTColdalaijocoegyetlenMagyarország2017ajándékvanlehetőségekAmiTagjövedelemreegyéb2000KiegészítőmáselsőTurirendszerrefkeresniTutiJutalék

Forrás: pepitahirdeto.multiapro.com

Paleo Gluténmentes csoki, édesség termékek nagy választékban a NaturTéka webshopban. Rendeljen online vagy telefonon akár ingyenes kiszállítással!


Feladva: 2017-05-22    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: NaturTékaédességcsokiGluténmentesPaleoRendeljenHirdetőwebshopbanPepitawebáruházválasztékbannagykiszállítássaltermékekingyenesakártelefononvagy

Forrás: pepitahirdeto.multiapro.com

A Vörös Reishi (pecsétviaszgomba, Ganoderma lucidum) gyógygomba méregteleníti és kiegyensúlyozza a szervezetet. Én port és kapszulát is szedek. A kapszulával jobban be tudom tartani az adagomat, ami 10 pár RG és GL kapszula. A Reishi port szeretem elszopogatni, mert egyből a szájüregből felszívódva a fogakra, ínyre és torokra is kifejti hatását. 3 éve használom a DXN Ganodermás termékeit. Személyes tapasztalataim 1 év után: ... további részletek >>

www.kavekiraly.hu/blog-2014-10-18-Megelozni_konnyebb__mint_gyogyitani_-_sajat_tapasztalataim Az RG nagyon erős méregtelenítő. Addig kutat a testben, amíg meg nem találja a panasz helyét. A GL-nek kevésbé agresszív a méregtelenítő hatása. Erőssége a regenerálásban és a kiegyensúlyozásban rejlik. A pecsétviaszgomba nem csak a testet méregteleníti és egyensúlyozza ki, hanem a lelket is. Hangulatjavító és antidepresszáns hatású. Webáruház: www.kavekiraly.hu/termekek


Feladva: 2017-01-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kavekiralyVöröstapasztalataimhttpnempecsétviaszgombaportReishiméregtelenítőGanodermaméregtelenítifelszívódvakevésbénagyonadagomattermékeitcsaknek

Forrás: pepitahirdeto.multiapro.com

Statikus szakértői vélemény CSOK igényléséhez. (családi otthonteremtési kedvezmény) Díja: 40.000 Ft.


Feladva: 2016-11-28    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: StatikusotthonteremtésicsaládiigényléséhezCSOKvéleményszakértőiZsuzsanna000JózsaDíjaSZAKVÉLEMÉNYkedvezmény

Forrás: pepitahirdeto.multiapro.com

Mesefigurás gyerekágyak leesésgátlóval jó minőségben, jó áron! Ez az ifjúsági ágy gyermekének is garantáltan tetszeni fog, mert kinézetre pont olyan, amilyet szeretne. Szép, mutatós kidolgozású gyerekágy lekerekített élekkel, jó minőségben. A körbetámlás gyerekágy biztonságos és balesetmentes, mert nem esik le a gyerek. Kényelmes és könnyen összeszerelhető gyerekagyak csak nálunk. A gyerekbútor webáruház többféle forma és színválasztékában biztosan megtalálja a megfelelőt! Válasszon!


Feladva: 2015-11-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: gyerekágymertárongyerekágyakMesefigurásminőségbentöbbféleágynemSzépwebáruházifjúságiszeretnegyerekbútorbalesetmentesamilyetnálunkleesésgátlóval

Forrás: pepitahirdeto.multiapro.com

Az ország egész területén állunk rendelkezésükre! Küldje el hozzánk javítandó laptopját. Nincs kedve sok kilométert utazni a legközelebbi szervizig, otthagyni a gépet, majd újra visszamenni érte? Lehet egyszerűbben és kényelmesebben is javíttatni a laptopot. Rendeljen futárt hibás laptopjáért, amikor Önnek jó, ahova Önnek kényelmes. Az ország egész területén állunk rendelkezésükre!Futárszolgálattal az ország bármely településéről el tudja elküldeni részünkre a javítandó laptopot Küldje ... további részletek >>

el szervizünknek javításra! Milyen laptop hibákat javítunk? Lassú, problémás laptop javítása. Túlmelegedő, lefagyó laptopok javítása. Hardver problémák elhárítása. Laptop bővítés, korszerűsítés. Vonalas telefonszámunk: +36-1-709-10-86 Mobil telefonszámunk: +36-20-265-75-30


Feladva: 2017-11-26    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: LaptopországrendelkezésükrejavításaKüldjetelefonszámunkállunklaptopotterületénjavítandóegészÖnnekLaptopszervizcenterHardverfutártszervizünknek265

Forrás: pepitahirdeto.multiapro.com

A szilvalekvár akkor az igazi, ha cukor nélkül főzzük. Ez akár egy teljes napot is igénybe vehet, de megéri a fáradozást, hiszen nemcsak finom, de nagyon egészséges csemegét kapunk végeredményként. Az aszalt szilva és a szilva lekvár hatásai hasonlóan jók, sőt, ez a gyümölcs nyers és aszalt formában tartogatja a legtöbb előnyt az emberi szervezet számára. Felhasználhatjuk székrekedés és túlzott gázképződés, puffadás ellen, valamint általánosságban az emésztés javításához. Ugyanakkor segíti a ... további részletek >>

májműködést és az agyi tevékenységet is. A szilva fajták és hatásuk bővebben weboldalunkon!


Feladva: 2017-02-14    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: szilvalekváraszalthatásukvalamintvehetlegtöbbKittifajtákvégeredménykéntellenigénybetartogatjaKellérkapunkpuffadásnapotformábankészítésecsemegét

Forrás: pepitahirdeto.multiapro.com

Régi és új ARANY-, EZÜST- és egyéb FÉMPÉNZEK, PAPÍRPÉNZEK, kitüntetések, jelvények, emlékérmek, plakettek, régi képeslapok, numizmatikai gyűjtemények VÉTELE – ELADÁSA! Az antik világtól napjainkig terjedő, több ezer darabos kínálatunk a “Termékek” menüpontra kattintva témakörönként tekinthető meg. Üzletünk 1999. óta áll a gyűjtők és eladni szándékozók szolgálatában. Vásároljanak tőlünk személyesen, vagy online, termékeinkért felelősséget vállalunk! A minőség ... további részletek >>

magáért beszél!


Feladva: 2017-04-11    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: régitekinthetőajánlóterjedőplakettekVásároljanaktémakörönkéntHirdetőnapjainkigbeszélemlékérmekszolgálatábankattintvaPepitavilágtólmagáértjelvények

Forrás: pepitahirdeto.multiapro.com

Most vegye meg, vagy kösse le álmai otthonát, nyaralóját! Nálunk most akár önerő nélkül is lakáshoz juthat! Amennyiben tőlünk (vagy megbízott ingatlanközvetítőinken keresztül) vásárolja meg lakását, a CSOK és a kedvezményes kamatozású hitelügyintézésben is segítünk önnek! Ezen felül partner ügyintézőnk állami támogatás intézésében is segít önnek + 8 millió Forint államilag garantált kedvezményes hitel intézésében is! A kivitelezést már megkezdtük! BADACSONY LEGKORSZERŰBB ... további részletek >>

PANORÁMÁS, ENERGIATAKARÉKOS KLIMATIZÁLT TÁRSASHÁZA ÉPÜL! CSOK IGÉNYBE VEHETŐ!!! www.facebook.com/groups/1573877696240446/permalink/1690129964615218


Feladva: 2017-07-21    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kedvezményesvagyönnekmegCSOKintézésébenmosthitelNálunk16901299partnerÁlomotthonTÁRSASHÁZAmegbízottnyaralójátpermalinkfelülKLIMATIZÁLTgarantált

Forrás: pepitahirdeto.multiapro.com

A Wilson Burn széria a 2017. évi tavaszi szezonra teljesen megújult mind anyagában, mind külső megjelenésében. A széria három tagja (95 CV, 100 CV, 100S CV) új megerősítést kapott a Countervail technológia révén, amelyet félévvel korábban a Blade szériánál mutatott be először a Wilson. Az ütők megjelenése is harmonizál a Blade és Pro Staff ütők színvilágával, ami minimál dizájnt jelent, fekete alapszínnel, tiszta vonalakkal és matt festéssel. Az ütőket a szériákra jellemző szín teszi ... további részletek >>

megkülönböztethetővé a többitől, így a Burn ütők messziről felismerhetők a feketébe ágyazott narancsszínükkel. A Burn széria teniszütői az alapvonal játékosok számára készülnek, akik nagy erővel hátulról játszva ütik a labdát, s ezzel tartják ellenfelüket folyamatosan nyomás alatt a mérkőzés utolsó pillanatáig. www.lhsport-shop.hu/tenisz/teniszuto/wilson-burn-95-cv-teniszuto


Feladva: 2017-04-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: burnwilsonütőkszériateniszutomindBlade2017PepitaakikStaffmesszirőlrévénfolyamatosanmattkészülnekProtechnológiaanyagábanellenfelüketvonalakkal

Forrás: pepitahirdeto.multiapro.com

Budapest és Pest megye egész területén vállalunk üvegezési munkát, rövid határidővel, helyszíni beépítéssel, biztosító által elfogadott számlára is. Ha ön betöri mi beüvegezzük! Ha ön megfesti mi bekeretezzük! Szolgáltatásaink: - Üveg, tükör - Bútorüveg - Hőálló és hőszigetelt üveg - Edzett és hajlított üveg - Akvárium, terrárium - Üveg zuhanyajtó - Üvegfalak Telefon:061 426 74 56 Mobil.06 30 262 85 91 06 70 933 78 21


Feladva: 2017-02-20    [Lakossági szolgáltatás]

Címkék, kulcsszavak: ÜvegüvegezésimegyePestBudapestÜvegfalakazuvegesekSzolgáltatásainkhatáridővelzuhanyajtómegoldásokbekeretezzükrövidÜvegezésmegfestimunkátterrárium933

Forrás: pepitahirdeto.multiapro.com

Olcsó új gyerekruhák és játékok! Gyerekruhák bébi, gyerek és kamasz méretekben, bébi kiegészítők nagy választékban. Több mint 10.000 gyerekjáték a bébitől egészen 12 éves korig. Személyes átvétel Budapesten, házhoz szállítás az ország egész területén.


Feladva: 2016-03-27    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: GyerekruhákbébijátékokOlcsóJátékBudapestenválasztékbanátvételnagySzemélyeskiegészítőkkorigkpjatekévesméretekbenwwwegészenkamaszterületénbébitől

Forrás: pepitahirdeto.multiapro.com

Szeretettel várunk minden pihenni, szórakozni és kirándulni vágyó vendéget a Velencei-tó mellett lévő pákozdi vendégházunkban! A ház közvetlenül az erdő mellett, csendes festői környezetben található, ami családias hangulatot, kényelmet, nyugalmat biztosít vendégeink számára. Ideális szórakozni, pihenni vágyó családoknak, osztályoknak, baráti társaságoknak (max. 45 főig, egyeztetés után).


Feladva: 2016-12-03    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: pákozdivágyópihenniszórakoznimellettvendégházingókőamilévőtalálhatóVelenceikörnyezetbenutánVendégetIdeálisfestőiegyeztetéskirándulniszámárafőig

Forrás: pepitahirdeto.multiapro.com

Amire az Iparban szükség lehet. Szerszám Kötőelem- Rögzítéstecnika- Szerszámgép - Hegesztéstechnika - Forrasztástechnika - Munkavédelem - Zár-lakat-vasalás.


Feladva: 2017-08-07    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: SzerszámvasalásszükséglakatIparbanZárAmireMunkavédelemBudapestForrasztástechnikaKftHegesztéstechnikaBauSzerszámgépBarkerRögzítéstecnikaszakáruház

Forrás: pepitahirdeto.multiapro.com

Közösségi napelempark tulajdon részeinek MLM-ben való értékesítésére üzletkötőket keresek. Egyedi. Hosszútávú. 25 évig fizet! Euró alapú jutalékos kifizetés! Internetes munka kifejlesztve.


Feladva: 2017-07-01    [Pénzkeresés - MLM]

Címkék, kulcsszavak: kereseküzletkötőketEurórészeinekfizettulajdonévignapelemparkHosszútávúKözösségiEgyediBudapestkifejlesztveajánlómunkaHirdetőInternetesértékesítésére

Forrás: pepitahirdeto.multiapro.com

Eladó !!!!! Brother tipusú 2 tűs ipari varrógép. 6mm- es tűtávolság, tű kikapcsolás, 220 voltos motorral, rendszeresen szervizelt, 15 db orsóval eladó. Érdeklődni: 16 óra után Tel: 30/751 2327, Tóthné Ági. Irányár: 80.000 Ft.


Feladva: 2018-02-19    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: BrothervarrógépeladóipariszervizelttipusúÁgirendszeresenTóthnémotorralKaposvár2327voltosBéláné751220TóthTelkikapcsoláskéttűsutántűtávolság

Forrás: pepitahirdeto.multiapro.com

Petőfi Sándor (Kiskőrös, 1823. január 1. – Fehéregyháza, 1849. július 31.) Magyar költő, forradalmár, nemzeti hős, a magyar költészet egyik legismertebb és legkiemelkedőbb alakja. Közel ezer verset írt rövid élete alatt, ebből körülbelül nyolcszázötven maradt az utókorra. www.regikonyvek.hu/kiadas/forradal mi-versek-1-franklin-konyvkiado-n-v


Feladva: 2018-02-17    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: versekmagyarforradalmiregikonyvekwwwPepitaAdsezerköltőutókorrawebáruházKözeljúliusmaradtalakja1849nyolcszázötvenlegkiemelkedőbbFehéregyháza8211

Forrás: pepitahirdeto.multiapro.com

Újpalota szívében, a Páskomliget utcában, eladó egy 35 nm-es, erkélyes, 1+fél szobás, 10. emeleti, parkra néző ingatlan. A nagy szobában a radiátor, és a nyílászáró cseréje megtörtént, a bejárati ajtó, acél biztonsági. A konyhában villanytűzhely található, új konyhabútorral. Az ingatlan per és tehermentes. Az infrastruktúra kiváló, óvoda, iskola, orvosi rendelő pár perc sétával elérhető. További információk: ... további részletek >>


Feladva: 2018-01-26    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: ingatlanBudapesteladóUjpalotavillanytűzhelyKeruletnagyrendelőszívébenkonyhábannézőorvosikerbiztonságiparkraiskolaPepitaAdsacélballaingatlanhtml

Forrás: pepitahirdeto.multiapro.com

A magas fehérvérsejt szám rendellenes állapot, mely általában fertőzést mutat. Ugyanakkor pajzsmirigy túlműködés is állhat drasztikus mértékű megemelkedésének hátterében. Az alacsony fehérvérsejt szám szintén nem ideális, hiszen fogékonyabbá tesz a betegségekre. Ez általában kemoterápia, sugárkezelés, csontvelő rendellenesség és vírusfertőzés miatt fordul elő. Egy egészséges szervezetben a fehérvérsejtek az összes sejt 1%-át teszik ki, az ennél magasabb és alacsonyabb arány betegség meglétét ... további részletek >>

mutatja. A fehérvérsejt és vörösvérsejt terápiák a kiváltó ok ismeretében kezdhetők meg.


Feladva: 2016-08-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fehérvérsejtállapotáltalábanvörösvérsejtszámkemoterápiamutatjahátterébenszervezetbenmeglététmegemelkedésénekegészségesrendellenesbetegségekrebetegség

Forrás: pepitahirdeto.multiapro.com

Kovacsics Öcsi könyve: Omega-Universal zenekartól az együttesig. 50 év zenetörténelem, ahogy megélte 4 zenekarban. Megvásárolható az alábbi boltokban: 3490 Ft, az alapár. Libri, Rockdiszkont, Bookline, Lira, Ujkönyvek.hu, Könyvtenger, mai könyv.hu, Rockmúzeum, Könyv szállító, Könyvesboltom, numero7 könyvesbolt, Könyvtündér, Emag, eKönyv. www.kovacsics.hu/konyv.html


Feladva: 2017-07-12    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: kovacsicskonyvÖcsiBudapestKönyvtengerzenekarbanhttpAndrásUjkönyvekmegélteeKönyvOmegárólLiraahogyEmagkezdetiBooklinezenetörténelemKönyvtündérmai

Forrás: pepitahirdeto.multiapro.com

Latex vegyvédelmi kesztyű Készleten 9 és 10 méretben (1 csomag 12 pár = 1.788,-Ft) Latex védőkesztyű csúszásbiztos textúrált felülettel tenyéren és az ujjakon, bolyhosított belső. 12 pár/csomag tő (149,-Ft/pár) ! Sárga Méret: 10, Legkisebb rendelhető mennyiség: 1 pár - bontott csomag: 219,-Ft/pár www.gazdaporta.hu/vedokesztyu-ff-h s-05-001-haztartasi-latex-10-494


Feladva: 2018-02-09    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: párcsomagLatexrendelhetővédőkesztyűméretbenháztartásibelsőKészleten001bolyhosítottkesztyű219ujjakonvegyvédelmitenyérenkerületbontottfelülettel

Forrás: pepitahirdeto.multiapro.com

Angol nyelvtanítás, korrepetálás, felkészítés nyelvvizsgára, állásinterjúra, közép és emelt szintű érettségire Szolnok belvárosában diplomás nyelvtanárral.


Feladva: 2017-09-23    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nyelvtanításAngolSzolnokbelvárosábanbarnaérettségireszintűemeltközépállásinterjúranyelvvizsgárafelkészítésnyelvtanárralkorrepetálásdiplomás

Forrás: pepitahirdeto.multiapro.com

Flóra Garden kertészeti Bolt és Webáruház! Szobraink garantáltan fel fogják dobni környezetét! Viszonteladók jelentkezését is várjuk! (06 70/299-2066)


Feladva: 2017-01-12    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: kertimostmárdíszeinkettipegőthttpgarantáltanvagykészletkisöprésSzobrainkárongrillezőtTéliirodájátlegalacsonyabbszökőkutat2066Halásztelekpiacon

Forrás: pepitahirdeto.multiapro.com

Klasszikus és modern olasz konyhabútorok nagy elemválasztékával várja Önt a Lineaflex Olasz Bútoráruház és Ágybetét Stúdió.


Feladva: 2016-09-02    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: OlaszBútoráruházLineaflexÖntvárjaelemválasztékávalnagykonyhabútorokmodernStúdióKlasszikusÁgybetétkerBudapestkonyhabútor

Forrás: pepitahirdeto.multiapro.com

Otthonosan berendezett lakás kiadó Szegeden. Szállóvendégeink szeretik a jól felszerelt konyhát, valamint a szép fürdőszobát. olcsó szállás Szeged : 2800ft/fő/nap


Feladva: 2017-10-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: SzegedszállásCsabakonyhátFülöpfelszereltapartmanjólpanziónapszeretikszegedi2800ftSzállóvendégeinkSzegedenkiadóolcsólakásfürdőszobátberendezett

Forrás: pepitahirdeto.multiapro.com

Igényes megjelenésű klímás autók sofőrrel kérhetőek. Kiállás Budapesten díjtalan. Autóink rendelhetők már 6.000.-/óra díjtól. Számoljon velünk, részletekért klikkeljen a www.szepauto.5mp.eu oldalra.


Feladva: 2017-03-20    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: KiállásCsaládivelünkkérhetőekpartiSzámoljonsofőrrelCégesdíjtólautókRendezvényóraklímásAutó000megjelenésűoldalraEsküvőmárIgényes5mpRichárd

Forrás: pepitahirdeto.multiapro.com

Az Erő forrás alternatív gyógyászatban Előző életes utaztatásra (Reinkarnációs utazás) lehet jelentkezni. Megtudhatja hogyan élt, viselkedett, mit gondolt és érzett dolgaival kapcsolatban. Felhozhat jelenleg elfeledett emlékeket, kapcsolat rendszereire is válaszokat kaphat...


Feladva: 2017-10-12    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: ErőéletesElőzőéltalternatívemlékekethogyanforráselfeledettMegtudhatjajelenlegjelentkezniSzigetszentmiklósFelhozhatlehetforraskapcsolatbanutazás

Forrás: pepitahirdeto.multiapro.com

Óvodának, iskolának, alapítványnak vásárolnál? Akkor különleges ajánlatunk biztos elnyeri majd tetszésedet! Webáruházunkban intézményi vásárlóként 10% állandó kedvezményt kaphattok! Nincs más dolgotok, mint regisztrálni oldalunkon. A regisztráció után visszaigazolást küldünk, mely tartalmazza az intézményi vásárlás feltételeit is. A visszaigazolás után a következő belépésnél már a Nektek szóló árakat láthatjátok majd oldalunkon. A kedvezmény teljes termékkínálatunkra vonatkozik! Kövess ... további részletek >>


Feladva: 2017-10-13    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: utánoldalunkonmajdegyszerboltintézményiküldünkvásárlókéntKövessmárÓvodánakvisszaigazolástWebáruházunkbanvonatkozikbelépésnélajánlásregisztrációteljes

Forrás: pepitahirdeto.multiapro.com

Vattacukor készítő gépek - Új/Gyáriak (USA Design) - átlátszó plexi szélvédő burával, (Professional candy floss machine) + kétkerekű kocsival szerelten (kordé), vagy asztali változatban ELADÓK - MEGRENDELHETŐK! A Vattacukor gépek ELEKTROMOS (Electric) és GÁZOS (PB Gas) fűtéssel választhatóak! Kiemelkedően profi gasztronómiai használat, és gyári design! E-mail címre tájékoztatót, és képeket küldök! Az értékesítés Pro-Forma számlával történik! ... további részletek >>


Feladva: 2017-04-30    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: ELADÓKdesigngépekVattacukorMEGRENDELHETŐKProcandyprofiWAYértékesítésProfessionalKiemelkedőenGOLDENváltozatbanküldökburávalválaszthatóakasztaliGas

Forrás: pepitahirdeto.multiapro.com

Ma még van munkád, de Holnap??? Elégedett vagy magaddal és a helyzeteddel? Ha igen akkor ez nem neked szól, de ha nem, akkor olvass tovább... Nincs munkád, vagy ha van a kereseted a megélhetéshez kevés, de az éhenhaláshoz sok? Gyere hozzánk dolgozni! Hosszútávú lehetőség. Munkatársakat keresek. Csatlakozz Betterware csapatomhoz!


Feladva: 2017-11-08    [Pénzkeresés - MLM]

Címkék, kulcsszavak: vanvagymunkádakkornem224helyzeteddel232magaddalHosszútávúlehetőségElégedettdolgozniMunkatNincsHolnaphozzánkrsakattovábbmégGyerekereseksok

Forrás: pepitahirdeto.multiapro.com

A Fordított Ozmózis víztisztító berendezés a mosogató alá szerelhető, kis helyigényű. Közvetlen a hideg víz csapjához csatlakoztatjuk a többlépcsős szűrőberendezést. A beszerelése különös szakmai tudást nem igényel, a használati utasításokon leírtak alapján egyszerűen elvégezhető. A víztisztító berendezés csak a szabvány ivóvíz, a vízművek által kibocsájtott víz tisztítására alkalmas. A nem a vízhálózaton keresztül folyó szennyezett származású víz tisztítása nem végezhető el!


Feladva: 2015-06-25    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: víztisztítónemvízszakmaifolyókisberendezésszűrőrendszerkülönöskeresztülszerelhetőbeszerelésevízhálózatonaláelvégezhetőkszűrőberendezéstalkalmasBéla

Forrás: pepitahirdeto.multiapro.com

A legjobb otthoni segéd. E világszabadalmazott szerkezet szinte bárhol, bármilyen körülmények között felállítható, használható magunk, barátaink nagy megelégedésére. Minden grillezhető rajta. Teljes egészében rozsdamentes anyagból kézzel készült. A hihetetlen teljesítményű, fém hajtóműves kis méretű motor egy akkumulátor töltéssel több mint 20 órán át képes üzemelni. Bárhová vihető, vagy szállítható akár egy kis táskában is. Mérete igény szerint.


Feladva: 2016-08-08    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: kisegyGrillDobvagykörülményekméretű174rajtavihetőbármilyenhajtóműveskényelmesengrillezhetőBárhovábárholfémGrillezésszerintMindenüzemelniigény

Forrás: pepitahirdeto.multiapro.com

KRESZ által előírt közúti elsősegély doboz, A mentőláda, B egészségügyi csomag és C buszos mentődoboz értékesítése. Házhoz szállítással is megrendelheti webáruházunkban!


Feladva: 2014-10-29    [Autó - Motor - Jármű]

Címkék, kulcsszavak: KreszelsősegélyértékesítésementődobozHajdúböszörménybuszosmentőládákcsomagfelszerelésekegészségügyimentőládadobozwebáruházunkbanmegrendelhetiközúti

Forrás: pepitahirdeto.multiapro.com

Fürjtápot keres? Nálunk az is van: 159,- Ft/kg A holland De Heus takarmányokat már Magyarországon is megvásárolhatja. Kiváló minőség és széles áruválaszték jellemzi. A fürjtáptól a lótápokig minden állatfajnak tudunk tápot biztosítani. Kiszállítás megoldott, viszonteladókat is kiszolgálunk.


Feladva: 2017-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: keresKiszállításKiválóFürjtápottápotmegoldottmegvásárolhatjaPadragkúttudunkviszonteladókatMagyarországonAjkaállatfajnakkiszolgálunkmárajánlóminden

Forrás: pepitahirdeto.multiapro.com

Miért Extrém Hatékony Önvédelem a Fülöp-szigeteki Doce Pares Eskrima? Miben más és jobb, mint a többi harcművészet? Ezekre a kérdésekre egyszerű, és világos a válasz: Mert extrém helyzetekben képes helytállni! A képzések helyszínei: Debrecen - Központ, Budapest - XIII. ker., Budapest - IV. ker., Hajdúszoboszló, Nyíregyháza, Mikepércs, Karcag. Tájékozódjon a honlapunkon!


Feladva: 2016-04-07    [Sport - Kemping - Túra]

Címkék, kulcsszavak: extrémDebrecenÖnvédelemHatékonykerBudapestEskrimaXIIIvilágosParesKözpontegyszerűDocekérdésekrehonlapunkonszigetekihelyszíneiEzekreTájékozódjon

Forrás: pepitahirdeto.multiapro.com

Balaton, Balatonfenyves, közvetlen vízparti szállás, üdülés, horgászat. Az udvarból a Balatonba léphet... csak 1 lépés a Balaton! Strandolás, horgászat helyben. Biztonságos, családias, gyermekbarát környezet. Ingyenes stég, csónak, vízibicikli, kerékpár használat. Bográcsozási lehetőség. SZÉP-KÁRTYA elfogadás! Nézze meg a honlapot és kérjen ajánlatot! NE FELEDJE: ... csak a halak vannak közelebb a Balatonhoz...


Feladva: 2016-09-25    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: csakhorgászatBalatonBalatonfenyvesilépésüdüléslehetőségBiztonságosvízpartiBográcsozásihelybenFELEDJEközvetlenhasználatajánlatotBalatonfenyveskerékpár

Forrás: pepitahirdeto.multiapro.com

Master, Big Master Böckmann lószállító akció és vásár! Master -WCF- ára: nettó 8.712,-Euro helyett nettó 8.386,-Euro + Áfa (bruttó 3.354.000,-Ft) Big Master -WCF- ára: nettó 10.193,-Euro helyett nettó 9.915,-Euro + Áfa (bruttó 3.966.000,-Ft) www.boeckmann.com/en/product/horse _trailer/master


Feladva: 2018-01-26    [Autó - Motor - Jármű]

Címkék, kulcsszavak: masterEuronettó000BigbruttóÁfalószállítóhelyettBöckmannáraWCFértékesítésMagyarországi966354utánfutó386712vásártrailer915akcióhorsecom

Forrás: pepitahirdeto.multiapro.com

Budapesten belül vállalok kedvező árakon burkolást és felújítást, nagy tapasztalattal! Rövid határidővel dolgozom, hétvégén is hívható vagyok. Árak: burkolás 3000.-/nm Mozaik, díszkő, diagonál 3200.-/nm Metro csempe 3500.-/nm Laminált parketta 1000.-/nm További részletek telefonon.


Feladva: 2017-10-11    [Lakossági szolgáltatás]

Címkék, kulcsszavak: BudapestenburkolásárakonLamináltvagyokkedvező3500hívhatóvállalokcsempehétvégénbelülMetrodolgozom3200határidővelBudapestdiagonálRövidtelefonon

Forrás: pepitahirdeto.multiapro.com

Nem tud bejutni ingatlanába? Elveszett a kulcs vagy beletört? Elhagyta vagy ellopták? Segítünk! Sérülés mentes zárnyitás minden nap 24 órás ügyelettel Budapesten és Pesten. Hétvégén és ünnepnapokon is elérhetőek vagyunk plusz költség mentesen! Zár nyitása, zárfeltörése non- stop ügyelettel. www.ajtoambulancia.hu/zarnyitas.ht ml


Feladva: 2017-05-13    [Lakossági szolgáltatás]

Címkék, kulcsszavak: ügyelettelvagyzárnyitásajtoambulanciamenteswwwtudvagyunkSérüléshttpNemelérhetőekSegítünkBudapestünnepnapokonelloptákstopZárfeltörésHétvégénnon

Forrás: pepitahirdeto.multiapro.com

Elhunyt szerettei fotóját megörökítő porcelán plakettek. Fénykép alapján porcelánfestékkel készülnek, 80 °C felett beégetve, kopásálló felülettel és fotó minőségben. Plakettek nagy forma és méretválasztékban! Sürgősséggel akár 2 nap alatt is elkészül a sírkőkép és már a ravatalozáson is ott lehet.


Feladva: 2016-01-04    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: PlakettekporcelánkészülnekBudapestméretválasztékbanporcelánfestékkellehetDekormániaformaalapjánottfényképesnagyFényképravatalozásonragaszthatómár

Forrás: pepitahirdeto.multiapro.com

Az egészségjavító AJÁNDÉKUTALVÁNY a legjobb ajándék. Ön eldönti,mennyit szán rá,a megajándékozott eldönti,hogy mire alkalmazza. Választási lehetőségek: - látás-hallás vagy memóriafejlesztő gyakorlatok,gyógytorna,gyógymasszáz s - alakformáló,zsírégető masszázs - fogyás kicsiknek és nagyoknak - biorezonanciás dohányzásleszoktatás. Bővebb információért hívjon a 06 30 907 47 86 telefonon. eletmod-debrecen.hupont.hu Életmód Stúdió


Feladva: 2017-12-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: StúdióÉletmóddebreceneldöntigyakorlatokmegajándékozottdohányzásleszoktatásmemóriafejlesztőszánbiorezonanciásvagymennyitnagyoknakhalláshupontajándék

Forrás: pepitahirdeto.multiapro.com

A legújabb divat szerinti és retro fazonú női csizmák világválasztéka! A legtöbb vásárlási lehetőséghez ingyenes házhoz szállítás (Free shipping) www.ebay.com/sch/Boots


Feladva: 2018-02-14    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: csizmáknőischlegtöbbcomvilágválasztékaebaywwwshippingfazonúFreeretroszállításszerintiházhozdivatingyeneslegújabblehetőséghezPepitaAdsBoots

Forrás: pepitahirdeto.multiapro.com

A fitt emberek webáruháza. Eredeti Body&Fit termékek Magyarországon. Étrend kiegészítő, sporttáplálkozási, diétás termékek. Fehérjék, aminosavak, protein szeletek, diétás édességek. Nézze meg weboldalunkat és adja le megrendelését.


Feladva: 2017-07-14    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: termékekFitBodydiétáshungaryproteinwebáruházabodyfitaminosavakemberekwwwFehérjékfittmegrendelésétBudapestadjasporttáplálkozásiweboldalunkatmeg

Forrás: pepitahirdeto.multiapro.com

Örökre búcsút vehet a súlyos patron és toner kiadásoktól, aki képes újratölteni azokat. Lehet akár tintasugaras, vagy lézernyomtató, esetleg fénymásoló. A módszerben segítünk. Vásároljon egy liter nyomtatótintát, vagy töltse újra drága tonerjét, akár 1.000 Ft alatti palackozott tonerporral!


Feladva: 2015-03-21    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: vagytoneregyakártintaestonerVásároljonkiadásoktólezerTintapatronsegítünkmódszerbenpatronfénymásolósúlyostonerjétlézernyomtatóvehetdrágabúcsút

Forrás: pepitahirdeto.multiapro.com

Egy immunerősítő gyerekeknek nemcsak akkor hatékony, ha véd a fertőzésektől, hanem ha ahhoz is hozzájárul, hogy a kicsik egészségesen fejlődhessenek. A colostrum éppen ilyen. Immunerősítő gyerekeknek előtejből, melyben megtalálhatók az immunfaktorok, növekedési faktorok és tápanyagok is. A vizsgálatok szerint legalább 50 féle különböző folyamatot támogat az újszülött szervezetében, köztük a védekezőrendszer kiépítését is. A colostrum immunrendszer erősítő gyerekeknek, felnőtteknek, sportolóknak ... további részletek >>

egyformán áldásos hatásokat tartogat a megelőzésben és a teljesítmény fokozásában.


Feladva: 2017-05-02    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: gyerekeknekImmunerősítőcolostrumvizsgálatoktartogatfejlődhessenekvédekezőrendszernemcsaktápanyagokhatásokategészségesenköztükEgyfaktorokáldásoskicsik

Forrás: pepitahirdeto.multiapro.com

-AKCIÓS SERTÉSHÚS ÁRAK !- Sertéscomb ár : 890 Ft/kg Sertéslapocka ár : 880 Ft/kg Sertéskaraj ár : 890 Ft/kg Sertésoldalas ár : 880 Ft/kg Sertésdagadó ár : 880 Ft/kg Sertéstarja ár : 880 Ft/kg Sertéscsülök ár : 690 Ft/kg Budapest 1113.Bocskai út 42 sz. --- Telefon:061/3611-609 --- Web: www.lazarhus.hu Email: lazarhusmintabolt@gmail.com< /a>


Feladva: 2016-08-16    [
Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: 880BudapestÁRAKSERTÉSHÚSAKCIÓS890Email690lazarhusSertéscsülökwwwÉlelmiszerWebSertéstarjaHús609SertésdagadóLázár3611SertésoldalasBudapesten

Forrás: pepitahirdeto.multiapro.com

A mosott kavics 16-32 ára bruttó 4200 Ft/m3. A folyami kavics 16-32 ára bruttó 4200 Ft/m3. A dunai kavics 16-32 ára bruttó 4200 Ft/m3. A dísz kavics ára bruttó 5842 Ft/m3. A gyöngy kavics ára bruttó 5842 Ft/m3. Az osztályozott kavics ára bruttó 5842 Ft/m3. A rostált kavics ára bruttó 5842 Ft/m3. A bánya kavics ára bruttó 3500 Ft/m3. A töltő kavics ára bruttó 3000 Ft/m3. A mosott dunai folyami kavics 24-40 kerti utak, parkok lefedésére, a rostált osztályozott dísz kavics 16-32 ... további részletek >>

lábazatok díszítéséhez, szikkasztóhoz, a gyöngy kavics 4-8 és a gyöngy kavics 8-16 parkok, játszóterek lefedésére, a bánya és a töltő kavics terület feltöltésre, szerelő beton alá használható. A mosott kavics, osztályozott kavics, dísz kavics, gyöngy kavics, kulé kavics, rostált kavics, töltő kavics kapcsán felmerülő kérdéseikre szívesen válaszolunk, e-mail címünk és telefonszámaink honlapunkon megtalálhatóak.


Feladva: 2016-10-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: kavicsbruttóáragyöngydíszosztályozottmosott5842rostált4200töltőfolyamidunaikulébányalefedéséreparkokfeltöltésrehonlapunkonszállításterület

Forrás: pepitahirdeto.multiapro.com

ALOE VERA BABAÁPOLÁS! A szett tartalma: - Aloe Vera baba arc és testápoló érzékeny bőrre - 100 ml - Aloe Vera habfürdő és sampon érzékeny bőrre - 250 ml - Aloe Vera baba krém érzékeny bőrre - 100 ml A három termék együtt: 7990 Ft A babák és a gyerekek gyengéd bőre nagyon érzékeny, hiszen még fejlődik! Ahhoz, hogy megfelelően védjük, fontos az alapos ápolás. A termékcsalád ápoló termékei 40%, a tisztító termékei pedig 30% aloe verát tartalmaznak. Kíméletesen ápolják az érzékeny ... további részletek >>

bőrt. A bio calendula kivonat regenerálja és védi a bőrt. A bőrbarát termékek nem tartalmaznak parabént és ásványi olajokat. Védik a bőrt a kiszáradással szemben, hiszen elegendő nedvességgel látják el. A mamák teljes körű ápolására is gondolva: a termékcsalád egy masszázs balzsamot is tartalmaz, melyet az anyukák terhességtől megviselt bőrére lett kifejlesztetve. A balzsam ideálisan ápol és támogatja a bőr rugalmasságát. A babák bőrén is használható!


Feladva: 2017-11-22    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: aloeveraérzékenybabacalendulaBABAÁPOLÁStermékcsaládbőrrebőrtbabáktartalmaznakmelyetbőrmártermékeihiszen100ápolókrémelterjedtfejlesztettünk

Forrás: pepitahirdeto.multiapro.com

Autómentés a nap 24 órájában az év minden napján belföldön minden gépjármű-kategóriában. • Rendelkezésre állás: 0-24 óráig! • Autómentő kiállási ideje Budapesten: 30-40 perc • Autómentő kiállási ideje vidékre/külföldre: azonnali indulással, a lehető legrövidebb időn belül!


Feladva: 2016-01-23    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: 8226Autómentés6499188TelIstvánMészárosmindenidejekiállásiAutómentőnapbelülidőnpercDunakeszilegrövidebbBudapestenautószállításlehetőóráigNon

Forrás: pepitahirdeto.multiapro.com

KI SZERETNÉ a KÖZÖSSÉGI MÉDIÁVAL MEGALAPOZNI a JÖVŐJÉT? Mindig gondoltam, hogy az internet és a közösségi média milyen hatalmas üzlet. Jó lenne részese lenni, ennek az üzletnek! Most részed lehet benne, neked is, ha érdekel Új cég Magyarországon, márciusban indul. További infókért írj Preregistration


Feladva: 2018-02-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: érdekelközösségiüzletMÉDIÁVALnekedhatalmasSZERETNÉbennemilyenPreregistrationÁgilehetmédiaírjSárközinérészedinfókértEuroMostinternetTovábbi

Forrás: pepitahirdeto.multiapro.com

Ha az év eleji elhatározása az, hogy leteszi a cigarettát, jó hírem van: - egyetlen biorezonanciás kezeléssel a dohányzás leszoktatás gyors és szenvedésmentes - megszűnik a nikotinéhség - az elvonási tünetek minimalizálódnak - most 1-et fizet,2-t kap, vagyis a kezelés után választhat 1 ingyenes állapotfelmérést, vagy 1 hónapon belül megismételheti a dohányzásleszoktató kezelést ingyenesen. Cigaretta nélkül az élete fittebb, szabadabb, sikeresebb. Bővebb információért, időpont ... további részletek >>

egyeztetésért hívjon a 06 30 907 47 86 telefonon. eletmod-debrecen.hupont.hu Életmód Stúdió


Feladva: 2018-01-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: kapfizetdebrecenidőpontegyeztetésértdohányzásleszoktatásdohányzásleszoktatóNagynéinformációértkezelésselmegismételhetiZitaBővebbbiorezonanciásbelülkettőt

Forrás: pepitahirdeto.multiapro.com

Tudtad, hogy 2016-tól a Gördeszka Olimpiai sportág? Végre :) Most meg tudod mutatni, ki vagy. Tanulj a Legmagasabb szintű módszerrel. Kerüld az ”utcán haveroktól v. önállóan megtanulom” elvet. Hacsak nem akarod, hogy 30 éves korodra széthulljanak az ízületeid, ínszalagjaid, csontjaid. A sikered 100%-ig attól függ: - ki az oktatód - milyen a technikai-módszer Őrizd meg az egészséged. Legyél Pro deszkás. Tanulj a Legjobb módszerrel. Juss ki akár a 2020-as Olimpiára. ... további részletek >>

Teljesen kezdő vagy? Rémület fog el, ha az esésekre gondolsz? 1) 90 perc alatt 2) Teljesen a Nulláról 3) Alap szinten 4) Stabilan 5) Baleset nélkül, esés-mentesen megtanítunk gördeszkázni.


Feladva: 2017-07-12    [Sport - Kemping - Túra]

Címkék, kulcsszavak: 8221meg2020TeljesenakárJussGördeszkamódszerrelhogyTanuljvagyLegyéltudodsikeredPepitaszintenkezdőelvetegészségedMostcsontjaidOlimpiaAlap

Forrás: pepitahirdeto.multiapro.com

L-Recapin® Hajsampon: Bőrgyógyászatilag tesztelt hatóanyag kombináció, kíméletesen ápol! Ha rendszeresen használjuk az L-Recapin Hajtonikkal kombinálva, segít visszaállítani a haj és a fejbőr egészséges állapotát. L-Recapin® Hajtonik: Megállítja az örökletes hajhullást! Hajmosás után vigyük fel a nedves fejbőrre és körkörös mozdulatokkal masszírozzuk be! Csak mindkét termék rendszeres és tartós használatával érhetjük el a kívánt hatást! L-Recapin hajápolócsalád!


Feladva: 2016-05-10    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: RecapinHajtonikegészségeshasználatávalkombinációfelfejbőrtartóshatóanyagvigyükhajrendszeresteszteltutánvisszaállítanitermékbőrgyógyászatilagsegít

Forrás: pepitahirdeto.multiapro.com

A D3 vitamin hatása nagyon jelentős, a legtöbb ember szervezetében mégis csak a kelleténél kevesebb található belőle. A hiány pedig súlyos következményekkel járhat! A D 3 vitamin fogyasztás rendszeresen már gyermekkortól kezdve fontos, amikor a csontok, a fogak és az izmok fejlődése a legaktívabb. Ilyenkor különösen oda kell figyelni rendszeres pótlására, hogy elkerüljük az angolkór és más mozgásbeli rendellenesség kialakulását. A D3 vitamin hatása kiterjed az immunrendszerre, az idegrendszerre, ... további részletek >>

a szív- és érrendszerre is. Segítségével sok gyakori krónikus betegség megelőzhető. www.d3.d-vitamin.bolt.hu/d3-vitamin


Feladva: 2017-07-25    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: vitaminhatásaidegrendszerrekövetkezményekkelhogyemberfogakimmunrendszerresúlyospótlásáralegtöbbcsontokkiterjedpedigrendszeresjelentősamikorhiány

Forrás: pepitahirdeto.multiapro.com

Vállalom: - Kft-k, Bt-k, kis- és közép vállalkozások teljes körű munkavédelmi, tűzvédelmi képviseletét - Oktatásokat, kötelező munkavédelmi kockázatértékeléseket - Új típusú Tűzvédelmi Szabályzatok készítését, zaj, fény, hő, pára mérések elvégzését Természetesen számlával. Bővebb információ, referenciák, megjelent publikációim a honlapomon megtalálhatóak: www.munkaszabo.5mp.eu


Feladva: 2016-05-08    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: munkavédelmiTűzvédelmiközépBővebbtípusúkisszámlávaléttékelések5mpKftTermészetesenkockázatmunkaszaboVállalomelvégzésétwwwZoltánmérésekkötelező

Forrás: pepitahirdeto.multiapro.com

Ha felmerült már benned, hogy Te is lehetnél ingatlanértékesítő, csak nem tudtad, hogyan kezd el, Ha gondoltál már arra, milyen jó volna egy igazán jó csapatban dolgozni, és sikert elérni, Ha eszedbe jutott már, hogy szeretnél végre Te is átlag feletti jövedelemhez jutni, Ha rájöttél, hogy változtatni szeretnél az eddigi életeden, Ha szeretnél a jelenleginél valahogy többet, mást, jobbat, és kész vagy tenni is érte, akkor a legjobb helyen vagy!! Balatoni ingatlanirodánk munkatársat ... további részletek >>

keres Ingatlan tanácsadó munkakörbe. HIDD EL LEHET MÁSKÉNT! Kidolgoztunk egy olyan egyedi, ingatlan értékesítési rendszert, amely során kollégáink egymást tisztelve és támogatva, hatékonyan képviselik ügyfeleinket. Egy biztos, ha jelentkezel, és kiválasztunk, megváltozik az életed. Ha keresgélsz tovább, holnap is ugyan azt fogod csinálni, amit idáig. Biztosan ezt akarod? Mi lenne a feladatod? - megbízáskötés - potenciális vevőink számára megtalálni a megfelelő ingatlant - eladó piacképes ingatlanoknak vevőt találni - tárgyalásokat bonyolítani, lakásokat megtekinteni, értékelni, bemutatni - kapcsolatot tartani meglévő és új ügyfelekkel Mit érdemes még tudni? - értékesítési tapasztalat előny, de nem előfeltétel Mik az elvárásaink ? - kiválóan kommunikáció - 1-2 éves munkatapasztalat - mind önállóan, mind csapatban megállja a helyét - kitartó és vállalkozói szemléletű - ápolt a megjelenése - szeret emberekkel foglalkozni - sikerorientált Mit nyújtunk mi ? - alapképzés mellett, folyamatos továbbképzési lehetőség biztosított - mentori rendszer segít a sikeres munkavégzésben - minden értékesítő maga osztja be a munkaidejét - változatos a munka Várjuk jelentkezését fényképes önéletrajzzal a frank.andrea@dh.hu e-mail címen. Amennyiben pályázata megfelel elvárásainknak, úgy a többfordulós kiválasztási folyamat kezdeteként egy személyes találkozó időpontjának egyeztetése céljából értesítjük.


Feladva: 2018-02-05    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: ingatlanegyszeretnélmárhogyingatlanirodánkBalatonivagyMitnemcsapatbanmunkakörbemindtanácsadóértékesítésikeresmunkatapasztalatszámárarendszert

Forrás: pepitahirdeto.multiapro.com

Zárszerviz Budapesten non-stop elérhető Zárszerviz gyors szolgálat éjjel nappal várja hívását ha Zár probléma akadt. Budapest területén egy órán belül és kiszállási díj nélkül végezzük munkáinkat. Szolgáltatásaink: Zárszerviz Zárcsere Ajtónyitás Zárnyitás Betörés utáni helyreállítás Lakatos munka Hisec ajtó zárszerviz Kínai ajtó zárszerviz Műanyag ajtó zárszerviz Biztonsági ajtó zárszerviz Ha zár probléma akadt mi vagyunk a megoldás kulcsa! Rejtett ... további részletek >>

költségek nélkül garanciával állunk rendelkezésére az év minden napján. Bővebben: www.zarszervizmester.hu


Feladva: 2017-05-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: zárszervizajtózarszervizmesterakadtproblémazárnélkülköltségekhívásátMűanyagSzolgáltatásainkRejtettvárjaKínaimunkáinkatwwwkulcsanappalHisechttp

Forrás: pepitahirdeto.multiapro.com

Kimerít a mindennapos rohanás? Vagy fásulttá tesznek a szürke hétköznapok? Már régen érezted szeretve magadat? Ha olyan masszázsra vágysz, ahol érzed, hogy szeretettel vagy érintve, akkor jó helyen jársz :) Ebben az órahosszában a figyelmem csak a tiéd, aminek hatására teljesen kipihentnek, ellazultnak fogod érezni magadat. A relaxált állapot már önmagában is beindítja a szervezet regeneráló folyamatait, aminek hatására gyógyulások mennek végbe a legkülönbözőbb területeken. Ezt ... további részletek >>

még fokozhatjuk azzal, hogy a kezelés elején immunerősítő energiákat indítok el, ami a masszírozás ideje alatt végig dolgozik a test izmaiban, sejtjeiben. Aki erre vágyik, szívesen jön vissza újra és újra és újra ... Ha kipróbálnád Te is, szeretettel várlak Kecskeméten a Széchenyivárosban csendes környezetben. www.egeszseg-wellness.hu/masszazsok


Feladva: 2017-07-31    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: újravagymárszeretettelmagadathatásárahogyaminekvégigfogodKutiazzalakkorvisszafolyamataithétköznapokalattellazultnakmasszázsfokozhatjukérintve

Forrás: pepitahirdeto.multiapro.com

Nagyszerű lehetőség boltok, vállalkozások számára! Hangulat színváltó ékszerek, melyek hőmérséklet változásra színt változtatnak, 12 féle színárnyalatra képesek. Most a 48 darabos állványos kezdőcsomag segítségével akár 200%-os haszonra is szert tehet! www.hangulatosbolt.hu/kereskedokne k-hangulat-nyaklanc-48-db-os-indulo -keszlet/szinvalto-hangulat-ekszere k/szinvalto-hangulat-nyaklanc/-p902 745.html


Feladva: 2018-01-22    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ékszerek200akárhőmérsékletHANGULATOSkezdőcsomagmelyekhaszonállványosértékesítéséveldarabosszínváltóMostHangulatképesekszámáratehetszínárnyalatra

Forrás: pepitahirdeto.multiapro.com

Sasszem Magánnyomozó és Tanácsadó Iroda Fontos Önnek az eredmény, a diszkréció, a gyorsaság és a precizitás? Ha igen, akkor válasszon minket magánnyomozói megbízása végrehajtására! Szolgáltatásaink: - Leplezett megfigyelés, követés - Hűtlenség bizonyítása, leleplezése - Eltűnt személyek, tárgyak felkutatása - Hűségteszt, hűségpróba - Adósságbehajtás - Cégen belüli (bűn)cselekmények felderítése - Számítástechnikai eszközök védelme - Környezettanulmány, személyek átvilágítása - ... további részletek >>

Információk, bizonyítékok beszerzése - Csapatépítés. Próbálja ki magát!


Feladva: 2017-05-22    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: SasszemszemélyekIrodaMagánnyomozóbizonyításabeszerzéseakkorbűnHűtlenségbizonyítékokigenbelüliajánlókövetésInformációkprecizitásCégenHirdetőPepita

Forrás: pepitahirdeto.multiapro.com

Rajtad is múlik, hogy NE legyenek katasztrófák, NE pusztuljon ki a világ! www.onfejlesztes6.webnode.hu


Feladva: 2017-06-19    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: webnodeRamsbergonfejlesztes6ÉvahttpHalmaivilágNyárinépusztuljonDorfstrkatasztrófákOberelegyenekhogymúlikRajtadBayern

Forrás: pepitahirdeto.multiapro.com

Meg Vagy Te Őrülve??? Kidobod a tintapatronodat ahelyett, hogy feltöltenéd??? Más emberek ezrei nyomtatnak ÖTÖD-, vagy akár TIZEDÁRON, egy teljesen biztonságos, egyszerű módszerrel, súlyos ezreket, tízezreket takarítva meg a tintapatronjaikon! Nyomtass Te is ÖTÖD-, vagy akár TIZEDÁRON! Kattints és tudd meg, hogy ez mennyire olcsó és egyszerű!


Feladva: 2015-09-06    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: megvagyhogyTIZEDÁRONŐrülveakárRefillParadiseÖTÖDegyszerűmennyiretakarítvaMártízezreketfeltöltenédezreketahelyetttuddsúlyostintapatronodategy

Forrás: pepitahirdeto.multiapro.com

Eladom bélyeggyűjteményemet egyben vagy darabonként. Érdeklődni lehet: Bodor Csaba: 06-20/556 9841 bodormotor@gmail.com


Feladva: 2017-05-27    [Hobbi - Gyűjtemény - Modell]

Címkék, kulcsszavak: CsabaBodorÉrdeklődnidarabonkéntvagyegybencombélyeggyűjteményemetbodormotor@gmailEladom9841Tahitótfalu556eladóBélyeglehet

Forrás: pepitahirdeto.multiapro.com

Lökhárító, motoridom javítás és műanyag karosszéria javítás, horpadás javítás, műanyaghegesztés. Sérült, törött lökhárítók, fényszórók és egyéb műanyag alkatrészek javítása. Robogók, nagymotorok műanyag burkolatainak javítása. Műanyag háztartási, és egyéb eszközök javítása. Képek és árak a honlapon! Tel. : (30) 9 124- 279 Budapest 1105, Halom u. 42.


Feladva: 2017-01-24    [Autó - Motor - Jármű]

Címkék, kulcsszavak: javításMűanyagjavításamuanyagjavitashttpegyébBudapestLökhárítófényszórókZentaiKépeklökhárítókMŰANYAGJAVÍTÁStörötteszközökSérültHalom1105horpadás

Forrás: pepitahirdeto.multiapro.com

A forró kávé varázsát gondolom, nem kell bemutatnom. De mi a megoldás nyári kánikulában, mikor inkább egy jéghideg italra vágyunk? A DXN Ganoderma gyógygombás kávékülönlegességei hidegen is nagyon finomak, és amit még jobb, nem vagyok forró vízhez, konyhai eszközökhöz kötve: bárhol el tudom magamnak készíteni egy perc alatt: www.kavekiraly.hu/blog-2017-06-19- DXN_Ganoderma_kave_keszitese_hideg_ vizzel


Feladva: 2017-07-01    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: alattforróperckávéegynemGanodermaDXNbárholhidegenkavekiralybemutatnomkonyhaikávékülönlegességeihttpkellvízhezgyógygombásgondolomvizzelvágyunk

Forrás: pepitahirdeto.multiapro.com

Amerikában (Pennsylvania és New York államokban) szállodai és bentlakásos házvezetőnői állások, pároknak és hölgyeknek egyaránt” Leinformálható, megbízható, segítőkész!


Feladva: 2016-09-16    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: LeinformálhatóAmerikábanYorkNew8221PennsylvaniaegyaránthölgyeknekBudapestpároknakKleinállásokMirjamházvezetőnőimunkákbentlakásosszállodaisegítőkész

Forrás: pepitahirdeto.multiapro.com

Törökbálinton a Depóba raktári takarítási munkára keresünk főállású takarítókat délelőttre, illetve délutánra egyaránt (reggel 6 és délután 18 óra között elosztva 2 x 8 órában átfedéssel). Feladatok: kézi és gépi takarítás egy szép igényes rendezett raktárban. Napi 8 órás munkaidő hétfőtől péntekig, a hétvégék szabadok. Elsősorban férfi alkalmazottat keresnénk, de minden megoldásra nyitottak vagyunk. Jelentkezni telefonon a 20/9-268-790-es számon, illetve önéletrajz küldésével lehet, ... további részletek >>

fizetési igény megjelölésével.


Feladva: 2017-05-29    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: illetveküldésévelátfedésselmindenállásúNapiállásönéletrajzórábankeresnénkkeresünkraktárbantakarítóelosztvaalkalmazottatmunkárarendezettszámon790

Forrás: pepitahirdeto.multiapro.com

Vásároljon első kézből a Devon fürdőszobabútorok magyarországi forgalmazójától, nagy és kiskereskedelmi kiszolgálás, kedvező ár! Fürdőszobabútoraink széles választékával várjuk önöket csepeli raktár áruházunkban. Bútoraink festett fényes fehér MDF előlappal rendelkeznek, lapraszerelt állapotban, karton dobozban kerülnek átadásra. www.majerszerviz.hu/furdoszobabuto r.html


Feladva: 2017-09-19    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: furdoszobabutorDevonválasztékávalkézbőlMDFszélesmajerszervizelsőfehérFürdőszobabútorainkwwwVásároljonfényeskedvezőátadásraajánlófestettkiszolgálás

Forrás: pepitahirdeto.multiapro.com

Ha nyaralni, üdülni, vagy egyszerűen kikapcsolódni szeretne a Balatonnál, jó helyen jár, válasszon minket, a 2× 5+1 férőhelyes, két hálóteres, az egész évben nyitva tartó apartman házunkat Siófokon. Az apartman Siófok kertvárosában helyezkedik el, közel mindenhez. A Balaton kb. 15 perc séta, a Galerius fürdő kb. 10 perc autóval. A feltüntetett ár 1 db 5 fős apartmanra értendő főszezonban! Új szolgáltatásunk, dézsafürdőnk is igénybe vehető (egyeztetést igényel). T: 06302760722 ... további részletek >>

Figyelem! Ha bulizó helyet keresnek, akkor ne minket válasszanak!


Feladva: 2016-12-02    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: BalatonnálminketSiófokapartmanpercSiófokonvehetőhelyenfürdőházunkatválasszanakigénybeGaleriustartódézsafürdőnkszeretnesétanyitvaakkorBalaton

Forrás: pepitahirdeto.multiapro.com

Magyar termék, közvetlenül a gyártótól. 5 év garancia! Új ZS-Therm vegyes-tüzelésű kazánok: 15,22,27,35kw teljesítményben már 71.500 Ft + áfától. Kizárólag nyitott rendszerre (próbanyomás: 0,8 bar), vagy akár zárt rendszerre (próbanyomás: 3 bar) is szerelhetők. A kazánokhoz tartozékok megvásárolhatók 8000 Ft + áfás áron. Kazánjaink VM MGI vizsgálatával, TÜV Tanúsítvánnyal és CE Megfelelőségi jellel rendelkeznek. A kazánok mellett fűtési puffertartályok, gabonakanalak, pótkocsi ... további részletek >>

felépítményekhez hajlított trapézlemezek gyártásával is foglalkozunk. Ezúton szeretnénk felhívni figyelmüket a puffertartály akciónkra! Pl: 1000 literes puffertartály 69000 Ft + áfa! Termékeink értékesítéséhez hazai és külföldi (szlovák, román) viszonteladókat keresünk. Bővebb információért forduljon hozzánk bizalommal!


Feladva: 2017-10-02    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: barpróbanyomásrendszerretüzelésűvegyeskazánokpuffertartályhajlított500keresünkTanúsítvánnyalMagyarliteresszerelhetőkfelépítményekhezmárTÜVajánlás

Forrás: pepitahirdeto.multiapro.com

A Balaton-felvidéken, Badacsonyhoz 5 km távolságra káptalantótii szálláshelyek fényképes gyüjtőoldala. Kiadó panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Sok fényképpel a szálláshelyekről és a faluról. - Weblap: www.zimmerinfo.hu/kaptalantoti/hu. htm


Feladva: 2017-05-10    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: zimmerinfoszálláshelyekközvetítésipanziókszálláshelynélKiadówwwlehetőséggyüjtőoldalahttpfoglalásifényképesWeblapközvetlenfalurólelérhetőségükkelSok

Forrás: pepitahirdeto.multiapro.com

Bellelli B-One Clamp gyerekülés, hátsó, csomagtartóra szerelhető Hátsó gyermekülés. Szerszám nélkül a csomagtartóra rögzíthető. Használata 7 éves korig javasolt. Maximum teherbírás 22 kg. Egy kézzel ki/be csatolható biztonsági öv. Szürke vagy kék színben. www.bicyclewebshop.com/?1260,belle lli-b-one-clamp-gyerekules-hatso-cs omagtartora-szerelhetö=2591


Feladva: 2017-09-18    [Baba - Gyerek - Játék]

Címkék, kulcsszavak: gyerekülésclampcsomagtartóraonebellelliHátsószerelhetőwwwjavasoltszínbenkorigajánlókékévesHirdetővagyHasználataPepitaSzürkerögzíthetőKerékpár

Forrás: pepitahirdeto.multiapro.com

Bontott kisméretű tégla 75 Ft/db Országos kiszállítás! www.bontott-tegla.co.hu


Feladva: 2016-09-12    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: teglabontottkisméretű75FtÉrdKöveswwwkiszállításOrszágos

Forrás: pepitahirdeto.multiapro.com

PÉCS-től 4 km-re, a MECSEK lábánál, Cserkúton a Vackor Vendégházakba várjuk vendégeinket egész évben! Szép, csendes környezetben a négy különálló, összkomfortos vendégházunk összesen 20 alapággyal és 4 pótággyal működik. Lakásonként hálószobák, fürdő, WC, nappali-konyha, TV-műhold, mikró, kávéfőző, kenyérpirító, hűtőszekrény van. SZÉP Kártyát elfogadunk. Gyerekkedvezményt is adunk. Igény szerint étkezést is biztosítunk. Várjuk gyermekes családok, baráti társaságok, természetjárók, ... további részletek >>

nyugdíjasok jelentkezését!


Feladva: 2016-07-12    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: VárjukSZÉPműködikegészhűtőszekrényKonczpótággyalbiztosítunkvendégeinketkenyérpirítóSomogyvárinéalapággyalétkezéstVendégházakbakávéfőzőVackorokbannégy

Forrás: pepitahirdeto.multiapro.com

Nátha ellen elsősorban az immunrendszerünk folyamatos erősítésével védekezhetünk. A sok C-vitamin jelenti a legjobb módszert, de még ez sem zárja ki teljesen, hogy évente néhány alkalommal megfázzunk. Mivel nátha és megfázás elleni gyógyszer nem létezik, más módszerekkel kell kikúrálni magunkat. A sok gyümölcs és a sok folyadék gyorsítja a felépülést, az orrspray segítségével lelohaszthatjuk a nyálkahártya duzzanatát, a köhögéscsillapítók pedig az egyik legzavaróbb tünettől szabadítanak meg. A ... további részletek >>

nátha ellen tehát házilag is sikeresek lehetünk, egészséges felnőtt esetében a teljes gyógyulás általában 7-10 nap alatt végbemegy.


Feladva: 2017-12-04    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: náthasokellenmeggyógyulásmáshogyimmunrendszerünkorrsprayteljeslétezikteljesenszabadítanakelsősorbanfelépüléstesetébennemzárjatünettőlKittisem

Forrás: pepitahirdeto.multiapro.com

Kecskemét mellett Helvécián dinamikusan fejlődő településen, autópályától és a Mercedes gyártól 3 percre kiadó egy nettó 50/170 négyzetméteres kis műhely, udvarral, kis előtelővel, bekerítve. Nyugodt területen, műhelynek, rajtárnak, telephelynek.


Feladva: 2013-08-04    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: HelvéciánmellettKecskemétkiadóMercedeselőtetővelautópályátólkistelepülésenudvarralfejlődő661kisműhelydinamikusanÉrd170nmtelephelyneknettóegy

Forrás: pepitahirdeto.multiapro.com

Kérjük, hogy támogassák alapítványunkat, és így együtt segíthetünk azoknak, akiknek a lakhatása veszélybe került, vagy máris hajléktalanok. Ezzel hozzájárulhatunk emberi életfeltételeik minimumának megteremtéséhez. Köszönjük az utalást, megosztást és mindenféle segítő felajánlást! Erre az OTP számlaszámra várjuk a felajánlásokat: 11707000-20490166 (IBAN): HU73 1170 7000 2049 0166 0000 0000 SWIFT kód OTPVHUHB Adószám: 18739196-1-42


Feladva: 2016-10-29    [Közlemények - Felhívás - Adomány]

Címkék, kulcsszavak: 0000SzívNyugodtKöszönjükkódveszélybefelajánlásokatMagyarországmegteremtéséhezSWIFTlakhatásavárjukajánlóminimumánakakiknekszámlaszámraHirdető0166

Forrás: pepitahirdeto.multiapro.com

Ruhajavító üzletbe képzett varrónőt keresünk, felsőruházat és általános varrási munkák elvégzésére. Érdeklődni a 06 30 222 2912 vagy a 06 30 222 2912 -es telefonon lehet Munkaidő: Kedd - Péntek -ig Web: www.altalanosruhaszerviz.freewb.hu


Feladva: 2017-10-06    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: keresünkvarrónőt2912222üzletbeRuhajavítótelefononképzettfreewbvagyaltalanosruhaszervizÉrdeklődniLaszlohttpelvégzéséreBerkesWebmunkáksürgősen

Forrás: pepitahirdeto.multiapro.com

Új Kocsik Érkeztek!!! Most Több Darabból Választhat! Téliesített, Kiváló Állapotban Lévő Büfékocsi Berendezéssel Együtt Kiadó! Rendelkezik a szükséges szakhatósági engedélyekkel, személyautóval, B-s jogosítvánnyal kényelmesen vontatható, azonnal munkára fogható! A bérléshez 1 havi bérleti díjnak megfelelő kaució szükséges! Külföldi használat esetén a bérleti díj havi 400,- Euró, a kaució pedig Magyarországtól való távolságtól függ! Egész Szezonra Történő Bérlés, és előre fizetés esetén ... további részletek >>

díjkedvezményt biztosítunk! Büfékocsi Kölcsönző Eger, A Legjobb Feltételekkel!!! Nyitva: H-P: 08-16:30; SZ: 08-12; V: Zárva Kérem a fenti időpontokban érdeklődjenek!!! Kérem tekintse meg honlapunkat!


Feladva: 2016-10-14    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BüfékocsibérletiKölcsönzőKéremszükségeseseténkaucióBérléshaviEgerEgészÁllapotbanmegkényelmesenfüggKiválótekintsehasználatjogosítvánnyalKülföldi

Forrás: pepitahirdeto.multiapro.com

Van egy szuper lehetőség! Shoppingoltál már úgy hogy közben pénzt is adtak érte?! A világon Egyedülálló rendszer, extra lehetőség, amelyre jelentkezz most! Várom érdeklődésed, írj mielőbb, mert számít az idő!


Feladva: 2017-11-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: lehetőségegyElviraérdeklődésedadtakSzakálVárompénztshoppingolássalmostközbenProfitáljjelentkezzhogyamelyreúgymáridőextraShoppingoltálszámít

Forrás: pepitahirdeto.multiapro.com

Miért érdemes még hozzánk jönni? ⋅ mert ha valamit nincs nálunk, azt 24-48 órán belül megszerezzük ⋅ mert termékigényét eljuttathatja hozzánk a webáruházon keresztül, vagy e-mail-en, amit aztán célba juttat egy futár, esetleg átveheti egy PickPackPont-on, de akár személyesen is ⋅ mert üzletünkben van: spirálozás, fénymásolás, laminálás, nyomtatás, bélyegzőkészítés és szkennelés, (e-mail-ben juttassa el hozzánk dokumentumait majd a kész kötészeti anyagot vegye át a ... további részletek >>

futártól, vagy a PPPonton. ⋅ mert szakmai tanácsot is adunk (térítés nélkül!). Aki inkább a hagyományos vásárlást részesíti előnyben, azt szeretettel várjuk kiskereskedelmi üzletünkben: 1133 Budapest, Dráva u. 5/d. H - CS: 9.00 - 17.00; P: 9:00 - 16:00 óra között.


Feladva: 2017-10-04    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: mert8901hozzánkaztvagymailBudapestegyüzletünkbennélkülesetleganyagotbelülnyomtatásajánláskiskereskedelmitérítésfutárkötészetióránlaminálás

Forrás: pepitahirdeto.multiapro.com

Elöfordul, hogy minden ok nélkül szorong, ideges, meggondolatlan, bizonytalan, félénk, rosszkedvü vagy szomorú? A Dianetika adja meg erre a magyarázatot!


Feladva: 2017-12-10    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: adjamindenDianetikahogyszomorúElöfordulvagyXIIIrosszkedvüBudapestfélénkMarcsibizonytalanajánlommeggondolatlanszivvelmagyarázatotidegeserremeg

Forrás: pepitahirdeto.multiapro.com

Jó minőségű külső és belső fa nyílászárók, harmonika-toló, emelő-toló, bukó-toló erkélyajtók, valamint egyedi méretre gyártott konyha-háló-fürdőszoba-ebédlő-gardr ób-gyerekszoba-nappali-iroda-üzleti bútorok közvetlenül a gyártótól! Kérem hívjon bizalommal! 0620/473-7816 Megnyílt Nyergesújfalun a Kossuth Lajos u. 70. alatt a GU-BKS viszonteladói boltja! Minden kedves vásárlót szeretettel várunk! Tel/Fax: 0633/355-111


Feladva: 2016-10-17    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: tolóharmonikaBKSajtóKéremhálóFaxnyílászárókalattgyártótólkonyha0633belsőLajosközvetlenülgyártottTelkülsőKossuthbútorokméretrevárunküzleti

Forrás: pepitahirdeto.multiapro.com

A Pongó Vendégház Gádoros Nagyközség központjában található, a három darab kétszemélyes (pótágyazható) szobában tusoló, WC, franciaágy, kábeltelevízió, wifi elérés áll rendelkezésre. Egy szoba légkondicionált és akadálymentesített. Minden szükséges eszközzel felszerelt közös konyhában készíthetik el a lakók ételeiket. Befogadóképesség: max. 9 fő Szobafoglalás, információ: Bencsik Sándorné: +36703299481 Elérhetőség: 5932 Gádoros, Jókai u. 5. www.pongovendeghaz.oldalunk.hu ... további részletek >>


Feladva: 2017-03-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: GádorosSándornépongovendeghazBencsikVendégházPongówwwoldalunkszobábanBefogadóképességlégkondicionáltJókaipótágyazhatóételeiketszobakétszemélyeslakók

Forrás: pepitahirdeto.multiapro.com

Gyári és utángyártott autóalkatrészek 35-50%-os kedvezménnyel! Raktárról, vagy megrendelésre, rövid határidővel, garanciával. Folyamatosan frissülő akcióinkkal várjuk kedves meglévő és leendő vevőinket. 1047 Budapest, Baross utca 35. 06-1-350-6202 06-20-330-6666 Hétfő 08.30 – 17.00 Kedd 08.30 – 17.00 Szerda 08.30 – 17.00 Csütörtök 08.30 – 17.00 Péntek 08.30 – 16.00 Olajszűrők: 900.- Ft-tól Levegőszűrők: 1200.- Ft-tól Utastérszűrők: 1500.- ... további részletek >>

Ft-tól Fékbetétek: 4000.- Ft-tól Féktárcsák: 8000.- Ft-tól/pár Vízpumpák: 4500.- Ft-tól Ablaktörlők: 3000.- Ft-tól Régebbi VW alkatrészek Kuplung szettek Futóműalkatrészek Karosszéria elemek, lámpák, rácsok, stb... Az ünnepi nyitvatartásokról honlapunkon mindig tájékozódhat. www.miksan.hu


Feladva: 2016-11-09    [Autó - Motor - Jármű]

Címkék, kulcsszavak: tól8211BudapestRégebbileendő1500vagyünnepiHétfőAutóalkatrészmeglévőUtastérszűrőkRaktárrólstb66663000kedves1200kedvezménnyelrácsok330várjuk

Forrás: pepitahirdeto.multiapro.com

A tisztaság fél egészség! Persze a mondás máshogy is szól, mely akár még igaz is lehet. Hiszen minek vesződjön a ruhatisztítással, a fárasztó mosással, vagy a korán sem kíméletes vegytisztítással, amikor van, aki szívesen megcsinálja Ön helyett? A mosoda Budapesten biztosítja azon professzionális ruha- és vegytisztítási szolgáltatásokat, melyek garantáltan foltmentes világot teremtenek. A mosoda Budapesten több évtizedes múltra tekint vissza. Új üzemeltetőként igyekszünk a patinás patyolat ... további részletek >>

hírnevét tovább vinni, munkatársaink a mosást, a vegytisztítást és a ruhatisztítást gyorsan és precízen látják el, olyan kiegészítő szolgáltatásokkal együtt, mint például a frissen mosott ruha házhoz szállítása. Teljes körű szolgáltatásaink, kedvező áraink, szakképzett kollégáink és a professzionális eszközeink teszik lehetővé, hogy a mosoda Budapesten még a háztartási mosógépek világában is versenyképes legyen. Ruhatisztítás Budapesten és egész Pest megyében, gyorsan és precízen!


Feladva: 2016-10-05    [Lakossági szolgáltatás]

Címkék, kulcsszavak: mosodaBudapestenprecízengyorsanmégRuhatisztításruhaprofesszionálismegcsináljamintfárasztóháztartásitovábbteremtenekmondáskedvezőszívesenegyüttaki

Forrás: pepitahirdeto.multiapro.com

Tekintse meg jelenleg bérelhető flipper automatáinkat! Bérelhető flippereink abból az időszakból származnak, amikor a játéktermek fénykorukat élték, a valaha gyártott legjobb flipperek készültek, mint a Terminator 2, az Indiana Jones: The Pinball Adventure, vagy akár az Addams Family. A legnagyobb flippergyártó 2000-ben befejezte működését, azonban a gépek a retro hullámnak is köszönhetően visszatértek a köztudatba. Mára ezek a gépek igen keresettek, azonban szerviz igényességük miatt kevesen ... további részletek >>

foglalkoznak a bérbeadásukkal. Flippereink egytől-egyig tökéletes műszaki állapotban vannak (ez nem zárja ki a meghibásodást, de ennek esélyét töredékére csökkenti), esztétikailag is igényesen felújítva kerülnek kihelyezésre. www.automataberles.hu/hu/flipper-berles További szolgéltatásaink: - Játékterem telepítés - Retró játékok bérbeadása - Klasszikus és retró játékok családi napokra, céges rendezvényekre - Csocsó, darts kölcsönzés - Box gép bérlés - Prémium katergóriás játékautomaták kölcsönzése - Videójáték bérlés


Feladva: 2016-10-10    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: bérlésflippergépekFlippereinkautomataberlesjátékokretróBérelhetőazonbanegyigTheCsocsószolgéltatásainkigenfénykorukattöredékérebenBudakalászegytől

Forrás: pepitahirdeto.multiapro.com

Otthonról végezhető munkára keresek 5 főt Betterware csapatomba! Komoly gondolkodású,kitartó munkatársak jelentkezését várom. - Ha elmúltál 18 éves, - Jól kezeled a számítógépet, - Szeretnél plusz jövedelmet, - Dolgoznál is érte, Irj és megbeszéljük.


Feladva: 2018-02-07    [Pénzkeresés - MLM]

Címkék, kulcsszavak: OtthonrólkezeledBetterwareJólfőtéveskeresekmegbeszéljükelmúltálmunkáraIrjváromvégezhetőértejelentkezésétDolgoználmunkatársakSiófokjövedelmet

Forrás: pepitahirdeto.multiapro.com

A Kingtel egy eddig még sohasem látott távlatot kíván megismertetni önökkel a Mobiltelefonok rohamosan fejlődő világában. Főbb szolgáltatásaink: Mobiltelefon Táblagép Telefonok a Boltunkban Gyári Tartozékok Kiegészítők iPhone Szerviz Android Szerviz Kijelző Felújítás Minden használt Mobiltelefont és Táblagépet készpénzért azonnal megvásárolunk vagy beszámolunk a legmagasabb piaci áron!


Feladva: 2017-09-23    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: MobiltelefonTáblagépKingtelSzervizszolgáltatásainkMindenlátottáronTelefonokhasználttávlatotBoltunkbanMobiltelefontkívánGyáriTáblagépetmegismertetni

Forrás: pepitahirdeto.multiapro.com

Minőségi mosdó csaptelepek garanciával! (A termék kódja De-3004) Megbízható 40 mm-es kartussal szerelt, fém fogantyúval ellátott csaptelepek széles választékban. 5 év testgaranciával! Az ár magában tartalmazza a szállítási költséget utánvétellel, Magyarország területére. Megrendeléshez adja meg a termék kódját a megrendelő nevét és a címet és következő munkanapon postára is adjuk. Amennyiben elfoglaltság miatt nem tudjuk hívását fogadni... SMS rendelés: 06-70-427-7896 Email ... további részletek >>


Feladva: 2017-07-09    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: csapteleptermékrendeléscsaptelepekMagyarországSMSfogantyúvalkövetkezőHirdetőutánvétellelfogadnifémcímetPepitamosdocsaptelepköltségethívásátszerelt

Forrás: pepitahirdeto.multiapro.com

Professzionális segítségre és gyógyításra számíthat az UNIQA legújabb betegségbiztosításával, ha egy súlyos, „rettegett” betegség ütné fel Önnél a fejét. A Best Doctors közreműködésével felkutatjuk Önnek az adott betegség legjobb specialistáit a világon, teljes körűen megszervezzük és térítjük a külföldi gyógykezelését 2 millió euró összeghatárig. Tájékozódjon honlapomon a Med TopDoc betegségbiztosításról, vagy kérjen tájékoztatót!


Feladva: 2015-01-18    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: MedbetegségTopDocBestlegújabbteljesbetegségbiztosítássalfejéthonlapomonUNIQAvilágonÖnnélTájékozódjonszámíthatspecialistáitfelösszeghatáriglegjobb

Forrás: pepitahirdeto.multiapro.com

Zárnyitás, ajtónyitás teljesen roncsolás mentesen manipulációs zárnyitás technikával. Több mint 20 év zárnyitás területén szerzett szakmai tapasztalatunk alapján, nem csak a becsapódott ajtókat tudjuk roncsolás mentsen kinyitni, hanem azokat is, amelyek kulcsra vannak zárva. Speciális német és amerikai szerszámok segítségével a manipulációs zárnyitás, azaz a finomnyitás technikát alkalmazva a kéttollas (Mottura, Cisa, CR, S.A.B. Viro, Dierre Atra stb) és cilinderes zárak belső záró elemeit addig ... további részletek >>

mozgatjuk, amíg mindegyik a megfelelő pozícióba kerül, és úgy kinyílik a zárszerkezet mintha a saját kulcsát használtuk volna. Ebből következően a zárnyitás során semmiképpen nem tud megsérülni sem az ajtó sem pedig a zárszerkezetek, így továbbra is tudja azokat használni zárcsere nélkül is.


Feladva: 2017-11-23    [Lakossági szolgáltatás]

Címkék, kulcsszavak: zárnyitásnemazokatajtónyitásBudapestmanipulációssemroncsoláselemeitbecsapódotthasználnikéttollasteljesenzárszerkezetzárvazárócsaksemmiképpenbelső

Forrás: pepitahirdeto.multiapro.com

Magnetit mágneses ékszerek most akciós áron a Lili Bizsu webáruházban már 400Ft-os akciós ártól www.lilibizsu.hu/modules.php?name= fokat&id=58f9d39f69a8d-MAGNESES-EKS ZEREK


Feladva: 2018-01-20    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: akciósBizsuLiliékszerekmágnesesártólMagnetitWEBÁRUHÁZ400Ftmárwebáruházbanáronmost

Forrás: pepitahirdeto.multiapro.com

Minden számitógépünk akcióban! ÚJ számítógép, használt számítógép, többnyire 3 év garanciával! Új Gamer gépeink szintén óriási akcióban! Akcióink: www.pcfactory.hu/shop_artspec.php?artspec=1 Keresse a PcFactory oldalát a Facebook-on is, minden héten új nyereményjátékkal! Minden számítógépünk gyártás utáni teszteknek vetjük alá és 3, illetve 5 év GARANCIÁT vállalunk rájuk. Rendeljen, akár ingyenes kiszállítással, az egész ország területén! Nézzen be weboldalunkra! Játsszon velünk a ... további részletek >>

Facebook-on! www.pcfactory.hu - www.facebook.com/pcfactoryhu Érdeklődjön telefonon: 06 20 57 67 906


Feladva: 2017-02-27    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: pcfactoryMindenszámítógépakcióbanszámítógépünkfacebookGARANCIÁToldalátNézzenilletve906KeresseterületénakcióalátelefononországvetjükÉrdeklődjön

Forrás: pepitahirdeto.multiapro.com

A vizsgálatok eredményei szerint a propolisz csepp sok különböző vírus- és baktérium ellen fejt ki áldásos hatást. A herpesz, az influenza, a Candida és a körömgomba is ezek közé tartozik, de kimutatták hatékonyságát Staphylococcus és E.coli fertőzés esetén is. A propolisz cseppek a házi patikában mindig jó szolgálatot tesznek, hiszen sérüléseket, sebeket kezelhetünk velük, felhasználhatjuk bőrápoláshoz és a megfázás tüneteitől is hamar megszabadulhatunk, ha elkezdjük fogyasztani. Nem beszélve ... további részletek >>

arról, hogy természetes immunerősítő hatásával a megelőzésben is segítségünkre lesz. Minősített propolisz csepp vásárlás webáruházunkban!


Feladva: 2016-10-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: propoliszcseppCandidaarrólszerintvelükeseténinfluenzabeszélveeredményeikezelhetünkfertőzésherpeszNemvizsgálatoksebeketMinősítettcolihatástlesz

Forrás: pepitahirdeto.multiapro.com

Ha szikrázik, füstöl, zizeg, ott bizony elektromos probléma van. Mi a legjobb, amit tehet? Áramtalanítsa a lakást és azonnal hívjon minket! NEM VILÁGÍT A LÁMPA? A legvalószínűbb, hogy kiégett az izzó, ezért cserélje ki típusban és teljesítményben megfelelőre. Ha ezt követően sem működik hívjon minket.


Feladva: 2017-10-16    [Lakossági szolgáltatás]

Címkék, kulcsszavak: minkethívjonlegjobbsemCsászihogyvankövetőenGyorsszolgálatlegvalószínűbbproblémaeztVillanyszerelőLÁMPAelektromosmegfelelőreVILÁGÍTbizonyményben

Forrás: pepitahirdeto.multiapro.com

Szünetmentes tápegység Kemot tiszta szinuszos Felhasználás terület: a teljesítmény figyelembevételével: - hűtők - hő központok - keringtető szivattyúk - búvárszivattyúk, villanymotorok www.elektroexpressz.hu/spl/499141/ UPS-SZUNETMENTES-TAPEGYSEG


Feladva: 2017-01-22    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: SZUNETMENTESelektroexpresszszinuszostisztatápegységteljesítménysplterületFelhasználáshttpsvillanymotorokbúvárszivattyúkKemotszivattyúkkeringtető300W

Forrás: pepitahirdeto.multiapro.com

Művészi fa urnák! A céget működtető művészcsalád tagjai közt van a fát szerető és értő iparművész, elhivatott festőművész, aki még ismeri a régi nagy mesterek titkait, ötletekben gazdag tervező, vagy ahogy manapság divatosan nevezik ”designer” A vállalkozás gyárt egyedi és kis szériás sorozatban is! Már a Facebook-on is: www.facebook.com/Urnakeszito


Feladva: 2013-03-31    [Kegyelet - Ezotéria]

Címkék, kulcsszavak: manapságelhivatottTapolcahttpwwwfacebookcomUrnakeszitoahogyiparművészkoporsókFacebookonvagyértőurnaisMártervezőszeretőurnáksorozatbangazdagfátvan

Forrás: pepitahirdeto.multiapro.com

Segítünk megvédeni mindent, ami Önnek fontos. Otthona, munkahelye biztonságát a távfelügyelet garantálja. Kiépítjük biztonsági rendszerét, távfelügyeletbe kapcsoljuk, és bármilyen riasztás esetén akár 5 percen belül a helyszínen a segítség. Mi nem jobbak, hanem másabbak vagyunk a konkurenciánál a professzionális vagyonvédelem területén!


Feladva: 2017-07-01    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: nemrendszerétmindentsegítségbiztonságimegvédenihelyszínenKiépítjükterületénSegítünkbelülgarantáljavagyonvédelemajánlópercentávfelügyeletHirdetőakár

Forrás: pepitahirdeto.multiapro.com

Vonz a film világa? Rendezői babérokra törsz? Csakis a Legjobbtól érdemes tanulnod! Szurdi Miklós ismert és elismert színész, rendező. Sokszínű életpályáját mutatja, hogy a Színházi Adattárban regisztrált bemutatóinak száma rendezőként 65 mű! Ne hagyd ki ezt a lehetőséget, hogy Nála sajátíthatod el a színház és filmrendezés alapjait! :) Olyan képzést keresel: - ahol elismert szakemberektől tanulhatod meg a szakmát? - ahol nem évekig tanulsz, mégis komoly tudásra tehetsz szert? - ... további részletek >>

ahol fontos kapcsolatokat építhetsz? - ahol gyakorlati oktatás is szerepel a tematikában? Minket keresel! :) Őszi akciónk keretein belül, most 50% kedvezménnyel vehetsz rész a kurzuson! Jelentkezz: www.starsofthefuture.hu/jelentkezes Le ne maradj róla! :) A Kurzusról itt olvashatsz többet: www.starsofthefuture.hu/szinhaz-es-filmrendezes-alapjai


Feladva: 2016-10-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: aholelismertSzurdifilmrendezesszínházstarsofthefuturewwwhttphogykereselszínésztehetszvilágaJelentkezzMinketrendezőkéntismerttudásrafilmkurzuson

Forrás: pepitahirdeto.multiapro.com

Születésnap? Évforduló? Esküvő? Sütiben, tortában a Várfok Cuki a nyerő! Sütemények, torták, sós és édes finomságok, fagylaltok, jégkása, üdítő, tea és kávé különlegességek! Előrendelést telefonon is felveszünk!


Feladva: 2017-07-11    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: VárfokjégkásaSütibenfagylaltokEsküvőfinomságokÉvfordulóédesSzületésnapfelveszünksósBudapesttelefonontortákajánlóElőrendeléstSüteményekHirdetőkávé

Forrás: pepitahirdeto.multiapro.com

Szerezzen izometriás csőszerelő képesítést, mely külföldön (pl. Németországban vagy Hollandiában) is egyre keresettebb fémipari hiányszakma. Tanfolyamunk távoktatásos, tananyagunkat ipari területen dolgozó cégek segítségével alakítottuk. További információk honlapunkon: www.cort-oktatas.hu/izometrias-cso szerelo-tanfolyam Telefon: 70/287-5525 E-mail: info@cort-oktatas.hu Nyilvántartási szám: 01169-2010 Tanfolyam végén akkreditált szakmai tanúsítvány több nyelven!


Feladva: 2017-10-18    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: Tanfolyamcsoszerelocortoktatasizometriásterületen2010Németországbanizometriasipari01169külföldöntananyagunkatszámmelyhttptávoktatásosNyilvántartási

Forrás: pepitahirdeto.multiapro.com

Egy világméretű üzletet már ellehet kezdeni 15.000 forinttal! Te szeretnél pénzt keresni, vagy még dolgozni akarsz apró pénzért? Ez egy vásárlói közösség. Ha tovább ajánlod a kártyát, milliós jövedelmed származik abból is. A lehetőség korlátlan, te döntöd el mit választasz a pénz kereset szempontjából, 12 féle lehetőség közül választhatsz!!!! Skype: kollar.klara a további információ itt: www.forevergreen.cafeblog.hu/2017/ 09/27/van-egy-jo-munka-en-ezt-megle ptem


Feladva: 2017-09-27    [Pénzkeresés - MLM]

Címkék, kulcsszavak: egylehetőségmárüzletetvilágméretűforinttal000kezdeniellehetszármazikakarszjövedelmeddolgoznifélemilliósmégszempontjábólkártyátittvagykereset

Forrás: pepitahirdeto.multiapro.com

Női táskák óriási (akár 80%-os)kedvezménnyel , emellett további több mint 1000 féle ékszer és divatkiegészítő egy helyen nagyszerű kedvezményekkel a Lili Bizsu webáruházban. www.lilibizsu.hu/modules.php?name= lista&id=56a49c2b14c89-NOI-TASKA


Feladva: 2018-01-29    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: BizsuLiliféleWEBÁRUHÁZ1000kiárusításwebáruházbanmintTáskatöbbtovábbikedvezményekkelemellettnagyszerűkedvezménnyelhelyenakáregyóriásitáskákNői

Forrás: pepitahirdeto.multiapro.com

Az Ozeki IoT szoftvereket és eszközöket gyárt, amely terület robbanásszerűen fejlődik napjainkban. Mit várunk az ideális jelölttõl: - Felsőfokú programozói vagy mérnök informatikus végzettség (Utolsó éves hallgatói státusz, amely nem igényel hallgatói jelenlétet.) - Java nyelvismeret Amiben többet nyújtunk, mint más cég: - Szakmai képzés IoT területen. - Legújabb technológiák és kutatási eredmények használata - Átlagon felüli fizetés az elért eredmények arányában. Jelentkezés ... további részletek >>

módja: A job@ozeki.hu email címünkre küldött önéletrajzzal és jelentkezési adatlappal, vagy a weboldalunkon - www.jobs.ozeki.hu/index.php?owpn=28 Folyamatosan várjuk a jelentkezőket!


Feladva: 2016-07-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: JavaIoTeredményekhallgatói245amelyOzekitechnológiákMitAmibenálláslehetőségmódjavégzettségLegújabbnapjainkbanjelentkezőketnyelvismeretfejlesztvagy

Forrás: pepitahirdeto.multiapro.com

Akuna Alveo gyógynövények kombinációja, mely több évtizedes kutatómunka eredményeként született meg. Összetett hatásaival bárki egészségi állapotán képes javítani, hiszen kizárólag értékes hatóanyagok találhatók benne. A méregtelenítő Alveo ital fokozza a kiválasztószervek működését, így segíti a szervezet megtisztulását. Hatására a bevitt tápanyagok jobban felszívódnak és intenzívebben érvényesíthetik előnyeiket. Mivel a benne lévő növényi összetevők fokozatosan és kíméletesen hatnak, ... további részletek >>

fogyasztása nem okoz kellemetlen mellékhatásokat a méregtelenítés során. Méregtelenítés Akuna Alveo itallal - rendelés webshopunkban! www.gyogynovenyek.megoldascsomagok.com/akuna-alveo-szolos-950ml


Feladva: 2017-02-03    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: AlveoAkunaitalméregtelenítőMéregtelenítésbennewebshopunkbanműködésétképesfogyasztásatöbbintenzívebbenrendeléskiválasztószervekállapotánhatnakmely

Forrás: pepitahirdeto.multiapro.com

Bruce Willis egyike a legsikeresebb és legkedveltebb világhírességeknek. Számtalan arcát ismerjük, egyszerre változékony és hiteles. A világsztár az LR-rel közösen fejlesztette ki első saját illatát, amely kifejezi személyiségét, és összeköti karakterét egy illattal. Már kapható a második Bruce Willis-illat: a Bruce Willis Personal Edition. Ismerje meg az illatok világát velünk! www.pepitahirdeto.blogspot.com/201 7/07/a-kozmetikumok-vilaga-ismeri-m ar.html


Feladva: 2016-03-26    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: WillisBruceillatmásodikkaphatóelsővilághírességeknekMárfejlesztettelegkedveltebbillattalközösenlegsikeresebbegyrelegyikekarakterétvilágsztárPécs

Forrás: pepitahirdeto.multiapro.com

Hajsütővas, gőzállomás, waffelsütő, gofrisütő, melegszendvicssütő, porszívó, páraelszívó, fagyasztó, hűtő, szárítógép, mosógép, hősugárzó, olajradiátor, olajsütő, kenyérpirító. A tökéletes nászajándékok, karácsonyi ajándékok széles választéka! Személyes átvétel Budapesten. Link: www.stacioshop.hu Facebook: www.facebook.com/stacioshop Tel: 36704551969 E-mail: in fo@stacioshop.hu


Feladva: 2017-05-16    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: stacioshopfacebookwwwátvételhősugárzóinfo@stacioshopHajsütővasSzemélyesmosógépmailajánlóválasztékaszárítógép36704551969HirdetőszéleshűtőTelPepita

Forrás: pepitahirdeto.multiapro.com

Az utóbbi öt évben, négy kivételével, az összes tanítványom vizsgája sikerült, de korábban se volt rosszabb az arány 98%-nál. Matematika, mechanika, géptan, fizika, anyagtudomány, mechatronika, gazdasági matematika, analízis, sorozatok, differenciál-, integrálszámítás, lineáris programozás, differenciálegyenletek, mátrix, optimumszámítás, operációkutatás, valószínűségszámítás, oktatása korrepetálása 20 éves gyakorlattal egyetemistáknak, és középiskolásoknak.


Feladva: 2017-09-22    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: matematikamechatronikaanyagtudományfizikagéptanmechanikavalószínűségszámításHirdetőkorábbanoperációkutatásPepitagazdaságisikerültoptimumszámításvizsgája

Forrás: pepitahirdeto.multiapro.com

Nem árulok zsákbamacskát, sem ”legyél milliomos fél nap alatt” című e-könyveket sem. Egyszerű, bárki által könnyen érthető, INGYENES és fizető oldalakra szeretném a hangsúlyt fektetni. Egészítse ki a fizetését, keressen pénzt az interneten! Maximalizálja a profitot és költse arra amire szeretné! Látogasson el a blogoldalamra!


Feladva: 2017-05-31    [Pénzkeresés - MLM]

Címkék, kulcsszavak: sem8221félpénztkönnyenmilliomoskeressenáltalblogoldalamralegyélfizetésétbárkiLátogassonzsákbamacskátEgészítseEgyszerűszeretnéárulokfektetniNem

Forrás: pepitahirdeto.multiapro.com

Könyvelés - Cégalapítás - Székhelyszolgálat Hosszított esti és hétvégi elérhetőséggel állunk Ügyfeleink rendelkezésére. Jelenlegi és leendő partnereinkkel a kölcsönös és feltétlen bizalmon alapuló baráti és üzleti kapcsolatra törekszünk, hiszen ebben a szakmában ez elengedhetetlen. Kft, Bt könyvelése 7.000 Ft-tól Egyéni vállalkozó könyvelése 6.500 Ft-tól Székhelyszolgálat 4500 Ft-tól Cégalapítás 19.990 Ft-tól Célunk, hogy az Ön számára is hasznos segítség lehessünk ... további részletek >>

mindennapjaihoz. Reméljük, hamarosan Önt is ügyfeleink körében üdvözölhetjük, s egyúttal várjuk mielőbbi jelentkezését. Részletes információ weboldalunkon!


Feladva: 2016-10-11    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: tólmindenMostügyfeleinkCégalapításSzékhelyszolgálatingyenKönyveléskönyveléseÜgyfelünknekegyúttalbarátiszámáraelérhetőséggelEgyéniüdvözölhetjükalapuló

Forrás: pepitahirdeto.multiapro.com

A kívánság lampion története: Ezeket a papírballonokat repülő lámpásnak, azaz Tiang Deng-nek nevezik, eredete a keleti világban több száz évre nyúlik vissza. Ázsiában a mai napig hagyományosan több ezer ilyen repülőlampiont, azaz kívánság lampiont engednek fel az emberek újév napján, vagy az ismert ”Fullmoon” ünnepeken. Annyi év elteltével még mindig él a szokás, hogy feleresztésekor a belesuttogott, ráírt kívánságok valóra vállnak. Megrendelhető - lásd Honlap alább!


Feladva: 2015-02-18    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: kívánságlampiontöbb8221azazhogykeletinapjánalábbszokáseredeteújévSzegedHonlaphagyományosanmindignevezikemberekLátványPontlásdnapigmégnek

Forrás: pepitahirdeto.multiapro.com

Miért ajánljuk Agrimotor 3WF-3S permetezőt? Bevált magyar termék 12 hónap Agrimotor gyártói garancia Agrimotor gyár forgalmazza Országos szervízhálózat Teljes alkatrészellátás Egyszerű kezelés Kedvező ár Motor tipus: benzinmotoros, 2 ütemű, 42 ccm Teljesítmény: 1,2 kW Max. folyadék szállítás: 4 liter /perc vagy 6 kg/perc (POR esetén) www.bmann.hu/Agrimotor-3WF-3S


Feladva: 2017-04-15    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: Agrimotor3WFperceseténXIVbenzinmotorosgyárPORBudapesttipusgaranciaajánlóMotorgyártóivagyHirdetőKedvezőhónapliterPepitakezeléstermékfákhoz

Forrás: pepitahirdeto.multiapro.com

A zöldárpa hatása annak köszönhető, hogy a legfontosabb tápanyagokat ideális arányban tartalmazza. Összetevői szinte azonnal felszívódnak a szervezetben, azaz rögtön hasznosulni tudnak. Az árpafű a Föld talán legegészségesebb növénye, amit nagyon ajánlott fogyasztani azoknak is, akik plusz kilóktól szeretnének megszabadulni. Mivel benne minden létfontosságú tápanyag megtalálható, a diétázók úgy táplálhatják szervezetüket, hogy közben egyetlen felesleges kalóriát sem visznek be! Nagyszerű ... további részletek >>

gyulladáscsökkentő és vérképzéshez is kitűnő. Mire jó a zöldárpa por? Még többet megtudhat róla weboldalunkon! www.zoldarpa.buzafule.net/zoldarpa


Feladva: 2017-12-07    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: zöldárpahatásahogyÖsszetevőiköszönhetőmindenpornagyonszervezetbenegyetlenannakbenneamitfelszívódnakközbenMivelMirenövényeazonnalKittikitűnő

Forrás: pepitahirdeto.multiapro.com

A legtöbb kutya kedveli az extra finomságokat, ezért jó érzéssel tölti el minket, ha valami különlegeset kínálhatunk számukra. Az 8in1 jutalomfalatok ízletes csemegék további jótékony hatásokkal a kutyák számára. 8in1 Minis: Az 8in1 Minis ellenállhatatlanul finom, könnyen emészthető jutalomfalat kutyáknak. 8in1 Training treats: Tökéletes, csont alakú, egészséges, finom és omlós falat kutyák idomításához, amit a hozzáadott összetevők csak még hatékonyabbá tesznek. 8in1 Fillets: Az 8in1 ... további részletek >>

Fillets falatkák a finom csirkehúson belül, egy speciális hatóanyagot tartalmazó „mag”-ot, az úgynevezett „Nutri-Center”-t rejtik, amely hozzájárul a kutyák általános jó közérzetéhez és életerejéhez. A különböző termékváltozatok amellett, hogy egészségesek, ízletesek is. Egy cseppnyi extra gondoskodás: egészséges bőr, szőr, friss lehelet, kiegyensúlyozott emésztőrendszer és mozgékonyság. 8in1 Grills: Prémium minőségű csirkehús és jól rágható marhabőr egyedülálló kombinációja. Mintha egyenesen a grillsütőről jönne! 8in1 jutalomfalatok: www.8in1shop.hu/jutalomfalatok-94


Feladva: 2017-10-13    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: 8in1jutalomfalatokfinomkutyák8221MinisFillets8222egészségesextraEgyegészségesekamitlegtöbbrejtikemészthetőegyedülállóleheletcsirkehúsonhogy

Forrás: pepitahirdeto.multiapro.com

A vadgesztenye kivonat („a vénák balzsama”) a modern terápiás alkalmazásban és a népgyógyászatban sokoldalú alkalmazásáról ismert. Az UW vadgesztenyés lábkrém segít helyreállítani a lábakban jelentkező keringési zavarokat, illetve ödéma és vizenyőellenes hatással bír. Kellemes, nyugtató hatást biztosít a fáradt, túlterhelt lábaknak. Minden bőrtípusra alkalmazható. Ingyenes szállítási lehetőséggel. www.mososzerbolt.hu/id/00242_UW_Va dgesztenyes_labkrem_500_ml_


Feladva: 2016-01-27    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: enyhítivisszérpanaszokattüneteitfellépővéraláfutáskövetkeztébenVisszérgyulladásTerhességKftwebáruházregeneráljaFuturemosószerbőrtCudyHazaidurva

Forrás: pepitahirdeto.multiapro.com

A szálláshely szobái légkondicionáltak (csak a tetőtéri szobák) , TV-vel, hűtővel felszereltek. Minden szobához zuhanyfülkés fürdőszoba tartozik. Lehetőség van számítógépes csatlakozásra, internet használatra. Vendégeink még teljesebb kikapcsolódását medencével és hozzá kapcsolódó szaunával szolgáljuk.


Feladva: 2017-03-21    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: medencéveltartoziklégkondicionáltakkikapcsolódásátfürdőszobaszobáiteljesebbzuhanyfülkésszálláshelymégszobáhozSzékesfehérvárVendégeinkMindenIgnácPap

Forrás: pepitahirdeto.multiapro.com

Jelvények, kitűzők készítése több féle méretben - cégeknek, magánszemélyeknek - rendezvényekre, bulikra, szülinapokra, esküvőkre, partikra – megmozdulásokra. Legújabb termékünk a 44 mm-es kulcstartó-sörnyitós és a 32 mm-es kulcstartó. Tükrös kitűző, mágneses (32- 44- és 58 mm-es méretekben) készítése hozott képekkel is, új technológiával, tetszetős külsővel, írható felülettel - tetszés szerinti szöveggel.


Feladva: 2016-09-29    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: készítésekitűzőkJelvényekkulcstartómagánszemélyeknekkülsővelsörnyitóscégeknektetszetőstermékünkméretbentechnológiávalLegújabbféleképekkeltöbbhozott

Forrás: pepitahirdeto.multiapro.com

Turisztikai tanácsadókat keresünk, kiemelt jutalékos, ajánlói rendszerben. Érdeklődni: E-mail: utazomudulok@gmail.com


Feladva: 2018-02-10    [Pénzkeresés - MLM]

Címkék, kulcsszavak: keresünktanácsadókatTurisztikaicomKatalinutazomudulok@gmailBátkymailÉrdeklődnirendszerbenajánlóijutalékoskiemelt

Forrás: pepitahirdeto.multiapro.com

Albérletből könnyedén saját otthonba! Kérd segítségünket! Üzenetben megadott telefonszámon is visszahívunk. Albérletben te is saját lakásról álmodozol? Esetleg meglévő lakásodat bővítenéd, vagy cserélnéd nagyobbra? Amiben segíteni tudunk: Havi 20.000 forinttal, 30 %-os vissza nem térítendő állami támogatással, OBA garanciával, kamatadó- és járulékmentesség. Álmaid otthona neked is elérhető! Kérd üzenetben ingyenes visszahívásunkat telefonszámod és egy számodra megfelelő időpont ... további részletek >>

megjelölésével. Segítünk megteremteni, eligazítunk a lehetőségek között. Tájékoztatást nyújtunk személyesen.


Feladva: 2016-12-26    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: sajátüzenetbenKérdvagycomtámogatássalOTTHONeligazítunknagyobbravisszahívunkbindererika56@gmailállamiALBÉRLETmegteremtenicserélnédtelefonszámonwebnode

Forrás: pepitahirdeto.multiapro.com

Akciós szépséghibás, kartonsérült és outlet háztartási gépek akár féláron! Új, csomagolássérült, leértékelt és outlet mosógépek, hűtőszekrények, valamint egyéb háztartási gépek széles választékban azonnal, készletről! Üzleteinket személyesen is érdemes meglátogatni, címlista itt: www.leertekelve.hu/content/6-kapcs olat


Feladva: 2017-04-27    [Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: outletleértékeltgépekháztartásihűtőszekrényekHirdetőszemélyesenmosógépekPepitaÜzleteinketBoltjakészletrőlkapcsolatÁrukazonnalcsomagolássérültcontent

Forrás: pepitahirdeto.multiapro.com

Angol - igény szerint, minden szinten: - nyelvoktatás, korrepetálás, kiegészítő tanítás, - szintentartás, felzárkóztatás, - felvételire, nyelvvizsgára, érettségire, állásinterjúra, pótvizsgára, osztályozó vizsgára felkészítés, - tanulócsoportok mentorálása, konzultáció, - fordítás, - online tolmácsolás (előre egyeztetett idópontban) - az angol nyelvhez és kultúrterülethez tartozó témában célirányos felkészítés Tanítási módszerem: részletes magyarázat, stabil elméleti ... további részletek >>

alapok, házi feladat, gyakorlatorientáltság Óradíj és Fizetés: tanóra: 2700 Ft/50 perc fordítás, tolmácsolás: megegyezés szerint fizetés módja: átutalással bankszámlára Számlaképes vagyok. Rugalmas időbeosztással várom a tanulni vágyókat! A rendszeresség az egyik legfontosabb a nyelvtanulás során. Elfoglalt vagy? Sok a dolgod? Nem probléma: a tanóra időtartama megegyezés alapján akár 20 perc is lehet (ennek megfelelő árral)!


Feladva: 2017-04-09    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: angoltanórafizetésszerinttolmácsolásfordításpercfelkészítésmegegyezésidőtartamaalapokkorrepetálásegyikkultúrterülethezmódjaosztályozóelméletistabil

Forrás: pepitahirdeto.multiapro.com

Ingatlan értékbecslés az Ön településén is, független értékbecslőktől. Hivatalos és magán ügyben egyaránt. Bírósági - Adóhatósági - hagyatéki - vagyonmegosztási - válási és bármilyen más ügyben. Keressen bennünket + 36702408616 telefonszámunkon, vagy írjon a info@ertekbecslot.hu címünkre. Olcsón - gyorsan és szakszerűen készítjük el megrendelt értékbecslését. www.ertekbecslot.hu/bemutatkozunk. html


Feladva: 2017-12-01    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: ügybenfüggetlenértékbecslésIngatlanírjonhagyatékiertekbecslotBudapestvagyAdóhatóságiwwwirodatelefonszámunkonBíróságiértékbecslésétÉrtékbecslőegyaránt

Forrás: pepitahirdeto.multiapro.com

Édesség, aprósütemény, teasütemény, linzersütemény gyártás, készítés, forgalmazás.


Feladva: 2016-11-04    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: gyártásteasüteményaprósüteményislerlinzersüteményzserbólinzerÉdességbékéscsabaGabriellaPatakiforgalmazóforgalmazáskészitőkészitésgyártó

Forrás: pepitahirdeto.multiapro.com

3 rétegű üveggel, 80 mm vastag, 6 légkamrás ablakok és ajtók, 2-4 héten belül legyártva a kívánt méretre. Beszerelést is szakszerűen kivitelezzük, 1994 óta nyílászárókkal foglalkozunk. Kizárólag német „A” osztályú minőség, 7 év teljes körű garanciával. Többféle műanyag, fa és alumínium nyílászárót forgalmazunk, biztosan megtalálja az Önnek megfelelőt. A legjobb nyílászáró árak nálunk vannak. Részletes árlisták: www.ablakajtoaruhaz.hu/hu/arlistak.html Rendelje meg most az ... további részletek >>

ablakait, a párkányt ajándékba adjuk minden 200.000.- Ft feletti rendeléshez Július 30-ig. A beépítést 6500.-/m2 áron végezzük. Nézzen körül weboldalunkon és a webáruházunkban: www.ablakajtoaruhaz.hu/hu/aruhaz/category/muanyag-ablak.html


Feladva: 2017-07-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: ablakajtoaruhazhttpshtmlablakáronmuanyagmostmegszakszerűenÖnneküveggelrendeléshezosztályúRendeljeBeszereléstmegtaláljarétegűfeletti8221arlistak

Forrás: pepitahirdeto.multiapro.com

A Lada Vesta stílusos, merész és ragyogó – pont, mint amilyennek egy új generációs Ladának lennie kell. A szedán sziluettje korszerű és harmonikus, az X forma egységként kíséri végig a karosszériát. Az új, bátor stílus könnyen felismerhető a részleteiben: a fekete színnel kiemelt radiátor borításban, a lenyomatokban az oldalakon, a hátsó fényszórók fényvisszaverőin. A megemelt öv vonalának, meghosszabbított motorháztetőnek illetve lejtős tetőnek köszönhetően a Vesta külsőre is sportos és ... további részletek >>

dinamikus. Egy ilyen autóval nehéz észrevétlennek maradni az utakon. Vesta. A LADA új arca. www.ladaszolnok.hu/vesta_sedan_ismerteto


Feladva: 2017-04-12    [Autó - Motor - Jármű]

Címkék, kulcsszavak: vestaLADAEgymeghosszabbítottmintsedanszínnelilyenformavonalánakpontfeketeharmonikusmegemelt8211ladaszolnokrészleteibendinamikuskorszerűragyogó

Forrás: pepitahirdeto.multiapro.com

Kameradepó az IP kamerák, IP kamerarendszerek, éjjel látó színes IP infrakamerák webáruháza! Ön kényelmesen megrendeli az íróasztala mellől, mi rövid határidővel kiszállítjuk! Prémium kategóriájú Full HD IP kamerarendszerek a legjobb áron! Magánszemélyeket, cégeket és kivitelezőket is kiszolgálunk! Nézze meg a weboldalunkat: www.kameradepo.hu/ip-kamerarendsze r.html Kérje kollégánk segítségét: 06-20-5698848 Kameradepó webáruház a gyors, biztonságos megoldás!


Feladva: 2014-02-05    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: KameradepókamerarendszerekhttpolcsónFullinfrakamerákgyorsweboldalunkatKamerarendszertkategóriájúszíneswebáruházmegPrémiumlátóNézzekiszállítjukéjjel

Forrás: pepitahirdeto.multiapro.com

Főbb kínálatunk: OMNITRONIC / PSSO dj – stúdió – hangtechnika ::: EUROLTE / FUTURELIGHT látvány – fénytechnika ::: DIMAVERY hangszerek ::: ALUTRUSS traverz ::: OMNILUX fényforrások ::: ROADINGER rack gyártás ::: EUROPALMS műnövények – dekoráció. Nálunk közel 10.000 termék közül válogathat. A megfelelő termékek kiválasztását fotók, videók, részletes termék leírások és pontos méretek segítik. Tekintse meg kínálatunkat... www.showtechnic.hu


Feladva: 2016-12-04    [Zene - Hangszer]

Címkék, kulcsszavak: showtechnictermék2003HUNGARYrackOMNILUXpontosPSSO000traverzleírásokOMNITRONICközelALUTRUSSkínálatunkNálunkhangszerekrészletesFőbbdekorációker

Forrás: pepitahirdeto.multiapro.com

Interaktív eszperantó tanfolyam, nulláról az eszperantó nyelvvizsgáig – hanganyaggal, gyakorlatokkal, házi feladatokkal. NEM zsákbamacska, próbáld ki az első leckét! . Budapesti Eszperantó Központ, www.eszperanto-online.hu/elso-leck e.htm


Feladva: 2017-03-24    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: EszperantótanfolyamwwwgyakorlatokkalKözponthanganyaggal8211BudapestinyelvvizsgáigleckétnullárólelsőpróbáldInteraktívzsákbamacskaLászlóNEMSzilvási

Forrás: pepitahirdeto.multiapro.com

Hordozható cserépkályha 160.000 Ft-tól 320.000 Ft-ig. Akciós és egyedi kézzel készült csempéből! Hagyományosan járatokkal ellátva, hőtárolós kivitelben. Rendkívül gazdaságosak! A fűtési módok közül a leghatékonyabb. Kiváló ár-érték arány jellemzi a saját magunk készített cserépkályhákat. Minden darab egyedi! Építünk, cserépkályhákat, kandalló típusú cserépkályhákat, tartályos cserépkályha-kandallókat. Web: www.cserepkalyhak-mobilcserepkalyhak.hu Email: pollakferi@icloud.com Tel.: ... további részletek >>

06-20-397-91-02


Feladva: 2016-12-03    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: cserépkályhacserépkályhákat000HordozhatóegyediAkcióskandallókatmagunkRendkívül320sajátkivitelbentartályostóljellemzi397hőtárolós140arányTel

Forrás: pepitahirdeto.multiapro.com

Eladó szamurájkard, katana, wakizashi, tanto! Minőségi acél, választható markolat és sok minden más... Aktuális árukészlet és akciók a honlapunkon!


Feladva: 2017-04-28    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szamurájkardEladóKardokSzamurájtantowakizashikatana

Forrás: pepitahirdeto.multiapro.com

Pécs belvárosában a János u. 9. szám alatt II. emeleti, csendes, belső kertre néző, téglaépítésű, gázfűtéses, 1,5 szobás, 46 m2-es, bútorozatlan lakás hosszú távra kiadó havi 70.000.- forint + rezsiért. (2 havi kaució szükséges) Várhatóan 2018. március 1-től költözhető. Érdeklődni a 0620/486-1614-es telefonszámon lehet.


Feladva: 2018-01-18    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: lakásPécskiadóbelvárosábanhavimárciushosszúalatt2018számVárhatóanbútorozatlanlehetJánosszükségesszobástelefonszámonkauciógázfűtéses1614486

Forrás: pepitahirdeto.multiapro.com

Az aki 40 évesen 123 kg-ot nyomott a mérlegen, így számos gyógyíthatatlan egészségügyi probléma küszöbén állt, most elárulja hogy mi indította be nála a fogyást.


Feladva: 2017-09-17    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: httpgyógyíthatatlanegyfogyástszámosátólnálaígytesttömegemindítottamérlegenmeghogynyomottszabadultamelárulja123Hogyanmostévesenálltakibit

Forrás: pepitahirdeto.multiapro.com

Nyaralás, üdülés Abádszalókon a Tisza-tónál a családias hangulatú Zöld Wellnessházban. Beltéri fűtött medence, jakuzzi, finn-infra szauna, masszázs, kábel TV, minibár, napozókert, napozóágyak, zárt parkoló. Árak: 3.500-7.000 Ft-ig. Csónak-kenu, kerékpár túrák, Böllér fesztivál, majd Kompér fesztivál, koncertek, előadások, stb ... Társaságoknak, meetingek, továbbképzések részére is kiadó! Programok és akciók a honlapon!


Feladva: 2016-01-25    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: ZöldfesztiválAbádszalókképzésektúrákszállás36202946410kábeltovábbhangulatúkerékpár36208028955masszázsmítingekcsaládiaskenuzoldwellnesshazszauna

Forrás: pepitahirdeto.multiapro.com

Új lakásba, házba költözni nagy öröm, még akkor is, ha csak nekünk új az ingatlan... Díszítse, dekorálja egyéni módon lakását vagy házát! Ha nincs ötlet, elképzelés, mi segítünk! Esetleg a hálószobában egy közös emlékeket idéző falmatrica. Vagy egy gravírozott kávéscsésze vagy müzlis tál, esetleg két - vagy több - névvel ellátott borospohár. Keressen minket és mi megoldjuk!


Feladva: 2016-11-14    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: vagyesetlegegyidéződekortöbbemlékeketlakasközöshttpkéthálószobábanZamárdisegítünkPétertálajándékozzmegoldjukBuzásmüzlismitminketötleted

Forrás: pepitahirdeto.multiapro.com

Duna House, Magyarország legnagyobb ingatlanközvetítői hálózata ingatlan-tanácsadói területre várja dinamikus, aktív, kitűnően kommunikáló, sikerorientált leendő munkatársait, akik számára fontos a kiemelkedő kereseti-, a folyamatos fejlődési lehetőség és a jó csapat. A Duna House kiemelkedő infrastruktúrával, folyamatos képzésekkel, karrierprogrammal és profi háttérével kiegészülve hosszú távon segíti tanácsadóit. Tanulj egy új szakmát nálunk, nyiss magad előtt új távlatokat! Amennyiben a ... további részletek >>

lehetőség felkeltette érdeklődésed, küldd el fényképes önéletrajzod a frank.andrea@dh.hu e-mail címre


Feladva: 2017-12-11    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: HouseDunaingatlanfolyamatoskiemelkedőlehetőségsegítilegnagyobbAmennyibenkommunikálótávonMagyarországcímretávlatokatkitűnőenhosszúPontmailcsapat

Forrás: pepitahirdeto.multiapro.com

Hitelkártyák, személyi hitelek, egyesítése egy hitelbe! Jelenlegi hiteleinek havi törlesztését akár 50-40%-ra is le tudjuk csökkenteni. Még mielőtt fizetésképtelenné válik, jelentkezzen! Az ügyintézésért jutalékot nem kérünk, bankokkal vagyunk szerződve! Szűcsné B. Erzsi Személyi kölcsön értékesítő vezető 1214 Budapest Csepeli út 83. Telefon: 06-30-841-0329 E-mail: i nfo.szbe@gmail.com Web: www.hitel-city.hu és www.hitelügyintézés.com


Feladva: 2017-07-12    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: SzemélyiegyesítésehitelekcomBudapestcitytörlesztésétvezetőSándorjutalékothitelhaviértékesítőSzűcsügyintézésértszbe@gmailhiteleinekkölcsöninfo

Forrás: pepitahirdeto.multiapro.com

Zeneszolgáltatás! Mulatós < Vendéglátós < Örökzöld zenék. Balatonlelle és távolabbi környékén, megfizethetően árazva. Hívjanak bizalommal! id.Bertalan József + egy fő hölgy hegedűs!


Feladva: 2017-11-18    [Zene - Hangszer]

Címkék, kulcsszavak: ZeneszolgáltatásBalatonlelleJózsefBertalanbizalommalhivjanakárazvamegfizethetöenkörnyékéntávolabbihegedüshölgyzenékegyÖrökzöldVendéglátosMulatós

Forrás: pepitahirdeto.multiapro.com

Több millió elégedett vevő! Már 3 nap alatt érzed a hatását. Természetes összetevők!


Feladva: 2017-03-28    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hatásátHatékonyérzedalattnapMárvevőelégedettmillióTöbbösszetevőkErzsebetTermészetesgombaölő

Forrás: pepitahirdeto.multiapro.com

Két szintes, önálló vendégházunk a Balatontól kb. 600 méterre, a Knézich utcában található. A ház 10-13 személyes, tökéletesen alkalmas családok, baráti társaságok számára. - 5 kétszemélyes háló, - két nappali, - felszerelt konyha-étkező, - emeleti melegítő konyha, - földszinti, emeleti fürdő, - fedett terasz, - parkolás az udvarban, - grillezési, bográcsozási lehetőség, - gyermekjátékok (hinta, homokozó) - díjtalan internet csatlakozás (wifi) OTP, MKB és K&H SZÉP kártyát ... további részletek >>

elfogadunk. A szálláshelyre kutya díjtalanul hozható. A ház csak egyben bérelhető, külön szobákat nem tudunk kiadni. Létszám és a foglalni kívánt időszak megjelölésével kérje ajánlatunkat.


Feladva: 2017-12-15    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: házkétemeletikonyhaönállószemélyeskívántparkolásCsikóscsatlakozásutcábanfoglalniteraszközelébenhozhatóhálóinternetKnézichLétszámfedettstrand

Forrás: pepitahirdeto.multiapro.com

Olcsó bérautónk sokkal tisztább és biztonságosabb, mint a tömegközlekedés MÁV, Volán, BKK, BKV igénybevétele. Autókölcsönzõnk májusi akciójában Renault Clio bérautónkat napi csak 3.000,- Forintért adjuk az átvételtõl számítva 24 órára. Bérautónk www.pluszautorent.hu autókölcsönzés oldalon. Automataváltós olcsó bérautók. Autókölcsönzõnket megbízhatóság, pontosság, jellemzi. Opel Ford Suzuki, Renault, Skoda, Chevrolet bérautók jó áron. Tel: +3630 9488730 www.plusautorent.hu Car hire ... további részletek >>

in Budapest. Válasszon a tiszta, jó, szervizelt, karbantartott olcsó bérautókból. Hosszú autóbérlés esetén akár 30% kedvezmény is igénybe vehetõ. Rövidebb bérlésnél is lehet 10%, és 20% akciós árat igénybe venni. Autóbérlés Budapesten, Pest megyében és a Ferihegyi Liszt Ferenc Nemzetközi repülõtérre kiszállítással. Válasszon bérautóink közül amelyek, 3, 4, 5, 6, 7 személyes, klímás, automata vagy kézi váltós, személyautó vagy kis tehergépkocsi, Kicsi economy, nagy luxus bérautók kölcsönzése. Bérelhetõ autótípusok Opel Corsa C 1.2, a hölgyek kedvenc bérautója. Kicsi helyre is könnyû parkolni vele. Suzuki Ignis 1.3, erõs fürge, pörgõs bérautó. Opel Vectra B 1.6 automata váltós, nagy 4 ajtós kölcsönautó. Ford Focus C-MAX 1.6 HDI Dízel fokozatmentes automataváltós CVT, egyterû. Nagyon alacsony a fogyasztása. Autókölcsönzõ Magyarországon kiszállítással. Suzuki Swift 1.3, a MI autónk a magyarok kedvence. A legolcsóbb bérautó klíma nélkül. Renault Clio 1.4, erõs 74 kw-os motorral.Renault Scenic1.6 Automataváltós egyterû bérautó. Kombi van. Opel Vectra C 2.2 nagy 114 kw szedan, erõ és biztonság jellemzi. Gépjármûkölcsönzés 1992-tõl. Chevrolet Aveo 1.2 kicsi gazdaságos, ezüst bérautó. 5 személyes. Skoda Fabia 1.2 Benzin Gáz LPG üzemû, hatchback 5 ajtós. Személyautó bérbeadás. Opel Vivaro 1.9 dízel 6 személyes kisteherautó. Az ülések gyorsan, könnyedén kiszedhetõek, így a rakodó tér kétszeresére növelhetõ. B személygépkocsi jogosítvánnyal vezethetõ. Renault Espace 2.2 dízel automata váltós 7 személyes bérautó. Klíma, cd tár, navigáció stb. A felsorolás nem teljes kérem, nézze meg a www.plusautorent.hu autókölcsönzõ weboldalunkat is.


Feladva: 2017-12-09    [Autó - Motor - Jármű]

Címkék, kulcsszavak: 245251RenaultOpelbérautóautókölcsönzszemélyesolcsóSuzukiAutomataváltóskiszállítássalwwwAutóbérlésbérautókváltósnagyautomatakicsidízelChevrolet

Forrás: pepitahirdeto.multiapro.com

24 órás otthoni szakápolás, betegápolás! Otthonában ápolom kifejezetten szakápolást igénylő lábadozó, beteg, vagy idős hozzátartozóját, krónikus belgyógyászati, haematológiai és onkológiai tapasztalattal és több, mint 25 éves gyakorlattal. Szükség esetén 24 órában. Kórház, műtét utáni ápolás. Tumoros betegek otthoni ápolása. Megfelelő végzettséggel és referenciával rendelkezem. Bérezés megállapodástól függően. Tel: 06-30-8834252 kovacsbiren@gmail.com


Feladva: 2017-05-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: otthonibetegápolásMegfelelőszakápolásSzükségidőscomápolásaórásgyakorlattalvagykovacsbiren@gmailBudapestéves8834252betegekIrénmintlábadozóTel

Forrás: pepitahirdeto.multiapro.com

A zöld kávé természetes zsírégető tabletta mellékhatások nélkül segít lefogyni. Próbált már sokféle diétás módszert, mégsem sikerült leadni a felesleget? A zöld kávé kapszula zsírégető hatásai anyagcserénket a maximális fokozatra kapcsolva segítik elő a fogyást. A méregtelenítés, a gyors anyagcsere, a kalóriák folyamatos égetése együttesen szükségesek ahhoz, hogy az egészséges fogyás folyamata beinduljon. Ehhez gyakran a diétázás és a rendszeres edzés sem elegendők. A zöld kávé tabletta ... további részletek >>

szedésével azonban elérhetjük azt az eredményt, amire régóta várunk! Természetes zsírégető tabletta a gyors fogyásért itt! www.zsiregeto.zoldkave.bolt.hu/zsiregeto


Feladva: 2017-12-05    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: zsírégetőzöldtablettakávégyorsTermészetesahhozhatásairólrégótakapcsolvaedzésdiétásszükségesekkévébabamirefokozatrarendszeressokféleegyüttesen

Forrás: pepitahirdeto.multiapro.com

HULLÁMOSÍTOTT ACÉLHÁLÓ (Heidekker háló) gyártása. Egyedi méretekre és különböző kivitelben gyártott hullámosított acélhálók (Heidekker háló) 18x18 mm-től - 115x115 mm-ig, többféle kockaméretekben: sima normál / álló, diagonál / átlós, valamint duplaszálas átlós kivitelben, 2330,-Ft/m²-től Megrendelhető: Nyíregyháza, Szarvas u 85 www.drotspecial.hu Tel: 06-70/453-8288


Feladva: 2016-10-04    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: HeidekkerhullámosítotthálóNyíregyházatőlACÉLHÁLÓkivitelbenátlósdrotspecialDrótszálvalamintacélhálókwwwdiagonálSzarvasállógyártottnormálkülönböző

Forrás: pepitahirdeto.multiapro.com

Vízszerelést, javítási munkákat, épületgépészeti munkákat, vízvezeték szerelési munkákat vállalunk Budapest és környékén, Pest megyében. Csaptelep csere, mosdó, mosogató csere javítás, vízóra csere, beépítés. Kerti csap készítés, kerti akna, vízóraakna készítése, telepítése. Minden ami vízzel kapcsolatos, szerelés, javítás, kivitelezés. Szivattyúk telepítés fúrt kutakra, kútfej telepítés, szerelés, javítás. Csaptelep csere, javítás (zuhany, kád, mosdó, mosogató), teljes felújítás ... további részletek >>

lebonyolítása. Keressen minket bizalommal!


Feladva: 2017-04-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: javításcserekertiCsapteleptelepítésmunkákatmosdóvízóraPestvízszerelőszerelésfelújításaknamosogatóVízszerelésfúrtszerelésiSzivattyúkkészítéskád

Forrás: pepitahirdeto.multiapro.com

Karcher HDS655 SX 220-as ipari gőzborotva vegyszeradagoló vizlágyító garanciával.


Feladva: 2017-10-29    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: Karchergőzborotvaipari220hds655zolt65506309126148hdsgaranciávalvizlágyítóvegyszeradagoló

Forrás: pepitahirdeto.multiapro.com

10 éves ingatlanközvetítői tapasztalattal szeretném figyelmébe ajánlani az INGATLANÁRUHÁZ szolgáltatásait. A Megbízási szerződés megkötése után az eladóknak díjmentes: • az ingatlan felmérése • az eladási ár megállapítása • az ingatlan hirdetése • érdeklődők tájékoztatása • az ingatlan bemutatása • segítség az ártárgyalás lebonyolításában • kedvező díjadású ügyvéd ajánlása • tanácsadás bedőlt hitellel kapcsolatban • tanácsadás ... további részletek >>

hitel felvételével kapcsolatban Megbízási díj csak az általunk hozott vevővel kötött adásvételi szerződés megkötése után jár, rejtett költségek nélkül! Megbízási díjak: • 7 MFt alatt 90.000 forinttól – 120.000 forintig • Nem kizárólagos szerződés esetén: 3%+ÁFA • Fél kizárólagos szerződés esetén: 2,5%+ÁFA • Kizárólagos szerződés esetén: 2%+ÁFA • Bérbeadás esetén: 1 havi bérleti díj Ingatlan keresése a vevők/bérlők számára ingyenes! • ingatlan keresése, megadott paraméterek alapján • a reális eladási ár megállapítása • a kiválasztott ingatlan megtekintésének megszervezése, bemutatása • szükség esetén szakember ajánlása (statikus, építész, generál kivitelező) • szükség esetén ügyvéd ajánlása • tanácsadás bedőlt hitellel kapcsolatban • tanácsadás hitel felvételével kapcsolatban Várom válaszát, hogy mielőbb vevőt találjunk ingatlanára Üdvözlettel Koma László 06 30/690-82-80 honlap: www.ingatlanaruhaz.com email: ingatlanaruhaz@gmail.com


Feladva: 2017-02-06    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: 8226ingatlaneseténszerződéskapcsolatbantanácsadás000ÁFAKizárólagosMegbízásiajánlásaszükségINGATLANÁRUHÁZmegállapításadíjeladásiutánfelvételével

Forrás: pepitahirdeto.multiapro.com

Legújabb digitális festékrétegmérő készülékünk az elmatronic F/NF HANDY. Nagyméretű LCD kijelzője könnyedén leolvasható, sőt a FLIP DISPLAY szolgáltatásnak köszönhetően az LCD kijelzőn megjelenő információk egy gombnyomással 180 fokban megfordíthatóak. Így a mérési eredmények minden esetben kényelmesen olvashatóak. Beépített mérőszonda, automatikus alapanyag felismeréssel. Gyors mérési sebesség, rendkívül egyszerű kalibrálás! 1 évgarancia! Magyar nyelvű használati útmutató! Áfás számla! ... további részletek >>

Szállítás raktárról azonnal! Ár: 49.000.-Ft Bruttó! Honlap: www.elmatronic.webnode.hu/products/elmatronic-f-nf-handy-digitalis-retegmero-keszulek


Feladva: 2017-02-26    [Autó - Motor - Jármű]

Címkék, kulcsszavak: elmatronichandyLCDmérésifestékrétegmérődigitáliskeszulekdigitalisesetbenSzállításkijelzőnsebességkészülékünkmindenszámlaeredményekÁfásköszönhetően

Forrás: pepitahirdeto.multiapro.com

Az elmúlt bő két évtizedben Zorán majd minden évben nagykoncerttel örvendeztette meg közönségét. Ezek a nagykoncertek mindig ünnepi alkalmak, mind az előadó, mind a közönség számára. Zorán mindig a bőség zavarával „küzd”, amikor az új turné vagy nagykoncert programját kell megszerkesztenie. Hiszen csak a négy évtizedes szólópályafutása alatt mintegy 150 dal született, ezekből akár bő tízórányi koncertet is össze lehetne állítani. Zorán ezúttal bátrabban válogat gazdag ... további részletek >>

repertoárjából, így 2018. április 23-án ritkán hallható szerzemények és igazi zenei csemegék is megszólalnak, de a programból természetesen nem hiányozhatnak a „kihagyhatatlan”, erejükből az évtizedek során mit sem vesztő dalok sem. Jegyárak: 5990, 4990, 5590 Ft www.jegy.hu/program/zoran-koncert-90059 2018. Ápr. 23. hétfő, 19:00 Babits Mihály Kulturális Központ, Színházterem 7100 Szekszárd, Szent István tér 10.


Feladva: 2018-02-24    [Zene - Hangszer]

Címkék, kulcsszavak: Zoránmind8221hétfő8222Ápr2018semSzekszárdkoncertmindigwwwezúttalerejükből150mindenMihályigazinagykoncert5590előadómintegymajdBabits

Forrás: pepitahirdeto.multiapro.com

Kőműves-, ács-, lakatos-, térburkoló munkák, bontás, épületfelújítás, kertépítés, festés, mázolás Budapesten, Pest megyében. Dumitru György www.gisi.hu 06-30-538-2573


Feladva: 2016-07-18    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: GyörgyDumitrugisibontáshttpvállalásamunkáktérburkolómegyébenlakatosPestácsBudapestenKőművesmázolásPilisvörösvárfestésházépítés2573kertépítés

Forrás: pepitahirdeto.multiapro.com

A bizsubolt webáruházban számos divatékszert, bizsut megtalálsz. Megtalálható nálunk a bizsuk széles választéka, úgy mint fülbevaló, karkötő, nyaklánc, gyűrű,zsinóros karkötő, barátság karkötő- és nyaklánc. A kislányokról sem feledkeztünk meg, taláható divatékszer webáruházunkban gyerek nyaklánc, gyűrű és karkötő. Megtalálható még nálunk saját készítésű, egyedi, kézműves ékszerek.


Feladva: 2018-01-08    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: karkötőnyakláncgyűrűnálunkmégMegtalálhatówebáruházbanfülbevalóbizsuboltmintékszerekCsávolygyerekúgykézművesAnitawebáruházunkbanválasztékaegyedi

Forrás: pepitahirdeto.multiapro.com

Megrendelőinknek díjmentes lakberendezési tanácsadás. Színvonalas választék, díjmentes felmérés. Költözik, tanácstalan? Enteriőr tervezés! Főbb területeink: - - Bútorszövet - Tapéta - Karnis - Függöny


Feladva: 2017-05-22    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: FüggönydíjmentesTapétaBútorszövettervezésajánlóEnteriőrHirdetőtanácstalanPepitaKöltözikotthonábafelmérésviszünkStílustKarnisválasztékSzínvonalas

Forrás: pepitahirdeto.multiapro.com

Ásvány ékszerek hihetetlen árakon nagyszerű kedvezményekkel akár 60% kedvezménnyel a Lili Bizsu webáruházban www.lilibizsu.hu Házhoz szállítás már 650 Ft-tól akár ingyenesen is


Feladva: 2017-10-29    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: ÁsványBizsuLiliakárnagyszerűmárárakonszállításhihetetlenHázhozékszereklilibizsuwwwWEBÁRUHÁZwebáruházbanolcsóniyeningyenesenékszertkedvezménnyel

Forrás: pepitahirdeto.multiapro.com

Szuper lehetőség! Otthonról végezhető internetes munkára keresem lelkes kollégáim. Ami szükséges hozzá: Internet, számítógép A legjobb, hogy bárhonnan végezhető munka, szuper termékek és segítőkész csapat vesz körül! Kitartó munkával elérheted a legnagyobb álmod is. Írjatok bővebb infóért.


Feladva: 2017-12-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: végezhetőOtthonrólszupermunkalegjobbkörülszámítógéplehetőségveszInternetSiófokcsapathozzáinfóértErzsébetsegítőkészszükségesbővebbHajdutermékek

Forrás: pepitahirdeto.multiapro.com

Azok számára állítottuk össze kezdő csomagjainkat, akik most vágnak bele a kisállat tartásba. A csomag tartalmaz minden, a felelős állattartáshoz szükséges kelléket. A Cavie 60 a Ferplast több éves fejlesztése. Strapabíró, praktikus és rendkívül esztétikus tengerimalac ketrec. Magas peremmel rendelkezik, így a kiszemetelés esélye minimális. Tálcája erős minőségi műanyagból készül, tisztán tartása könnyű. A csomag tartalmazza: -Felszerelt Cavie 60 ketrec /1db 300ml-es csepegésmentes ... további részletek >>

önitató, 1db szénarács/ -Fogkoptató kő /Panzi,55gr/ -Tengerimalac eledel /Panzi, 1000ml/ -Réti széna /350g/-Fenyőforgács /5L/ Színekről érdeklődjön elérhetőségeinken.


Feladva: 2017-09-18    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: tengerimalacketrecCaviePanzicsomag1dbtengerimalacnakkezdocsomagmindenerősállítottukkisallatokpraktikus1000mltartalmazTálcájaszámárawebshopAzok

Forrás: pepitahirdeto.multiapro.com

Side by side, óriás hűtő Márka: Hanseatic Típus: HSBS 17690WEHA1S Energiahatékonysági osztály: A + Szín: rozsdamentes acél megjelenés Szín oldallapok: Ezüst Vízadagoló: Igen Csövezet szükséges: igen Bővebben: www.olcsoelektro.hu/products/hanse atic-side-by-side-hsbs-17690weha1s< /a> Országos kiszállítási (Royal-Futár) díj 15.000 Ft. Egyedi szállítás telefon egyeztetéssel 0670-432-5426.


Feladva: 2018-02-09    [
Iparcikk - Elektronika - Kisgép]

Címkék, kulcsszavak: sidehanseaticigen17690weha1shsbsSzínEgyedihűtőszekrényproductsmegjelenés000olcsoelektroacéldíjwwwrozsdamentesFutárBővebbenosztályRoyal5426

Forrás: pepitahirdeto.multiapro.com

Csempézés, padlólapozás és egyéb hideg-burkoló munkák: 06/20/824-2880 és 06/30/643-6121. Kérem tekintse meg honlapomat is, amelyet a www.szladek.gportal.hu címen talál!


Feladva: 2017-06-01    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: megCsempézéstekintseIstvánKéremSzládek6121javításatalál643Hidegburkolatcímen2880Hidegburkológportal824Hidegburkolásszladekmunkákwwwhidegburkó

Forrás: pepitahirdeto.multiapro.com

Akác kerítéslécek közvetlenül a gyártótól. Többféle minta és méret.Akár egyedi igények készítését is vállaljuk. Szeletelt akác. Kerítések kivitelezése. Kérje ingyenes árajánlatunkat email-ben.


Feladva: 2017-05-13    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: gyártótólakáckerítésingyenesméretKerítéslécKérjemintakivitelezéseTöbbféleKerítésekközvetlenülSzeleteltkerítéslécekvállaljukÉrdkészítésétAttilaben

Forrás: pepitahirdeto.multiapro.com

Magyarország első találka alapú (pay per date) és fokozottan biztonságos társkereső szolgáltatása! Csak akkor kell fizetni, ha összejön a randi, de lehet akár teljesen ingyen is! Nálunk nincsenek kamu profilok! Nincsenek zaklató levelek! Ne ülj otthon a képernyő előtt! Próbálj ki valami újat! www.beengedlek.hu


Feladva: 2016-11-06    [Társkereső - Ismerkedés]

Címkék, kulcsszavak: levelekzaklatóNincsenekbeengedlekprofilokkamuotthonlehetdateüljrandiperösszejönpayfizetnialapúkelltalálkaakkorújatelsőCsakvalamiNálunk

Forrás: pepitahirdeto.multiapro.com

Használt számítógépek, laptopok és számítástechnikai kiegészítők, alkatrészek széles kínálatával várjuk üzletünkben Bonyhádon. 7150 Bonyhád, Rákóczi F. u. 1 Tel.: 0620/40-40-500


Feladva: 2017-09-05    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: kiegészítőkszámítástechnikailaptopokBonyhádszámítógépekHasználtalkatrészekbonyhadcomputerhttpsRákóczi7150BonyhádonSzámítástechnikaüzletünkbenvárjuk500

Forrás: pepitahirdeto.multiapro.com

Felejtse el üzletében az üresen tátongó felületeket! Arra törekszik, hogy ruhaüzletéből kihozza a maximumot? Egy nagy alapterületen elhelyezkedő boltot is be lehet úgy rendezni, hogy az előnytelen legyen, de egy kicsi boltocska is lehet sikeres és vendégcsalogató. Mi a titok? Először is nem árt okosan megválogatni az üzletberendezést. Ahol nem férnek el a hatalmas polcok vagy széles állványok, ott más, praktikusabb megoldásokra van szükség. Gondolt már arra, hogy a különféle fali ... további részletek >>

rendszerekkel mennyi helyet spórolhat? Próbálja ki ezeket a praktikus polcrendszereket és meg fogja látni, hogy nem létezhet nélkülük üzletberendezés. Miért előnyös ilyen fali rendszereket választani? Ezek a rendszerek a legkézenfekvőbb felületeket, a falakat használják ki. Akár egészen a padlótól a mennyezetig a teljes falat lefedheti egy sínes panellal vagy fali oszlopos rendszerrel, és máris megvan hová pakolhatja az eladásra szánt áruit. Tekintse meg kínálatunkat, és válassza azt a fali rendszert, ami a legjobban illik üzletéhez és elképzeléseihez! Különféle oszlopos vagy sínes panelek és fali rendszerek közül válogathat, amikkel helyet spórolhat és kihozhatja a maximumot üzletéből!


Feladva: 2017-07-01    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: falihogyrendszerekvagyegynemmaximumotsínesarrafelületeketoszloposmegspórolhatKülönfélelehethelyetpraktikusabbüresenpadlótólelőnyösokosanami

Forrás: pepitahirdeto.multiapro.com

A sokízületi gyulladás tünetei többnyire a nőknél jelentkeznek. Az ízületek duzzanatával, gyulladásával, merevségével járnak. A sokízületi gyulladás tünetei idővel súlyos elváltozásokat okozhatnak, a kezelés célja ezért éppen az, hogy az ízületek funkcióját minél inkább sikerüljön megőrizni. A betegség középső szakaszában már megindul az ízületek pusztulása, tehát nagyon fontos a korai felismerés és a terápia mielőbbi megkezdése. A reuma kezelése a gyógyszerek mellett magában foglalja a ... további részletek >>

rendszeres mozgást és az életmódváltást is, ami speciálisan összeállított étrendet és a túlsúly leadását is jelenti. Reuma ellen terápiák weboldalunkon!


Feladva: 2018-02-19    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: tüneteigyulladásízületeksokízületiReumamozgástokozhatnakkoraijelentkeznekellenmegőriznirendszereselváltozásokatfontosnőknélsikerüljönfoglaljasúlyos

Forrás: pepitahirdeto.multiapro.com

Konzol szaküzlet és szerviz Békéscsaba belvárosában. Használt játékok széles választékban garanciával! Megunt konzolodat és játékaidat is beszámoljuk.


Feladva: 2016-12-31    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: BékéscsabaXboxjátékokgépekOnebeszámoljukszervizjátékaidatszaküzlet360konzolodatKonzolPS4MeguntajánlóPS3garanciávalHirdetőválasztékbanPepita

Forrás: pepitahirdeto.multiapro.com

Ha túl nagy a lakása, ha inkább a gyermekével foglalkozna, vagy egyszerûen csak nem tudja hogyan fogjon hozzá, de tiszta lakást, átlátható ablakot szeretne, hívjon bizalommal! Kirakatok, ablakok, tükrök, üvegfalak, üvegportálok tisztítása. Üzletek, irodák, csarnokok, lakások, magánházak takarítása. Gyors, tiszta munkavégzés, korrekt árak. Megelégedettségi garancia! Huszka Antal 70/6163797 www.ablaktisztitas.5mp.eu


Feladva: 2017-06-02    [Lakossági szolgáltatás]

Címkék, kulcsszavak: AntalHuszkagaranciaMegelégedettségitisztatükrökablaktisztitashogyanGyorsnagyablakokwwwtudjatakarításatúlKirakatok6163797nemmagánházakBudapest

Forrás: pepitahirdeto.multiapro.com

Nagy lépés ez egy embernek, és még nagyobb az emberiségnek! Megtakarítások nélküli probléma megoldás! Sok család eddig azért nem tudta megoldani nagy kiadásokkal járó problémáit, mert a bevételből nem tudott megtakarítani ezek érdekében! Ennek a korszaknak vége, most már nincs akadálya annak, hogy minden tervét megvalósíthassa! A „Jövőképem a Létem” Támogató rendszer többek között lehetőséget nyújt: Családi ház, nyugdíj, Gépjármű vásárlás, Áram és gázszámla megszüntetése, ... további részletek >>

Gyermeke magas szintű oktatása, Családja anyagi jóléte, utazások, hobby, karitatív tevékenység, egyéb álmok, célok megvalósítására! A „Jövőképem a Létem” Támogató rendszer célja, hogy megszüntessük Magyarországon a szegénységet, hogy ne kelljen családoknak szétválniuk külföldi munkavállalás miatt, hogy a családok életszínvonalát jelentősen növeljük annak érdekében, hogy a jelen és a jövő generációja már egy sokkal jobb világban élhessen! Úgy oldhatja meg a jövőben felmerülő jelentős összegű anyagi kiadásait, hogy nincs szüksége havi rendszeres megtakarításokra! Jövőkép Programunk tökéletes megoldás arra, hogy akár már 2-3 év alatt megoldhassa az igényeihez szükséges anyagi hátteret! Mivel Önnek garantáltan ez egy fillér költségébe sem kerül, és a programot követve garantáltam megoldhatja a jövőben felmerülő jelentős anyagi kiadásokkal járó problémáit, ezért jelentkezzen bátran, mert kizárólag csak nyerhet a Tökéletes Támogató rendszerünkkel! rozsabusiness@gmail.com


Feladva: 2017-04-20    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyanyagiTámogatómáregymegoldásproblémanélkülinemMegtakarításokproblémáitrendszerjáró8221nagykiadásokkalLétemTökéletesnincsJövőképemjelentős

Forrás: pepitahirdeto.multiapro.com

Gitártanárt keresel Budapest belvárosában? A tanítás külföldi segédanyagokkal, zenei alapokra. Mindenféle stílusban: blues, rock, jazz, funky... Kezdőtől haladó szintig. Nézz körül a Facebook oldalunkon is: www.facebook.com/GitarBasszusgitar


Feladva: 2017-10-12    [Zene - Hangszer]

Címkék, kulcsszavak: facebookstílusbanajánlásoldalunkonMindenféleHirdetőkörülalapokraPepitaNézzzeneioktatásszintigsegédanyagokkalbasszusgitárhaladókülföldiGitároktatás

Forrás: pepitahirdeto.multiapro.com

MTZ-re és más gyártmányú traktorra! Hazai gyártású kiváló minőségű homlokrakodók kedvező áron, 25 - 200 LE–ig, szinte minden traktor típusra, szállítással, üzembe helyezéssel, rövid határidővel, készletről. BB. Junior 1.4 homlokrakodó: Emelőmagasság max.: 3,9 m. Terhelhetőség: 2500 kg. Emelőerő: 1800 kg. Felszereltség: - Traktor típus szerinti adaptációs alváz - Joystick vezérlés - Kihelyezett 3. hidraulikakör - Lengés csillapítás - Szállítás, üzembe helyezés ... további részletek >>


Feladva: 2015-11-09    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: homlokrakodóüzembeTraktorhelyezés200szerintiJuniorárontípuskészletrőlSzállításkedvezőhatáridővelcsillapításhomlokrakodókFelszereltségrövidLengés

Forrás: pepitahirdeto.multiapro.com

Szívből - Jövő című könyvem szívből ajánlom a szépirodalmat, verseket kedvelő kedves olvasóknak. Megrendelni a webáruházban lehet: www.verses.boltaneten.hu/kinalat/1 __aranyosi_ervin_versei


Feladva: 2015-09-19    [Könyv - Fotó - Film - Videó]

Címkék, kulcsszavak: ervinaranyosiszívbőlverseikedvesmegjelentkedvelőversesköteteverseketlegújabbkinalatszépirodalmatboltanetenajánlomverseshttpkönyvemlehetcíműJövő

Forrás: pepitahirdeto.multiapro.com

Automata mosógépek, mosogatógépek, hűtőgépek, varrógépek, mikrosütők, porszívók és egyéb háztartási gépek helyszíni és szervizes javítása 1 év garanciával.


Feladva: 2015-07-17    [Lakossági szolgáltatás]

Címkék, kulcsszavak: FerencCsókajavításagépekháztartásiszervizeshpmosógépekhospitalszervizesAutomataelektrohelyszíniltpwwwMarcalváros840Győr350egyébTelporszívók

Forrás: pepitahirdeto.multiapro.com

Nemzetközi szinten is kiváló minőségű, sporttáplálkozási-, étrend-kiegészítő- és diétás termékek. Body&Fit termékek. Kategóriák: www.bodyfit-hungary.hu/bodyandfit_ kategoriak


Feladva: 2017-08-01    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: termékekBodydiétássporttáplálkozásiFitkiegészítőétrendminőségűhungarykiválóbodyfitszintenwwwNemzetköziBudapest

Forrás: pepitahirdeto.multiapro.com

Állást keres? Vizsgázik? A táblázatkezelés, az adatbázis-kezelés egyáltalán nem nehéz! Meg fogja látni, mennyire egyszerű az Excel, az Access, vagy a Word, a PowerPoint. Milyen szép dolgokat lehet Corel vagy Flash segítségével létrehozni. Egyszerűen, gyorsan megérthető. Forduljon hozzám! Tapasztalataim szerint az egyéni foglalkozás előnye, hogy kevesebb idő alatt, hatékonyabban lehet elsajátítani az új ismereteket, mivel csak Önre figyelek, mindennel csak addig foglalkozunk, ameddig ... további részletek >>

Ön igényli, nem kell senkihez sem igazodnia. Fontos előny az is, hogy nincs ”kihagyott” óra. Csoportban, ha Ön nem ér rá, nem tud az órára eljönni, a csoport halad tovább, Így Önnek, ha a lépést tartani akarja, pótolnia kell a kimaradt óra anyagát. Szívesen tanítok csoportokat is, ebben is hosszú múltra tekinthetek vissza.


Feladva: 2016-07-21    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: nemtáblázatkezeléshogyóravagykelllehet8221kezelésadatbázisEgyszerűencsakkevesebbtovábblétrehoznimindennelExcelanyagátelőnyeVizsgázikhalad

Forrás: pepitahirdeto.multiapro.com

Közeledik március 15-e. Kokárda minden méretben, kokárda kitűző, huszárcsákó, papírpárta kapható. Szerezd be időben. www.hunbolt.hu/spl/586913/Kokarda- nemzeti-szalag


Feladva: 2018-01-30    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: kokárdamárciuspapírpártahuszárcsákókitűzőméretbenmindenKözeledikidőbenmargo101Szerezdkokárdákkapható

Forrás: pepitahirdeto.multiapro.com

A német tulajdonban lévő U&D Select Group Dél-Németországba keres: betanított és segédmunkásokat marhavágóhídra és tésztagyárba! Szállás igény esetén biztosított. Munkábajárásban tudunk segíteni. Német nyelvtudás nem feltétetel! Hosszútávú biztos munkalehetőség! Heti 5 munkanap, szombatonként túlórázási lehetőség Magyar nyelvű ügyintézés. Közvetítői díj nincs! Jelentkezni és, érdeklődni a delnemetmunka@gmail.com e-mail címen lehet. Telefon: +49151/26389661 és +3630/6485271


Feladva: 2017-10-19    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: NémetbetanítottDélnyelvűNémetmunkanemcímenmarhavágóhídraMagyarSegédmunkanyelvtudásmailsegédmunkásokatlehetőségcomtúlórázásisegítenikerestudunk

Forrás: pepitahirdeto.multiapro.com

Kiemelt specifikációk: - Rendszermemória (RAM) 2 GB - Operációs rendszer verzió Android 7.1.1 (Nougat) - Kijelző átlója 5.2 - Kijelző felbontás 720 x 1280 - Fényképező felbontása, tulajdonságai 13 MP, f/2.0, phase detection autofocus, 1/3 - Processzor sebessége Octa-core 1.4 GHz Cortex-A53 - Akkumulátor kapacitása 3000 mAh Ingyenes kiszállítás 24 hónap garancia Minden gyári tartozékkal Magyar nyelvű készülék VIP Phone szaküzlet 1138 Budapest, Váci út 136/c. +3670-930-4414 ... további részletek >>


Feladva: 2017-07-12    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: mobiltelefonnokiavipkeksimKijelzőphone3000PepitadetectionnyelvűAndroidkapacitásakártyafüggetlenphasewwwMagyarverzióAkkumulátorDual4414A53

Forrás: pepitahirdeto.multiapro.com

Csopaki kiadó szálláshelyek fényképes gyűjtőoldala. Hotelok, panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel,térképpel. - Közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül, a legolcsóbb áron. - Több mint 500 fényképpel a szálláshelyekről és a településről! - SZÉP kártya (Széchenyi Pihenő kártya) elfogadó szálláshelyek - Egész évben nyitva tartó szálláshelyek. - Weblap: www.zimmerinfo.hu/csopak/hu.htm


Feladva: 2018-01-05    [Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: szálláshelyekkiadókártyacsopakzimmerinfofoglalásinyitvatartógyűjtőoldala500KözvetlenévbenfényképesminttérképpelEgészTöbbelérhetőségükkelelfogadó

Forrás: pepitahirdeto.multiapro.com

Diéta, fogyókúra. Testépítés, aktív sportolás. Megoldást nyújtanak a body&fit termékek. Irány a bolt!


Feladva: 2017-11-22    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fitbodyalakMegoldásthungarysportolásbodyfitaktívwwwTestépítéshttpsfogyókúraboltDiétaIrányBudapesttermékekcsapatközérzetkellemesnyújtanak

Forrás: pepitahirdeto.multiapro.com

Megbízható vízszerelő dugulás megszüntetés csőtörés csepegések megszüntetése csapok szerelése új vízvezeték rendszerek telepítése, gyorsszolgálati munkák a legolcsóbban Hajdú-Bihar megyében!


Feladva: 2017-02-12    [Lakossági szolgáltatás]

Címkék, kulcsszavak: csőtörésvízvezetékmegszüntetésefővárosbancsepegéseklegolcsóbbanmunkákmegszüntetésszolgálatidugulásgyorsvízszerelőtelepítéseMegbízhatórendszerekSándor

Forrás: pepitahirdeto.multiapro.com

Rendelj az USA-ból, vagy Angliából, mi elhozzuk! Ruhaneműtől az autóig.


Feladva: 2014-09-18    [Vegyes hirdetések]

Címkék, kulcsszavak: USARendeljidealerAngliábólvagybólwwwautóigRuhaneműtőlelhozzuk

Forrás: pepitahirdeto.multiapro.com

Nem érzed magad biztonságban? Úgy érzed veszélyben van az életed? Van megoldás!!! Egy különleges harcművészet. A leghatékonyabb önvédelmi technikák. Az alapok 6 hónap alatt elsajátíthatóak. A támadó erejét használd fel a győzelemhez! - Önvédelmi tanácsok - Utcai szituációk kezelése - Jogtalan támadások elhárítása - Pszichikai felkészítés Ne legyél áldozat!


Feladva: 2017-09-26    [Sport - Kemping - Túra]

Címkék, kulcsszavak: BajaÖnvédelmiVanönvédelemérzederejétmegoldástámadásokNemtámadó06304670677JogtalanBajánelsajátíthatóakInfoválságindulkezelésealattvégéighónap

Forrás: pepitahirdeto.multiapro.com

Budapest chiptuning az élen.


Feladva: 2017-01-30    [Autó - Motor - Jármű]

Címkék, kulcsszavak: BudapestchiptuningJánosFontosautochipélen

Forrás: pepitahirdeto.multiapro.com

Válassz kutyádnak nyakörvet széles választékunkból, legyen szó akár kistestű, akár nagy testű kutyáról.


Feladva: 2016-09-17    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: akárszóKutyalegyenválasztékunkbólszélesnyakörvetkutyádnakkutyárólVálassztestűgubanagyebengyártásakistestűnyakörvek

Forrás: pepitahirdeto.multiapro.com

Szalvéta felülnyomást vállalunk céges rendezvényekre, esküvőkre! Készítünk még: étlapot, itallapot, egyedi pincérblokkot, reklám gyufát, papír tányéralátétet, ültetőkártyát, menükártyát. www.ritternyomda.hu/keszites/szalv eta.php


Feladva: 2017-04-16    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: szalvetaegyediajánlóritternyomdaétlapotHirdetőwwwmégPepitamenükártyátKészítünknyomásültetőkártyátesküvőkretányéralátétetrendezvényekrepapírcéges

Forrás: pepitahirdeto.multiapro.com

Csapatom bővítéséhez keresek munkatársakat. Munka és termékreklámozás. Minden támogatást megadok, hogy sikeres légy! Ha érdekel írj emailt!


Feladva: 2017-11-25    [Pénzkeresés - MLM]

Címkék, kulcsszavak: hogyHajosmegadokIstvannetámogatástBahnhofstraMindentermékreklámozásMunkaemailtmunkatársakatírjkeresekérdekelbővítéséhezlégyCsapatomsikeres

Forrás: pepitahirdeto.multiapro.com

Marcali szálláshelyek fényképes gyűjtőoldala. Kiadó panziók, vendégházak, villák, nyaralóházak, apartmanok, árajánlatokkal, elérhetőségükkel, közvetlen foglalási lehetőség a szálláshelynél, közvetítési díj nélkül. - Szép kártya elfogadó szálláshelyek - Egész évben nyitva tartó szálláshelyek Marcaliban. - Weblap: www.zimmerinfo.hu/marcali/hu.htm


Feladva: 2017-07-20    [
Utazás - Üdülés - Szállás]

Címkék, kulcsszavak: marcaliszálláshelyekzimmerinfoKiadóhtmelfogadóárajánlatokkalkártyaapartmanokSzépnyaralóházakwwwnélkülvillákhttpdíjvendégházakWeblapközvetítési

Forrás: pepitahirdeto.multiapro.com

Minden erőfeszítése ellenére sem tudja leadni a fölösleges kilóit? Nincs ideje,energiája edzőterembe járni? Megoldást ajánlunk. Biorezonanciával beállítjuk - az anyagcsere korrekcióját - a sejtszintű zsírbontást - étvágy csökkentést Már az első alkalommal beindul a fogyás. Heti 1 kezeléssel a folyamat fenntartható. A biorezonanciát ajánljuk,kisiskolás kortól,idős korig. A túlsúlyos gyermeket csúfolják a társaik és nem fogadják be. Ettől magányos,magábaforduló,sérült lesz,aki ... további részletek >>

evéssel és magányos játékokkal vigasztalja magát. Ebből a kiút az ésszerű fogyás. A túlsúlyos idősebbek - izületei nehezen cipelik a fölösleges súlyt, - a szívműködésük és - a vérnyomásuk fogyásért kiált. Alkalmanként egy 20 perces alakformáló masszázst ajánlunk,hogy a kilók onnan szívódjanak fel,ahol Önnek a legfontosabb. A normál súly - egészséget, - önbizalmat, - munkabírást, - boldog életet biztosít. Bővebb információért,időpont egyeztetésért hívjon a 06 30 907 47 86 telefonon. eletmod-debrecen.hupont.hu


Feladva: 2017-08-01    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: fogyásajánlunkfölöslegesmagányostúlsúlyosdebrecennemkilóithívjonfolyamatsúlyvigasztaljakorrekciójátmasszázsttársaikleadniegyeztetésértcipelikHeti

Forrás: pepitahirdeto.multiapro.com

Teljesen új kerti pad lóca eladó a gyártótól! Anyaga fenyő. Kezeletlen, lehetőséget nyújtva bármilyen felületkezelés alkalmazására, így bátran tetszőlegesen színezhető. Mérete: 123,5 x 42,5 x 81 cm. A termék lapra szerelt kivitelben van csomagolva, szállítás szempontjából nagyon kis helyet foglal. Az átvétel történhet személyesen, vagy utánvétes postázással. A termékre 1 év garanciát vállalunk (+ 500 Ft = 2 év) és számlát biztosítunk. www.dbutor.hu/butorok/fenyo-butor/kertibutorok ... további részletek >>


Feladva: 2017-02-09    [Háztartás - Kert - Vegyiáru]

Címkék, kulcsszavak: fenyopaddbutorkertitörténhetTeljesenszereltbiztosítunkbármilyenátvételMaglódlapraszámlátnyújtvafoglalgaranciávaltermék500lehetőségethelyet123

Forrás: pepitahirdeto.multiapro.com

LAPRA SZERELT IKEA - KIKA - RETZ BÚTOROK ÖSSZEÁLLÍTÁSA 06209884170. Háztartási gépek bekötése, lakásfelszerelési tárgyak felfúrása beton és tégla falra. Egyedi karnis, előszobafogas, gardrób gyártás, meglévő bútorok otthoni javítása.


Feladva: 2016-05-06    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: IKEASZERELTbútorokLAPRAEgyediÖSSZEÁLLÍTÁSAfalraRETZtéglaKIKAjavításabetonotthonifelfúrásatárgyakmeglévőlakásfelszerelésiBudapestgyártásbekötése

Forrás: pepitahirdeto.multiapro.com

Mégsem vagy még partnerünk? a SkyWay capital programjában való részvétel - egy kiváló lehetőség egy hatalmas innovációs projekt részévé válni, amihez hasonló még nem létezik a világban! a SkyWay projekt értéke ugyan 400 milliárd dollárra van felbecsülve, de mára már minimum 20szor ennyit ér. Ma ebbe befektetni - ez a lehető legelőnyösebb befektetés, amit csak megtehetünk. Tudjuk, hogy a legnagyobb léptékű Transnet projektet hozzuk létre és minden kockázatot számba vettünk.


Feladva: 2017-10-06    [Pénzkeresés - MLM]

Címkék, kulcsszavak: projektSkyWayegymármégcapitalbefektetni400válniléptékűpartnerünkebbeugyanrészévélegnagyobbvagyennyitértékeinnovációshogyMégsem20szorÁgi

Forrás: pepitahirdeto.multiapro.com

Társkereső weboldal baráti áron eladó. 3 in 1 megoldás. (Titkos, alkalmi, komoly). 1000-nél is több regisztrált felhasználó! .com-os, .hu-s domain nevekkel. Remek befektetés, ha komolyan gondolod. Alapozzad meg a jövődet! A részletekért hívj bátran!


Feladva: 2017-03-30    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: eladóweboldalTárskeresőnélBudapestgondolod1000AndraskomolyankomolyBundzselbefektetésalkalmiRemekTitkosnevekkelmegoldásbátrandomainhívjcom

Forrás: pepitahirdeto.multiapro.com

Tavasszal és nyáron szeretnénk a kertet is élettelivé varázsolni, melyhez jól jön néhány virágos növény! A gyönyörű kékeslilás színben tündöklő törpe levendula sokak kedvence, hiszen kis méretével és illatos virágzatával a kis kertekben is mutatós! A 15-20 cm-re növő példányt nemcsak szabadföldbe, hanem akár cserépbe teraszra vagy erkélyre is ültethetjük, ezzel a panellakás is szebb lesz! Megrendelhető az Üdekert Cserje Webáruházban! www.udekert.hu/product_info.php/pr oducts_id/11912


Feladva: 2017-03-10    [Állat - Növény - Tápszer]

Címkék, kulcsszavak: udekertCserjelevendulatörpevagykiscserépbenyáronillatosnövényakárTavasszalméretévelMegrendelhetővirágoshanemHajdúböszörményhiszenlesznéhány

Forrás: pepitahirdeto.multiapro.com

Személyre szabott gyógynövény teák tanácsadással. Minőségi szálas teák, gyógynövényes teakeverékek, tearendelés a termelőtől! Rigó teák Vegyszermentes kistermelés, gyűjtés, gondos válogatás. Íz-illat-harmónia. www.gyogynoveny-eger.hu/rigo-tea-t eakeverek-eger


Feladva: 2016-08-12    [Élelmiszer - Hús - Étolaj]

Címkék, kulcsszavak: teákgyógynövényszálasMinőségiVegyszermentesszabottSzemélyreRigóteakeverékektanulóillatgyógynövényesIstvánválogatásgondosgyűjtéstanácsadássalEger

Forrás: pepitahirdeto.multiapro.com

Minőségi fa beltéri ajtók közvetlenül a Schumacher™ Ajtóüzemtől! Natúr és felületkezelt beltéri ajtók kedvező áron Nemesnádudvaron és Budapesten. Szuper kedvezményekkel várjuk kedves vásárlóinkat! Elérhető áron, korrekt ügyintézéssel, kiváló minőséget kínálunk. Kérjen ingyenes árajánlatot és mi segítünk megvalósítani álmai otthonát. Tel:06/79-478-093 Web.: www.schumacherajto.hu


Feladva: 2016-01-11    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: beltériSchumacherajtókáronMinőségimegvalósítaniElérhetőfelületkezeltsegítünkvásárlóinkatNatúrárajánlatotkedvesschumacherajtoAjtóüzemtőlingyenesvárjuk

Forrás: pepitahirdeto.multiapro.com

NedyN piros bőrhatású női szoknya 95 % poliészter 5% elasztán Ajánlott mérete: S/M kis L méretre ajánlott A termék készleten. Kiszállítás 1-2 munkanap. www.adryfashion.hu/spd/80-226_Nedy N/NedyN-piros-borhatasu-noi-szoknya


Feladva: 2018-02-17    [Ruha - Cipő - Divat]

Címkék, kulcsszavak: NedyNszoknyanoipirosbőrhatásúajánlottadryfashionwwwmunkanapPepitaAdsKiszállításkészletentermékborhatasuméretrekis226méretespdelasztán

Forrás: pepitahirdeto.multiapro.com

VATTACUKOR ÁRUSÍTÁS MEGRENDELÉSE RENDEZVÉNYEKRE! Az új édesség „Fairy Floss” magyarul annyit tesz: TÜNDÉRPEHELY. Gyermek-napok, koncertek, falu-, városnapok, családi napok, rendezvények rendszeres, megbízható résztvevői vagyunk! Manapság egy rendezvény már nem is képzelhető el vattacukor nélkül! Árainkat megegyezés szerint alakítjuk! Gépeink az összes élelmiszer higiéniai követelménynek megfelelnek! Számlaképesen várunk minden megrendelést, ahol arra szükség van.


Feladva: 2017-05-04    [Szórakozás - Vendéglátás]

Címkék, kulcsszavak: vattacukorRENDEZVÉNYEKREMEGRENDELÉSEÁRUSÍTÁSnapokmárszükségvárosnapokösszes8222rendezvényarrafaluGépeinkédességegyaholkoncertekalakítjukGyermek

Forrás: pepitahirdeto.multiapro.com

Bútorok kárpitozását vállaljuk! Kiemelkedő minőségben, rövid határidővel. Az egész ország területén! Elérhetőség: www.karpitos.org 06 70 771 3888


Feladva: 2016-07-18    [Bútor - Lakástextil - Irodabútor]

Címkék, kulcsszavak: orgvállaljukkarpitoskárpitozásátwwwBútorokElérhetőségAlbertirsaterületénKftországSzervízegészKárpithatáridővelkárpitozásrövidBútor3888771

Forrás: pepitahirdeto.multiapro.com

Keresek mindenféle Zsolnay, Herendi és egyéb porcelánt megvételre. Érdekelnek többek közt figurák, szobrok, bonbonierek, étkészletek, vázák, eozin mázas alkotások stb... Az ország bármely részére szívesen elmegyek! Ezeken kívül egyéb antik tárgyak is érdekelnek! Hívjon, vagy írjon bátran! Elérhetőség a honlapon!


Feladva: 2016-10-09    [Régiség - Művészet]

Címkék, kulcsszavak: egyébérdekelnekporcelántHerendiZsolnayétkészletekElérhetőségKeresekelmegyekbonbonierekbátranBudapestszívesenszobrokírjonajandekokrészérefigurák

Forrás: pepitahirdeto.multiapro.com

XXI. századi modern és nagyszabású lakóparki beruházások kivitelezéshez keresünk tervező mérnököket, mérnöki irodákat. Már „zero riport”-felmérésekhez is... Ajánlati szám: VSZ/00159/16/07


Feladva: 2017-12-01    [Állás - Munka - Foglalkoztatás]

Címkék, kulcsszavak: VSZtervezőszázadiirodákatXXI00159mérnökikeresmérnököketmérnökötszámkivitelezéséhezAjánlatikeresünkBeruházásfelmérésekhezkivitelezéshez8221riport

Forrás: pepitahirdeto.multiapro.com

Ingatlant kínál, keres, cserélne, bérelne? Nézze meg a mi kínálatunkat! Eladó házak, lakások, irodák, nyaralók, telkek, panziók, üzletek, villák és sok más ingatlan a weboldalon. Országos hirdetési lehetőség, miután regisztrált nálunk, az oldal kezelése és a hirdetések feladása nagyon egyszerű - és ingyenes. Látogasson el Ön is az oldalunkra, és nézze meg a kínálatunkat!


Feladva: 2018-01-04    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: kínálatunkatmegnézzenyaralókingyenesIstvánhirdetésiirodákegyszerűTormaOrszágoslakásoknagyontólweboldalonházakfeladásaIngatlanokingatlanEladó

Forrás: pepitahirdeto.multiapro.com

Kompresszor, vákuumszivattyú, javítás, felújítás, szerviz, sűrítőegység, mechanika, pneumatika, vezérlés, szabályozás, hajtás motor, elektromosság ... MINDEN EGY HELYEN! 06-30-243-4771 Márkafüggetlenül, minden típus javítása.


Feladva: 2016-10-19    [Gép - Szerszám - Műszer]

Címkék, kulcsszavak: javításmindenKompresszorfelújításEGYMárkafüggetlenülelektromosságvákuumszivattyú4771motor243hajtáskerhtmszabályozásXVIItartalomjavitasvezérlésRak

Forrás: pepitahirdeto.multiapro.com

Autókölcsönző, autókölcsönzés, bérautó, autóbérlés, kaució nélkül!! Nonstop autóbérlés, kilométer megkötés és kaució nélkül, Napi 5.000.-Ft. Hosszútávra megegyezés szerint, Fiatal, megbízható, rendszeresen karbantartott kis fogyasztású autóból álló flotta. Honlap: www.berelhetoauto.hupont.hu


Feladva: 2015-10-25    [Autó - Motor - Jármű]

Címkék, kulcsszavak: autóbérlésautókölcsönzésgyőrautónélkülbérelhetőkauciósopronmosonmegbízhatóNonstophupontFiatalbérautóberelhetoautoszerintmegyébenAutókölcsönzőálló

Forrás: pepitahirdeto.multiapro.com

A Spirulina Chlorella algák ajánlottak allergia, Chron-betegség, ízületi bántalmak kezeléséhez, valamint a szervezet tápanyag raktárainak feltöltéséhez. Bár parányi élőlényekről van szó, hihetetlen mennyiségű vitamint, nyomelemet, ásványi anyagot, telítetlen zsírsavat és esszenciális aminosavat tartalmaznak, köztük szép számmal olyanokat is, melyeket a szervezet önmaga nem tud előállítani. A Chlorella Spirulina együttes fogyasztásával a természetes összetevők még tovább erősítik egymás hatását, ... további részletek >>

legyen szó immunerősítésről vagy az erőnlét és a közérzet javításáról. Kitűnő anyagcserefokozók, lúgosítók és méregtelenítők, segítenek a betegségek megelőzésében. Spirulina alga bolt itt!


Feladva: 2018-02-13    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: SpirulinaChlorellaszervezetszóerősítikBárönmagaajánlottakKitűnőtelítetlentovábbfeltöltéséhezalgákittjavításárólanyagotmégraktárainakmelyeketvan

Forrás: pepitahirdeto.multiapro.com

Olyan vendéglátóipari szakképesítést szeretnél, amivel könnyedén nyithatsz egy Street Food éttermet? Mindig is imádtad a gasztronómiai különlegességeket? Szívesen készítenél diétás, gluténmentes vagy laktózmentes ételeket? Jelentkezz Budapesten induló Szakács OKJ-s tanfolyamunkra! A tanfolyamra való jelentkezéshez csak alapfokú iskolai végzettség szükséges, így szakmai előképzettség nélkül jelentkezhetsz. 9 hónap, kitartó tanulás, sikeres vizsgák és már a kezedben is van az OKJ-s bizonyítvány. ... további részletek >>

Ha szeretnél kiemelkedő gasztronómiai tudást szerezni, akkor a Szakács szakma Neked való. Nincs más dolgod, csak kattints a honlapunkra és jelentkezz a tanfolyamra: www.tanfolyamokj.hu/szakacs-okj-s-tanfolyam-budapesten-a-xi-keruletben


Feladva: 2017-10-26    [Oktatás - Tanfolyam]

Címkék, kulcsszavak: okjbudapestenSzakácsjelentkezzcsakgasztronómiaitanfolyamszeretnélvalótanfolyamokjtanfolyamravégzettségakkorkészítenélsikeresamivelhonlapunkratudást

Forrás: pepitahirdeto.multiapro.com

100 % Guido Maria Kretschmer két illatban. Egy neked és egy neki. A tervező végre valóra válthatta régi álmát, hiszen együttműködésben az LR-rel megalkothatta első saját parfümkollekcióját. A parfümök különlegessége, hogy az illatok Guido Maria Kretschmer személyiségéhez köthetők: mint divattervező, mint művész, mint ember. „Nem csak csábítani akarok, hanem megérinteni is“, ez a tervező vezérelve...


Feladva: 2016-04-23    [Szépség - Kozmetika - Parfüm]

Címkék, kulcsszavak: GuidomintMariatervező8220egyKretschmeregyüttműködésbenkétcsakhiszen100NemillatokálmátPécs8222hogyrégiÉvaemberkülönlegességeválthattarel

Forrás: pepitahirdeto.multiapro.com

Ami egy házhoz kell Ha többet akar tudni, nézzen körül Akció !!!!!!!!! Itt www.vteam.hu www.vteam.hu/Komuves-munka www.vteam.hu/Kerites-epites www.vteam.hu/Lakasfelujitas Lakásfelújítás legkisebbtől a legnagyobbig. Ingyenes árajánlat. Mindenféle, ami egy ház és lakáshoz kell Viacolor- térburkolat Lakásfelújítás burkoló munkák Kerítés építése Gipszkarton Kőműves munkák Dryvitozás homlokzatjavítás Ajtó ablak csere Falazás, vakolás


Feladva: 2015-03-10    [Építés - Építőanyag - Szerelvény]

Címkék, kulcsszavak: vteamwwwhttpmunkákKőművesegyamiKerítésLakásfelújításlegnagyobbiglegkisebbtőlkellDryvitozástöbbetlakáshozházhozházkerepitesGipszkartonXXIII

Forrás: pepitahirdeto.multiapro.com

Szeretné, ha haja egészséges, csillogó és dús lenne? Szeretne kellemes környezetben, igazi szakemberek által gyógyulni, szépülni? Nem elégedett a boltokban kapható hajápoló termékekkel? Szalonunk a következő szolgáltatásokat ajánlja: -Hajgyógyászati kezelések: hajhullás, kopaszodás, korpa, zsírosodás, száraz, vékony, töredezett haj és fejbőr panaszok problémájára. Több mint 20 éves tapasztalattal! Személyre szabott kezelési programok, professzionális gyógyászati anyagok, komfortos érzés ... további részletek >>

kezelés közben! Mikrokamerás hajdiagnosztika, fejbőr és hajvizsgálat -Biofodrászat: Haj-állapotfelmérés speciális kamerával. Az Ön stílusának és hajszerkezetének legmegfelelőbb módszerekkel dolgozunk. Vegyszermentes hajfestés a haj szerkezetét erősítő festékkel, (maximális őszfedéssel) Természetes eredetű styling anyagok (hajhab, zselé, hajlakk), melyek meg is vásárolhatóak! Referenciaszalonunkban speciális, biológiailag aktív növényi hatóanyagokkal dolgozunk! Hajmosás, styling, vágás személyre szabottan, az ön haj-és fejbőrtípusának megfelelően. Ionos hajszárítás, kolloid ásványi anyagokkal történő hajfeltöltés. Vegyszermentes hajfestés, hajszerkezet-visszaépítés, vékonyszálú haj erősítése Egyedülálló, a hajszálak szerkezetébe beépülő biológiailag aktív növényi hatóanyagaink biztosítják, hogy az Ön frizurája nemcsak szép, hanem egészséges is legyen!


Feladva: 2017-06-30    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: hajBiofodrászatnövényifejbőraktívhajfestésSzeretnebiológiailagVegyszermentesegészségesszemélyrekezelésekstylingHajgyógyászatianyagokdolgozunkNovotni

Forrás: pepitahirdeto.multiapro.com

Ha nem tudjuk pontosan hol és hogyan jelenik meg a hirdetésünk, akkor valójában csak hisszük, hogy hirdetünk! A PEPITA HIRDETŐ is weboldal, éppen ugyan úgy látja a legtöbb internetes kereső, mint minden más weboldalt... Sajnálatos, de a legtöbb hirdetni szándékozó nem is tudja, hogy mit is kellene tennie hirdetése kereshetővé tételéhez, megtalálhatóságához. Vélhetően azért kívánnak hirdetni is, mert saját weboldalaikkal nem tudják a kívánt webforgalmat elérni! Prémium kiemelést kérő ... további részletek >>

hirdetőink számára ezt a problémát megoldjuk! Minden Pepita oldalunkon megtalálható Google keresőnkben a hirdetése mellett az összes weboldalrészletét is megjelenítjük önálló keresési találatként. További részleteket ezen az oldalunkon talál: www.pepitahirdeto.multiapro.com/apro.php?page_id=60547 Megjelenési, kereshetőségi garanciát kizárólag kért hirdetésekre és megbeszélés alapján vállalunk!


Feladva: 2015-12-21    [Internet - Weboldal - Érdekes]

Címkék, kulcsszavak: PepitaHirdetőakikmegjelenéstbeállításukkalrendelkeznekKiemeltHatékonyabbSpeciálishirdetésseltulajdonosnakérdeklődőketaktívwebáruházmegfogadniirányítják

Forrás: pepitahirdeto.multiapro.com

Béreljen riasztó rendszert és 3 év után az öné! Vagy válasszon akciós csomagjaink közül! Telepítéseinket az egész ország területén végezzük!


Feladva: 2016-10-17    [Biztonság - Őrzés - Védelem]

Címkék, kulcsszavak: riasztóSzolnokközülFerenccsomagjainkSzekeresakciósbefektetésselválasszonkisVagyrendszerönéutánrendszert5322126Béreljenriasztotgyorsan

Forrás: pepitahirdeto.multiapro.com

Figyelmedbe ajánlom, ha passzív jövedelem forrást keresel!


Feladva: 2017-10-26    [Pénzkeresés - MLM]

Címkék, kulcsszavak: firstcoinforrástjövedelempasszívajánlomFigyelmedbeCsabanhelyvalutájadigitáliswwwjövőhttpkeresel

Forrás: pepitahirdeto.multiapro.com

Eladó egy 23 négyzetméteres, összkomfortos üzlethelyiség forgalmas, budai metrófeljáróval szemben. Naponta minimum 25–35 ezer ember halad el az üzlet előtt, tehát az extra nagy forgalom garantált. Irányár: 1,5 millió Ft/m2. Az üzletnek jelenleg tartós bérlője van, tehát befektetésnek is jó, mert magas havi jövedelmet eredményez. Ajánlati szám: VSZ/00151/16/07


Feladva: 2017-12-01    [Ház - Lakás - Ingatlan]

Címkék, kulcsszavak: tehátbudaiVSZüzlethelyiségEladónagymetrófeljáróvalextra00151vanelőttforgalmasbérlőjeüzletszámtartóshaladAjánlatiösszkomfortosjelenlegember

Forrás: pepitahirdeto.multiapro.com

Autóbontók bontott alkatrészei egy helyen, az ország legnagyobb bontott alkatrész webáruházában: - Több, mint 250.000 db bontott alkatrész! - Pénz-visszafizetési garancia 15 napig - Házhoz szállítás másnapra - Magánszemélyek és viszonteladók kiszolgálása. A https://bontoplaza.hu webáruházban magyar autóbontók kínálatából vásárolhat karosszéria, fék, futómű, elektromos és motorikus alkatrészt., jelenleg az alábbi modellekhez: Alfa Romeo, Audi, BMW, Chevrolet, Chrysler, Citroen, Dacia, ... további részletek >>

Daewoo, Daihatsu, Fiat, Ford, Honda, Hyundai, Infiniti, Iveco, Jaguar, Jeep, Kia, Lada, Lancia, Land Rover, Lexus, Man, Mazda, Mercedes-Benz, Mini, Mitsubishi, Nissan, Opel, Peugeot, Porsche, Renault, Rover, Saab, Seat, Skoda, Smart, Ssangyong, Subaru, Suzuki, Toyota, Volvo, VW Volkswagen.


Feladva: 2016-10-15    [Autó - Motor - Jármű]

Címkék, kulcsszavak: bontottautóbontókhttpRoverhelyenegyalkatrészeialkatrészbontoplazaMazdafékHyundaiszállításAudiwebáruházábanMankarosszériaVolkswagenHondaHázhoz

Forrás: pepitahirdeto.multiapro.com

Divatos choker nyakláncok most akciós áron a Lili Bizsu webáruházban Emellett több mint 1000 féle ékszer és divatkiegészítő nagyon kedvező áron kedvezményekkel www.lilibizsu.hu/modules.php?name= lista&id=58835ba0e2876-STRASSZKOVES


Feladva: 2018-02-24    [Óra - Ékszer - Nemesfém]

Címkék, kulcsszavak: BizsuLiliakciósnyakláncokchokeráronkedvezőnagyondivatkiegészítőmostékszerféle1000DivatosmintWEBÁRUHÁZtöbbEmellettkedvezményekkelwebáruházban

Forrás: pepitahirdeto.multiapro.com

Könyvelés és bérszámfejtés kedvező áron Angyalföldön a Full Active Bt. könyvelőirodában. Egyéni vállalkozások és társas vállalkozások könyvelése kedvező áron. SZJA bevallás magánszemélyeknek kedvező áron. Könyvelését bízza hozzáértőkre! Visszamenőleges könyvelést is vállalunk. Ha bármilyen kérdése lenne könyvelés ügyben, keressen minket bizalommal. Tel: 412-08-06, Fax: 412-08-07


Feladva: 2015-01-20    [Üzlet - Befektetés - Pénzügyek]

Címkék, kulcsszavak: áronkedvezőkönyvelésActiveFullAngyalföldönbérszámfejtés412vállalkozásokhozzáértőkreEgyéniminketbízzakönyvelőirodábankeressenKönyvelésétügybenlenne

Forrás: pepitahirdeto.multiapro.com

A születésnapi idézetes papírtekercset minden férfi ismerősünknek ajánljuk, mely egyedi ajándék bármely korosztálynak. Termékleírás: Papírtekercs, színes szalaggal átkötve, fapálcikára feszítve, amelynek végei fagolyócskákkal vannak lezárva. Méret: 21cm X 16cm Itt található: www.dekorkucko.hu/papirtekercs-fer fi-szulinapi-koszonto


Feladva: 2017-04-27    [Irodaszer - Dísztárgy - Ajándék]

Címkék, kulcsszavak: ferfipapirtekercskoszontoszulinapiátkötveminden16cmszalaggalpapírtekercset21cmszínesidézetesMéretTermékleírásszületésnapilezárvakorosztálynakvannak

Forrás: pepitahirdeto.multiapro.com

Velence-korzón Novotny Hajgyógyászat és Biofodrászat szépség szalon! Nemzetközi diplomával rendelkező hajgyógyászunk várja szeretettel. 23 éves tapasztalattal személyre szabottan analizáljuk és megoldjuk problémáját: - hajhullás - roncsolt haj Kezelés színenergiával és biológiailag aktív hatóanyagokkal. Tudományos, orvos-technikai módszerek, mikro-kamerás haj- és fejbőr vizsgálat. Vegyszermentes hajfestés, dauerolás. Kérjen időpontot!


Feladva: 2018-02-22    [Egészség - Gyógyászat - Gondozás]

Címkék, kulcsszavak: VelenceHajgyógyászatNovotnyhajKezelésvárjakamerásroncsolthajgyógyászunkmikroGabriellahajhullásrendelkezőmódszerekNovotniproblémájátidőpontotKérjen

Forrás: pepitahirdeto.multiapro.com

Legjobb Replica Tökéletes 1: 1 Clone iPhone X Tartalmazza a iphone X Earpods az USB kábellel és USB tápegységgel. Támogatás: GSM, UMTS, TD - SCDMA és LTE (FDD és TD) mobil technológiák Wi-Fi, Bluetooth, NFC Real 4G LTE arcazonosítóval A hardveres elemeken nem spóroltak, hiszen szuper dolgok kerültek bele, mint a dupla előlapi kamera, vagy a 64 GB memória és 256 GB háttértár. iPhone X Clone-t, hogy ellenőrizze, minden esztétikája tökéletesen illeszkedik és nagyon közel van az UI-hoz az ... további részletek >>

iOS 11-hez képest. Ez az iPhone X 256 GB-os modellje Garancia nélkül! +3620/3266764


Feladva: 2017-12-13    [Számítástechnika - Mobiltelefon]

Címkék, kulcsszavak: iPhone256LTEUSBCloneesztétikájaTámogatásmintEladómindentápegységgelbeleKinábólképestRealellenőrizzekerültekKlónhezNFChogykábelleldolgok

Forrás: pepitahirdeto.multiapro.com

Daruzással kapcsolatos munkák végzése. Gép, konténer, építőanyag szállítása, daruzása! Kis helyekre 1 tonnás mini darus autónk van!


Feladva: 2017-01-02    [Szállítás - Szállítmányozás]

Címkék, kulcsszavak: darusmunkákminikapcsolatostonnásDaruzássalhelyekre